1Y2OA

Structure of n-terminal domain irsp53/baiap2
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
248
structure length
248
Chain Sequence
MSLSRSEEMHRLTENVYKTIMEQFNPSLRNFIAMGKNYEKALAGVTYAAKGYFDALVKMGELASESQGSKELGDVLFQMAEVHRQIQNQLEEMLKSFHNELLTQLEQKVELDSRYLSAALKKYQTEQRSKGDALDKCQAELKKLRKKSQGSKNPQKYSDKELQYIDAISNKQGELENYVSDGYKTALTEERRRFCFLVEKQCAVAKNSAAYHSKGKELLAQKLPLWQQACADPSKIPERAVQLMQQVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BAI1-associated protein 2 isoform 1
publication title Structural basis of filopodia formation induced by the IRSp53/MIM homology domain of human IRSp53
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 102
structure length 248
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08397 IMD IRSp53/MIM homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 1y2oA00
1Y2OA 2EFLA 3Q84A 2Q13A 2X3VA 3QE6A 4AKVA 4H8SA 4NQIA 4NSWA 2D4CA 4BNEA 2C08A 2RAIA 4ATMA 2X3WA 4WPEA 1I4TA 2X3XA 3QWEA 1ZWWA 3CAZA 1X04A 4DCNC 1URUA 3HAIA 2D1LA 3M3WA 3SYVA 3LLLA 5C5BA 1I4LA 4I1QA 2ELBA 4AVMA 1I49A 2EFKA 4DYLA 1I4DA 3ACOA 3I2WA 4FZSA 1WDZA 3OK8A 2Q12A 2V0OA 3Q0KA 1X03A 3DYTA 4WPCA 3HAJA 5C5BB 2RAJA 2Z0NA 3G9GA 3QNIA 2Z0OA 2RAKA 2YKTA 3PLTA 3ABHA 3SOGA 3HAHA 2Z0VA 2FICA
chains in the Genus database with same CATH superfamily
3BVVA 2Q13A 4NQIA 4FM3A 3QWEA 1TQSA 4HR1A 3CVRA 3D50A 3LMFA 2ZXQA 5KBPA 2EWFA 4EZXA 3CKDA 2Z0NA 3VEAA 3L3OM 2GA9D 4EZVA 3BVXA 4EZRA 2PMRA 4IM0A 3EJTA 3UITA 2YI8A 3BUIA 1R33A 1I4LA 3EJRA 2O0I1 1I4DA 5FIGA 1UPXA 1E2UA 2FYVA 3QA8A 3VKHA 1DKYA 1OA1A 1HTYA 2YI9A 1DKXA 3SYVA 1O7DC 3I01A 3T4AG 1MJGA 2ND0A 4FZSA 3G9GA 2GAFD 3I39X 3T46A 3DDGA 2YLAA 5TKYA 3DX4A 4EZWA 4FZPA 4AZHA 4HR1B 3EJSA 3ACOA 1X03A 3GI7A 4AZGA 3PLTA 3BVWA 3SOGA 3O3NB 1LQ7A 3DX3A 2D4CA 4EZPA 4ATMA 4F00A 1X04A 1TQVA 1I49A 3DX2A 2OBMA 2V0OA 4WPCA 2RAJA 4AZBA 1E9VA 3D51A 1HWWA 4JWIA 1O7DB 3KAVA 2YIAA 1SU6A 4FZOA 3BUQA 2PY6A 4KIKA 1GNLA 2RT6A 2EFKA 3I2WA 4M0MA 3D52A 2ND1A 4UDYX 3ABHA 4NPHA 1Y2OA 3LVTA 2YLLA 5E84A 4EZSA 2F18A 2X3WA 3T49A 3BUBA 3LLLA 3ER8C 4JLCA 1SU8A 3D2FA 1WDZA 1R5EA 4IM2A 3DX1A 2YIVX 3DPQA 3OWGA 3Q84A 4R5GA 4H8SA 4PO2A 4AZ6A 3QNJA 4JNFA 1ZWWA 1URUA 4AZCA 2D1LA 4R5KA 4IWQA 4HYBA 4B9QA 3O3OB 3OK8A 2YIBA 1GN9A 3D4ZA 3QNIA 2OW6A 3I04A 1SUFA 1HXKA 3EJPA 4AKVA 4JN4A 2YL9A 2RAIA 4G6QA 4JWDA 3KAWA 3VEBA 3BVTA 4I1QA 3KDRA 4H6HA 3ERCC 2LM0A 3OHXM 4UDXX 4EZQA 2F7RA 2EX3B 3ZEDA 1OA0A 1YWMA 2F1BA 4IW0A 3DPOA 3CAZA 2NCZA 1SU7A 2JNSA 2YL5A 3B52X 2WYHA 2OBLA 1OAOA 2RAKA 2OZNB 1R34A 4E3CA 1TQUA 3BLBA 1QX1A 4EZUA 2X5CA 3FD9A 2C08A 4JWEA 4EZTA 3A98A 2YL6A 2KHOA 1U00A 3B53X 4AZCB 4D8JA 1TQTA 1E1DA 3DYTA 4WPEA 2WYIA 4IWPA 4BNEA 3DX0A 2F7QA 4DCNC 2F7OA 2ELBA 3BUDA 4AVMA 4DYLA 4IWOA 4JWCA 2JNKA 4JNEA 1TQWA 2OW7A 3EJQA 4HY9A 2X3VA 1ZYLA 3DPPA 4E81A 2QXLA 4AZ5A 1I4TA 2X3XA 4H6IA 2F1AA 5C5BA 1QWNA 3L3PA 1DKZA 1W9MA 3B51X 2Z0VA 2FICA 2EFLA 4IM3A 2MI7A 2YL8A 5FLEX 3HAIA 4EZNA 3BVUA 3M3WA 3ER9B 2N3KA 4KIKB 3O3MB 3Q0KA 4JL9A 2QKWA 3HAJA 3D4YA 2YKTA 3BUPA 2GF4A 3RV0A 2WINM 4AZIA 1GNTA 3RPMA 3T47A 4R5IA 4R5LA 3CV5A 4EZZA 3D2EA 1JQKA 2Z0OA 1QWUA 2QFFA 3EJUA 3QE6A 3T48A 4EZYA 1PS3A 3F7WA 4NSWA 3RV1A 3DDFA 2F7PA 2ALWA 4EZOA 2LXYA 3CZSA 4R5JA 4F01A 3CZNA 2Q12A 2Z8YA 4AZ7A 5C5BB 2OO2A 3C7NA 3HAHA
chains in the Genus database with same CATH topology
1Y2OA 2EFLA 3Q84A 2Q13A 2X3VA 3QE6A 4AKVA 4H8SA 4NQIA 4NSWA 2D4CA 4BNEA 2C08A 2RAIA 4ATMA 2X3WA 4WPEA 1I4TA 2X3XA 3QWEA 1ZWWA 3CAZA 1X04A 4DCNC 1URUA 3HAIA 2D1LA 3M3WA 3SYVA 3LLLA 5C5BA 1I4LA 4I1QA 2ELBA 4AVMA 1I49A 2EFKA 4DYLA 1I4DA 3ACOA 3I2WA 4FZSA 1WDZA 3OK8A 2Q12A 2V0OA 3Q0KA 1X03A 3DYTA 4WPCA 3HAJA 5C5BB 2RAJA 2Z0NA 3G9GA 3QNIA 2Z0OA 2RAKA 2YKTA 3PLTA 3ABHA 3SOGA 3HAHA 2Z0VA 2FICA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y2O A;  2EFL A;  3Q84 A;  2Q13 A;  2X3V A;  3QE6 A;  4AKV A;  4H8S A;  4NQI A;  4NSW A;  2D4C A;  4BNE A;  2C08 A;  2RAI A;  4ATM A;  2X3W A;  4WPE A;  1I4T A;  2X3X A;  3QWE A;  1ZWW A;  3CAZ A;  1X04 A;  4DCN C;  1URU A;  3HAI A;  2D1L A;  3M3W A;  3SYV A;  3LLL A;  5C5B A;  1I4L A;  4I1Q A;  2ELB A;  4AVM A;  1I49 A;  2EFK A;  4DYL A;  1I4D A;  3ACO A;  3I2W A;  4FZS A;  1WDZ A;  3OK8 A;  2Q12 A;  2V0O A;  3Q0K A;  1X03 A;  3DYT A;  4WPC A;  3HAJ A;  5C5B B;  2RAJ A;  2Z0N A;  3G9G A;  3QNI A;  2Z0O A;  2RAK A;  2YKT A;  3PLT A;  3ABH A;  3SOG A;  3HAH A;  2Z0V A;  2FIC A; 
#chains in the Genus database with same CATH topology
 3BVV A;  2Q13 A;  4NQI A;  4FM3 A;  3QWE A;  1TQS A;  4HR1 A;  3CVR A;  3D50 A;  3LMF A;  2ZXQ A;  5KBP A;  2EWF A;  4EZX A;  3CKD A;  2Z0N A;  3VEA A;  3L3O M;  2GA9 D;  4EZV A;  3BVX A;  4EZR A;  2PMR A;  4IM0 A;  3EJT A;  3UIT A;  2YI8 A;  3BUI A;  1R33 A;  1I4L A;  3EJR A;  2O0I 1;  1I4D A;  5FIG A;  1UPX A;  1E2U A;  2FYV A;  3QA8 A;  3VKH A;  1DKY A;  1OA1 A;  1HTY A;  2YI9 A;  1DKX A;  3SYV A;  1O7D C;  3I01 A;  3T4A G;  1MJG A;  2ND0 A;  4FZS A;  3G9G A;  2GAF D;  3I39 X;  3T46 A;  3DDG A;  2YLA A;  5TKY A;  3DX4 A;  4EZW A;  4FZP A;  4AZH A;  4HR1 B;  3EJS A;  3ACO A;  1X03 A;  3GI7 A;  4AZG A;  3PLT A;  3BVW A;  3SOG A;  3O3N B;  1LQ7 A;  3DX3 A;  2D4C A;  4EZP A;  4ATM A;  4F00 A;  1X04 A;  1TQV A;  1I49 A;  3DX2 A;  2OBM A;  2V0O A;  4WPC A;  2RAJ A;  4AZB A;  1E9V A;  3D51 A;  1HWW A;  4JWI A;  1O7D B;  3KAV A;  2YIA A;  1SU6 A;  4FZO A;  3BUQ A;  2PY6 A;  4KIK A;  1GNL A;  2RT6 A;  2EFK A;  3I2W A;  4M0M A;  3D52 A;  2ND1 A;  4UDY X;  3ABH A;  4NPH A;  1Y2O A;  3LVT A;  2YLL A;  5E84 A;  4EZS A;  2F18 A;  2X3W A;  3T49 A;  3BUB A;  3LLL A;  3ER8 C;  4JLC A;  1SU8 A;  3D2F A;  1WDZ A;  1R5E A;  4IM2 A;  3DX1 A;  2YIV X;  3DPQ A;  3OWG A;  3Q84 A;  4R5G A;  4H8S A;  4PO2 A;  4AZ6 A;  3QNJ A;  4JNF A;  1ZWW A;  1URU A;  4AZC A;  2D1L A;  4R5K A;  4IWQ A;  4HYB A;  4B9Q A;  3O3O B;  3OK8 A;  2YIB A;  1GN9 A;  3D4Z A;  3QNI A;  2OW6 A;  3I04 A;  1SUF A;  1HXK A;  3EJP A;  4AKV A;  4JN4 A;  2YL9 A;  2RAI A;  4G6Q A;  4JWD A;  3KAW A;  3VEB A;  3BVT A;  4I1Q A;  3KDR A;  4H6H A;  3ERC C;  2LM0 A;  3OHX M;  4UDX X;  4EZQ A;  2F7R A;  2EX3 B;  3ZED A;  1OA0 A;  1YWM A;  2F1B A;  4IW0 A;  3DPO A;  3CAZ A;  2NCZ A;  1SU7 A;  2JNS A;  2YL5 A;  3B52 X;  2WYH A;  2OBL A;  1OAO A;  2RAK A;  2OZN B;  1R34 A;  4E3C A;  1TQU A;  3BLB A;  1QX1 A;  4EZU A;  2X5C A;  3FD9 A;  2C08 A;  4JWE A;  4EZT A;  3A98 A;  2YL6 A;  2KHO A;  1U00 A;  3B53 X;  4AZC B;  4D8J A;  1TQT A;  1E1D A;  3DYT A;  4WPE A;  2WYI A;  4IWP A;  4BNE A;  3DX0 A;  2F7Q A;  4DCN C;  2F7O A;  2ELB A;  3BUD A;  4AVM A;  4DYL A;  4IWO A;  4JWC A;  2JNK A;  4JNE A;  1TQW A;  2OW7 A;  3EJQ A;  4HY9 A;  2X3V A;  1ZYL A;  3DPP A;  4E81 A;  2QXL A;  4AZ5 A;  1I4T A;  2X3X A;  4H6I A;  2F1A A;  5C5B A;  1QWN A;  3L3P A;  1DKZ A;  1W9M A;  3B51 X;  2Z0V A;  2FIC A;  2EFL A;  4IM3 A;  2MI7 A;  2YL8 A;  5FLE X;  3HAI A;  4EZN A;  3BVU A;  3M3W A;  3ER9 B;  2N3K A;  4KIK B;  3O3M B;  3Q0K A;  4JL9 A;  2QKW A;  3HAJ A;  3D4Y A;  2YKT A;  3BUP A;  2GF4 A;  3RV0 A;  2WIN M;  4AZI A;  1GNT A;  3RPM A;  3T47 A;  4R5I A;  4R5L A;  3CV5 A;  4EZZ A;  3D2E A;  1JQK A;  2Z0O A;  1QWU A;  2QFF A;  3EJU A;  3QE6 A;  3T48 A;  4EZY A;  1PS3 A;  3F7W A;  4NSW A;  3RV1 A;  3DDF A;  2F7P A;  2ALW A;  4EZO A;  2LXY A;  3CZS A;  4R5J A;  4F01 A;  3CZN A;  2Q12 A;  2Z8Y A;  4AZ7 A;  5C5B B;  2OO2 A;  3C7N A;  3HAH A; 
#chains in the Genus database with same CATH homology
 1Y2O A;  2EFL A;  3Q84 A;  2Q13 A;  2X3V A;  3QE6 A;  4AKV A;  4H8S A;  4NQI A;  4NSW A;  2D4C A;  4BNE A;  2C08 A;  2RAI A;  4ATM A;  2X3W A;  4WPE A;  1I4T A;  2X3X A;  3QWE A;  1ZWW A;  3CAZ A;  1X04 A;  4DCN C;  1URU A;  3HAI A;  2D1L A;  3M3W A;  3SYV A;  3LLL A;  5C5B A;  1I4L A;  4I1Q A;  2ELB A;  4AVM A;  1I49 A;  2EFK A;  4DYL A;  1I4D A;  3ACO A;  3I2W A;  4FZS A;  1WDZ A;  3OK8 A;  2Q12 A;  2V0O A;  3Q0K A;  1X03 A;  3DYT A;  4WPC A;  3HAJ A;  5C5B B;  2RAJ A;  2Z0N A;  3G9G A;  3QNI A;  2Z0O A;  2RAK A;  2YKT A;  3PLT A;  3ABH A;  3SOG A;  3HAH A;  2Z0V A;  2FIC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...