1Y2OA

Structure of n-terminal domain irsp53/baiap2
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
248
structure length
248
Chain Sequence
MSLSRSEEMHRLTENVYKTIMEQFNPSLRNFIAMGKNYEKALAGVTYAAKGYFDALVKMGELASESQGSKELGDVLFQMAEVHRQIQNQLEEMLKSFHNELLTQLEQKVELDSRYLSAALKKYQTEQRSKGDALDKCQAELKKLRKKSQGSKNPQKYSDKELQYIDAISNKQGELENYVSDGYKTALTEERRRFCFLVEKQCAVAKNSAAYHSKGKELLAQKLPLWQQACADPSKIPERAVQLMQQVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords BAI1-associated protein 2 isoform 1
publication title Structural basis of filopodia formation induced by the IRSp53/MIM homology domain of human IRSp53
pubmed doi rcsb
source organism Homo sapiens
total genus 102
structure length 248
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08397 IMD IRSp53/MIM homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 1y2oA00
3ABHA 1Y2OA 1WDZA 3ACOA 1X04A 3HAJA 4BNEA 3I2WA 2RAJA 2EFKA 3HAHA 4FZSA 5C5BA 3Q0KA 3DYTA 4NQIA 3SYVA 4AVMA 3OK8A 2EFLA 4DYLA 1I4LA 4AKVA 2X3VA 2YKTA 1I4TA 2D4CA 2RAKA 2V0OA 2X3XA 3LLLA 2X3WA 3CAZA 3Q84A 4NSWA 5C5BB 1I4DA 2Z0NA 3G9GA 1URUA 4ATMA 2Z0OA 3HAIA 2Z0VA 4I1QA 1X03A 2Q13A 4H8SA 4WPCA 4WPEA 3M3WA 2D1LA 4DCNC 2ELBA 1ZWWA 1I49A 2C08A 2Q12A 3QE6A 3PLTA 2RAIA 3QWEA 2FICA 3SOGA 3QNIA
chains in the Genus database with same CATH superfamily
4EZUA 2GF4A 4EZWA 2GAFD 3C7NA 4FZPA 2F1AA 2YKTA 2OW7A 4EZVA 3CZNA 3QA8A 2Q12A 3BVUA 4IM3A 4FZOA 2QKWA 3CKDA 3ERCC 1LQ7A 3BVTA 2YLAA 5C5BA 1R33A 3SYVA 4AZHA 4DYLA 2ALWA 3KDRA 4UDYX 3G9GA 4R5LA 4EZTA 1PS3A 1URUA 5FIGA 2Z0OA 3O3NB 3T49A 4AZGA 5FLEX 3O3OB 4E81A 1TQVA 5E84A 2OO2A 4M0MA 3DX3A 3RV0A 3DX1A 3VEAA 3CZSA 4FM3A 3DPQA 1DKZA 4EZQA 3CV5A 3D2EA 3QE6A 3PLTA 1SU7A 4AZ5A 4EZOA 2WINM 3D2FA 1GNTA 3OK8A 4F00A 1O7DB 3I39X 3BUPA 2QFFA 3BUDA 2Q13A 3UITA 2EWFA 2YL5A 2F7RA 2EFKA 1YWMA 2OW6A 2YI8A 3EJSA 2LM0A 4IW0A 3BVVA 2EX3B 4R5GA 2ND0A 3QNJA 4WPEA 3EJUA 4EZXA 2KHOA 3ACOA 3DX0A 3ER8C 1OAOA 3Q0KA 4KIKA 2YL6A 3OHXM 1TQWA 2ZXQA 4KIKB 2QXLA 1GNLA 1U00A 4IM2A 2RT6A 4JWCA 2JNSA 1TQSA 2YIVX 3QNIA 3RV1A 4JLCA 4NPHA 2X5CA 3DX4A 4JNFA 1QWNA 3B53X 3CAZA 4JN4A 4ATMA 1DKYA 2JNKA 3VEBA 2C08A 3B51X 1E9VA 3LMFA 3VKHA 1E1DA 4NQIA 1UPXA 2MI7A 2V0OA 2Z8YA 3LLLA 4NSWA 2F7QA 2YL9A 2Z0VA 1SU8A 3EJPA 4AZCA 3I01A 2ELBA 2RAIA 4AZ6A 3ABHA 4UDXX 1OA1A 3DPPA 4AZCB 1O7DC 5TKYA 1E2UA 2EFLA 1I4LA 2GA9D 4JWIA 4R5KA 3L3OM 2Z0NA 3DX2A 1X03A 4G6QA 3T4AG 1I49A 3BUQA 2F18A 3T48A 1WDZA 2NCZA 4E3CA 4IWPA 2N3KA 3F7WA 3Q84A 3I04A 1HTYA 3KAWA 3GI7A 3DPOA 2OBLA 2F7OA 1DKXA 2OBMA 3OWGA 4B9QA 3BUBA 4EZSA 1SU6A 3DYTA 2F7PA 2YI9A 4EZRA 1HXKA 1I4DA 4HYBA 3LVTA 3D52A 2D1LA 4DCNC 1W9MA 3D51A 4R5JA 3SOGA 2RAJA 3EJTA 2WYIA 4AVMA 1OA0A 4EZZA 1I4TA 3T47A 4D8JA 4I1QA 4AZBA 3BLBA 4H6HA 4IWQA 4HY9A 3RPMA 4JWEA 3QWEA 2OZNB 2YL8A 3HAJA 4FZSA 3O3MB 4JNEA 4H6IA 1TQTA 4AKVA 1GN9A 4JL9A 3L3PA 2D4CA 3BUIA 4IM0A 5C5BB 3HAIA 2YIAA 2PY6A 2ND1A 3B52X 2YIBA 4R5IA 1Y2OA 3EJRA 1X04A 3BVWA 3I2WA 3HAHA 2YLLA 3DDGA 2O0I1 1SUFA 4WPCA 1QX1A 3M3WA 3DDFA 1ZYLA 2PMRA 4EZYA 3FD9A 4IWOA 4BNEA 2WYHA 1MJGA 2RAKA 2X3XA 2X3WA 3ZEDA 4EZPA 3D4YA 1QWUA 5KBPA 2F1BA 4PO2A 4H8SA 1JQKA 1HWWA 3D50A 3A98A 2FICA 3BVXA 2LXYA 3EJQA 3KAVA 4EZNA 3T46A 2X3VA 4HR1A 3CVRA 3ER9B 3D4ZA 4AZIA 1R5EA 2FYVA 4HR1B 4AZ7A 1TQUA 1ZWWA 4JWDA 4F01A 1R34A
chains in the Genus database with same CATH topology
3ABHA 1Y2OA 1WDZA 3ACOA 1X04A 3HAJA 4BNEA 3I2WA 2RAJA 2EFKA 3HAHA 4FZSA 5C5BA 3Q0KA 3DYTA 4NQIA 3SYVA 4AVMA 3OK8A 2EFLA 4DYLA 1I4LA 4AKVA 2X3VA 2YKTA 1I4TA 2D4CA 2RAKA 2V0OA 2X3XA 3LLLA 2X3WA 3CAZA 3Q84A 4NSWA 5C5BB 1I4DA 2Z0NA 3G9GA 1URUA 4ATMA 2Z0OA 3HAIA 2Z0VA 4I1QA 1X03A 2Q13A 4H8SA 4WPCA 4WPEA 3M3WA 2D1LA 4DCNC 2ELBA 1ZWWA 1I49A 2C08A 2Q12A 3QE6A 3PLTA 2RAIA 3QWEA 2FICA 3SOGA 3QNIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ABH A;  1Y2O A;  1WDZ A;  3ACO A;  1X04 A;  3HAJ A;  4BNE A;  3I2W A;  2RAJ A;  2EFK A;  3HAH A;  4FZS A;  5C5B A;  3Q0K A;  3DYT A;  4NQI A;  3SYV A;  4AVM A;  3OK8 A;  2EFL A;  4DYL A;  1I4L A;  4AKV A;  2X3V A;  2YKT A;  1I4T A;  2D4C A;  2RAK A;  2V0O A;  2X3X A;  3LLL A;  2X3W A;  3CAZ A;  3Q84 A;  4NSW A;  5C5B B;  1I4D A;  2Z0N A;  3G9G A;  1URU A;  4ATM A;  2Z0O A;  3HAI A;  2Z0V A;  4I1Q A;  1X03 A;  2Q13 A;  4H8S A;  4WPC A;  4WPE A;  3M3W A;  2D1L A;  4DCN C;  2ELB A;  1ZWW A;  1I49 A;  2C08 A;  2Q12 A;  3QE6 A;  3PLT A;  2RAI A;  3QWE A;  2FIC A;  3SOG A;  3QNI A; 
#chains in the Genus database with same CATH topology
 4EZU A;  2GF4 A;  4EZW A;  2GAF D;  3C7N A;  4FZP A;  2F1A A;  2YKT A;  2OW7 A;  4EZV A;  3CZN A;  3QA8 A;  2Q12 A;  3BVU A;  4IM3 A;  4FZO A;  2QKW A;  3CKD A;  3ERC C;  1LQ7 A;  3BVT A;  2YLA A;  5C5B A;  1R33 A;  3SYV A;  4AZH A;  4DYL A;  2ALW A;  3KDR A;  4UDY X;  3G9G A;  4R5L A;  4EZT A;  1PS3 A;  1URU A;  5FIG A;  2Z0O A;  3O3N B;  3T49 A;  4AZG A;  5FLE X;  3O3O B;  4E81 A;  1TQV A;  5E84 A;  2OO2 A;  4M0M A;  3DX3 A;  3RV0 A;  3DX1 A;  3VEA A;  3CZS A;  4FM3 A;  3DPQ A;  1DKZ A;  4EZQ A;  3CV5 A;  3D2E A;  3QE6 A;  3PLT A;  1SU7 A;  4AZ5 A;  4EZO A;  2WIN M;  3D2F A;  1GNT A;  3OK8 A;  4F00 A;  1O7D B;  3I39 X;  3BUP A;  2QFF A;  3BUD A;  2Q13 A;  3UIT A;  2EWF A;  2YL5 A;  2F7R A;  2EFK A;  1YWM A;  2OW6 A;  2YI8 A;  3EJS A;  2LM0 A;  4IW0 A;  3BVV A;  2EX3 B;  4R5G A;  2ND0 A;  3QNJ A;  4WPE A;  3EJU A;  4EZX A;  2KHO A;  3ACO A;  3DX0 A;  3ER8 C;  1OAO A;  3Q0K A;  4KIK A;  2YL6 A;  3OHX M;  1TQW A;  2ZXQ A;  4KIK B;  2QXL A;  1GNL A;  1U00 A;  4IM2 A;  2RT6 A;  4JWC A;  2JNS A;  1TQS A;  2YIV X;  3QNI A;  3RV1 A;  4JLC A;  4NPH A;  2X5C A;  3DX4 A;  4JNF A;  1QWN A;  3B53 X;  3CAZ A;  4JN4 A;  4ATM A;  1DKY A;  2JNK A;  3VEB A;  2C08 A;  3B51 X;  1E9V A;  3LMF A;  3VKH A;  1E1D A;  4NQI A;  1UPX A;  2MI7 A;  2V0O A;  2Z8Y A;  3LLL A;  4NSW A;  2F7Q A;  2YL9 A;  2Z0V A;  1SU8 A;  3EJP A;  4AZC A;  3I01 A;  2ELB A;  2RAI A;  4AZ6 A;  3ABH A;  4UDX X;  1OA1 A;  3DPP A;  4AZC B;  1O7D C;  5TKY A;  1E2U A;  2EFL A;  1I4L A;  2GA9 D;  4JWI A;  4R5K A;  3L3O M;  2Z0N A;  3DX2 A;  1X03 A;  4G6Q A;  3T4A G;  1I49 A;  3BUQ A;  2F18 A;  3T48 A;  1WDZ A;  2NCZ A;  4E3C A;  4IWP A;  2N3K A;  3F7W A;  3Q84 A;  3I04 A;  1HTY A;  3KAW A;  3GI7 A;  3DPO A;  2OBL A;  2F7O A;  1DKX A;  2OBM A;  3OWG A;  4B9Q A;  3BUB A;  4EZS A;  1SU6 A;  3DYT A;  2F7P A;  2YI9 A;  4EZR A;  1HXK A;  1I4D A;  4HYB A;  3LVT A;  3D52 A;  2D1L A;  4DCN C;  1W9M A;  3D51 A;  4R5J A;  3SOG A;  2RAJ A;  3EJT A;  2WYI A;  4AVM A;  1OA0 A;  4EZZ A;  1I4T A;  3T47 A;  4D8J A;  4I1Q A;  4AZB A;  3BLB A;  4H6H A;  4IWQ A;  4HY9 A;  3RPM A;  4JWE A;  3QWE A;  2OZN B;  2YL8 A;  3HAJ A;  4FZS A;  3O3M B;  4JNE A;  4H6I A;  1TQT A;  4AKV A;  1GN9 A;  4JL9 A;  3L3P A;  2D4C A;  3BUI A;  4IM0 A;  5C5B B;  3HAI A;  2YIA A;  2PY6 A;  2ND1 A;  3B52 X;  2YIB A;  4R5I A;  1Y2O A;  3EJR A;  1X04 A;  3BVW A;  3I2W A;  3HAH A;  2YLL A;  3DDG A;  2O0I 1;  1SUF A;  4WPC A;  1QX1 A;  3M3W A;  3DDF A;  1ZYL A;  2PMR A;  4EZY A;  3FD9 A;  4IWO A;  4BNE A;  2WYH A;  1MJG A;  2RAK A;  2X3X A;  2X3W A;  3ZED A;  4EZP A;  3D4Y A;  1QWU A;  5KBP A;  2F1B A;  4PO2 A;  4H8S A;  1JQK A;  1HWW A;  3D50 A;  3A98 A;  2FIC A;  3BVX A;  2LXY A;  3EJQ A;  3KAV A;  4EZN A;  3T46 A;  2X3V A;  4HR1 A;  3CVR A;  3ER9 B;  3D4Z A;  4AZI A;  1R5E A;  2FYV A;  4HR1 B;  4AZ7 A;  1TQU A;  1ZWW A;  4JWD A;  4F01 A;  1R34 A; 
#chains in the Genus database with same CATH homology
 3ABH A;  1Y2O A;  1WDZ A;  3ACO A;  1X04 A;  3HAJ A;  4BNE A;  3I2W A;  2RAJ A;  2EFK A;  3HAH A;  4FZS A;  5C5B A;  3Q0K A;  3DYT A;  4NQI A;  3SYV A;  4AVM A;  3OK8 A;  2EFL A;  4DYL A;  1I4L A;  4AKV A;  2X3V A;  2YKT A;  1I4T A;  2D4C A;  2RAK A;  2V0O A;  2X3X A;  3LLL A;  2X3W A;  3CAZ A;  3Q84 A;  4NSW A;  5C5B B;  1I4D A;  2Z0N A;  3G9G A;  1URU A;  4ATM A;  2Z0O A;  3HAI A;  2Z0V A;  4I1Q A;  1X03 A;  2Q13 A;  4H8S A;  4WPC A;  4WPE A;  3M3W A;  2D1L A;  4DCN C;  2ELB A;  1ZWW A;  1I49 A;  2C08 A;  2Q12 A;  3QE6 A;  3PLT A;  2RAI A;  3QWE A;  2FIC A;  3SOG A;  3QNI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...