3O3MB

(r)-2-hydroxyisocaproyl-coa dehydratase
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
373
structure length
373
Chain Sequence
MEAILSKMKEVVENPNAAVKKYKSETGKKAIGCFPVYCPEEIIHAAGMLPVGIWGGQTELDLAKQYFPAFACSIMQSCLEYGLKGAYDELSGVIIPGMCDTLICLGQNWKSAVPHIKYISLVHPQNRKLEAGVKYLISEYKGVKRELEEICGYEIEEAKIHESIEVYNEHRKTMRDFVEVAYKHSNTIKPSIRSLVIKSGFFMRKEEHTELVKDLIAKLNAMPEEVCSGKKVLLTGILADSKDILDILEDNNISVVADDLAQETRQFRTDVPAGDDALERLARQWSNIEGCSLAYDPKKKRGSLIVDEVKKKDIDGVIFCMMKFCDPEEYDYPLVRKDIEDSGIPTLYVEIDQQTQNNEQARTRIQTFAEMMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Reductive Radical Formation and Electron Recycling in (R)-2-Hydroxyisocaproyl-CoA Dehydratase.
pubmed doi rcsb
source organism Clostridium difficile
molecule tags Lyase
molecule keywords alpha subunit 2-hydroxyisocaproyl-CoA dehydratase
total genus 144
structure length 373
sequence length 373
chains with identical sequence D
ec nomenclature ec 4.2.1.157: (R)-2-hydroxyisocaproyl-CoA dehydratase.
pdb deposition date 2010-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06050 HGD-D 2-hydroxyglutaryl-CoA dehydratase, D-component
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.370 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3o3mB01
3.40.50.11890 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3o3mB02
3.40.50.11900 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3o3mB03
3O3OB 3O3NB 3O3MB
chains in the Genus database with same CATH superfamily
5JQGA 1XT6A 3RC7A 5F2KA 2Q27A 4D0NA 4C88A 4DG8A 1CZNA 1ZJ5A 4RW0A 5CK4A 3EA0A 4YT4A 2PUJA 1D4AA 3NHPA 1JEEA 4H6WA 2YVAA 3GFVA 3GRRA 4N6GA 4G4IA 2GBCA 2CFSA 1Y42X 3W8NA 1CDEA 2Y1LA 3D3EA 5B64A 1STOA 5BV2P 2YRFA 2O1WA 3G5TA 2C00A 1URPA 4U00A 3R9KA 1LTKA 3U31A 1X87A 2D00A 5IM4F 4GBGA 3RG8A 1RWKA 3WLLA 3ESZA 3S44A 3B1KA 2GJ8A 4LY6A 4I7EA 5DHRA 1F0NA 1V0JA 2BI8A 3B7GA 5K03A 3RT7A 3EOBI 1QFSA 4EF4A 2ZITA 4GLOA 2V6JA 4YTEA 3AR8A 1J5PA 2GYYA 3C24A 1DXQA 1Y4AE 2C0PA 3CZ9A 3K16A 4FR5A 3TB4A 2HJRA 2PZ8A 1JB9A 2VKQA 4MMXB 4HGPA 7ADHA 4REQB 4BMXA 3P4XA 1W76A 1MQ9A 1BA3A 1CUUA 2EFEB 2JEZA 2X8WA 4XWWA 3G6WA 4RHEA 2R7KA 3WK7A 1XZJA 2DQKA 5JV5A 2JAXA 1ULTA 3H17A 3BCSA 1E2QA 3KT8A 4N1AA 3T54A 3FMFA 3JW8A 5JAPA 1ISSA 3L84A 4WN9B 1PWXA 3CNLA 4MHSA 5FHRA 5B58T 1S2MA 2H18A 3VUEA 1UBUS 3GG9A 4H08A 5DGDA 4LYAA 3EGEA 4Z7NB 4HT3B 4ZO7A 1U5BB 1FEZA 3H1PA 2FPLA 1OFIA 3MWDB 2FP3A 3MMPA 3D7MA 3MWDA 4RZ3A 1QTQA 2QAIA 1T1SA 5FI0B 4YUWA 2AFHB 1NYRA 3TTSA 3P9NA 2FUNB 2O5EA 1CY0A 1YQDA 1TMOA 4KVZA 4ZRMA 2AUMA 2ZRCA 4H3SA 4N6OA 4YQZA 1IXZA 3BG5A 4YEDA 3ZXIA 4CV0A 4I50A 1T91A 5B2EA 2Y3IA 3BOSA 3K9BA 5AHWA 3AFMA 3OUZA 3HY3A 1KFCB 2AOTA 4W6QA 2XLBA 1HEYA 4FDVA 4WE3A 3VOBA 4GLLA 4OMFG 1KDOA 2ODWA 1JDSA 2V9PA 5F1OA 3WNZA 2B6NA 1LLQA 1QX1A 2ZJYA 3I34X 4U2FA 3I3OA 4EHHA 5FOQA 3U48A 1B15A 2R86A 3U80A 1P75A 4AZCA 3RGGA 1RXEA 1RYNA 4CMJA 1T1JA 5A1JA 2C7OA 2IZ1A 2D6FA 1M2FA 1YS7A 5GZ1A 3EXG2 1ATZA 4GYWA 4P34A 5BO5A 3BK1A 4ALIA 1C1XA 1YE3A 4TSFA 3S8YA 5LZ4A 5B7PA 2GN9A 3DE4X 1H2FA 1F48A 3OBBA 4IUBS 5TJHA 3LBYA 2QGFA 1VB5A 4NP6A 1UAYA 4KLRA 3FLAA 3P96A 1JR3E 2APJA 2PHZA 2BDEA 3G02A 4XTCS 4V1CB 2ANCA 1UM9B 2WUEA 4HPWA 5DM60 4NCBA 4CLRA 1KP3A 4CLRB 1BE8A 4CMKA 3JTMA 3EVZA 1I3KA 2XT6A 3UQYS 2YY5A 2C7QA 2OGZA 4NONA 4JEHA 4JJGA 2X0KA 3IP1A 2Z2ZA 4HCJA 5IDWA 1H8HA 1TGYA 2OOKA 3A1NA 1XYGA 5L3SA 2GI4A 1QIJA 1P8AA 3CM0A 1D1TA 3D54D 3PLRA 4HK4A 1Z4QA 2QRVB 4E88A 3DXXA 2C99A 3V8MA 3ZCSA 1E9RA 1PR9A 1VG8A 2YWXA 4KBGA 3ADBA 5EY5B 2QORA 5CK5A 1YT5A 3PUHA 2NU8B 1K7XB 4HLUC 3LWDA 3TTYA 2WYVA 1KK1A 1T13A 4WKNA 1G2QA 1JDBC 1GXSA 1SKAA 3FJ1A 3HCBA 4C6SA 2YVKA 3I32A 3TECE 1OX6A 1GADO 3WICA 4A6DA 4OAOA 2XGMA 1C80A 5E6SB 1E9DA 3FWPA 1JEJA 1ECPA 2PX4A 3SBXA 3SSNA 2FR8A 1JSCA 3ZY4A 5KWJA 1JPUA 1Y37A 2BSQA 3THWA 4HDRB 4KI0A 5C5BB 1Y9AA 5ALDA 4LHEA 3Q15C 1Z2AA 1SKUA 3RARA 5A3RA 5I8PA 5KTPA 2BFEA 4COOA 2C83A 3PFFA 5K8VA 2I2XB 3NCHA 2X1LA 3ER9A 1Q3KA 5AM4A 5C51B 3NR2A 1OWLA 1IXSB 2MYUA 5E9QA 1WBBA 2DUJA 1FVHA 2PY6A 4YK7A 2ZJ1A 1KVRA 1ZI9A 5CNKA 4XOUA 1HPLA 3HCWA 3PFGA 4G67A 2X5XA 3EXEB 4QREA 3SFZA 5FEUA 5HEKA 1EWKA 3LQFA 1V48A 4WLFA 1TF2A 4D6YA 2BRUA 2VRCD 2H1WA 1T36B 1G21A 1JFRA 1G21B 1XVTA 3IPYA 4H1UA 3RF7A 4PN7A 1YCDA 5KSPA 5JDIC 3VVBA 3GNTA 4KWHA 2FN4A 4J7UA 3S2YA 5BT8A 1SAYA 3QBJA 3GGPA 1MDBA 3V32A 5CLIA 1NLYA 1PJBA 1JEQA 3LD9A 1Z0IA 2GFQA 3LYHA 3D8HA 5HS6A 4F4JA 3HSSA 1AUXA 4HS9A 1PSDA 4PQYA 3VR4D 2BUBA 1H4SA 1O6CA 3GBPA 3HA5A 4FKBA 4EZZA 3D0QA 5A4FS 2Y0CA 2R4TA 4D42A 1SOUA 2LIVA 4QUEA 3WLMA 4BTEA 5JZSA 2I1VB 2N0SA 1B6TA 1U0FA 1EVEA 4A3SA 2G3YA 2C98A 1PJ4A 5IC4A 2OL4A 3PPIA 3TG8A 2FSSA 3M6UA 3AG6A 4JX8A 4JGGA 4MUIA 5ADUS 1K75A 3MCTA 1NYTA 4MV5A 5KAPA 2H3HA 1T8YA 4X20A 2VRNA 1K4KA 3CF2A 1F2TB 1T9GR 5ENDA 4CN8A 2VJAA 5EZSA 2DU8A 1IJEA 1YCFA 2W7TA 3GJRA 3ZGVA 3W8EA 3KOXA 5KYYB 3CY6A 3KU1A 1Z4PX 4NYMR 4KSYA 1V9SA 4OI4A 5L53A 1IVYA 1DEXA 1Z39A 2Z2YA 5ED0A 4LS3A 3CUYA 4QEKA 4DF3A 9MHTA 5IAGA 3MTQA 4C7OB 3W2HA 1UZUA 3GRKA 3M9LA 4B7UA 3TG2A 2AGVA 1FLVA 1BMDA 1CUDA 3D1JA 3HVUA 3EVCA 5AKGA 4WRRA 2A9FA 4BBZA 2EW2A 1E1YA 1ICIA 1KKMA 4QTZA 3I01M 4WFKA 4B4KA 3TIFA 3H1FA 1JKIA 2X86A 4B0PA 5I45A 1FRQA 4UU1A 4N03A 1CHNA 1ZVVA 4QAQA 3FVVA 1WDWB 1XE3A 5IRCD 1DJQA 4D9MA 2GPSA 1IVNA 3AKEA 1KZ1A 3AFGA 2VK4A 2F7PA 4RX1A 1JQLB 1NQUA 3LQQA 3CLRD 5BWCA 4ZCMA 3G2KA 5T4EA 1WMDA 2J5XA 3RTBA 1XROA 2YIJA 4FTWA 1VCOA 2CL0X 1P80A 2F3RA 4GOOD 4NFHA 5E4YA 2PFSA 2X1VA 5T64A 3ECSA 1UIRA 1Y9ZA 3JY6A 3N7TA 4MVJF 1KEVA 2V0NA 3KSUA 4PZYA 1OKKA 4IQ0A 1M33A 1ZCZA 4KWIA 4TS9A 5F33A 4BNYA 1ODTC 2PL1A 1PQUA 4V03A 3NNDA 1MC5A 2BFPA 2BE7A 3EMKA 3HL0A 3QFSA 3NW9A 3TLJA 1MORA 4C89A 4EMTA 3FDZB 2GNPA 1J09A 4H2DA 4IGKA 4F9FA 5ELMA 3LVBA 3PE3A 1VCNA 1FUKA 2XMQA 3ZLJA 3I53A 4AZ6A 5JAQA 1Z6PA 1C9EA 1FMCA 2Q6KA 1PR0A 2CKDA 3MWLA 1RFLA 3CRVA 3GP3A 3IKMB 4E21A 3L3PA 4FQ5A 1EIZA 5E8RA 5EYPB 3KUDA 5HF5A 4I6GA 1NTRA 3PNYA 5FA6A 2PLFA 3WS7A 3CPJB 4FZSA 3FY4A 3K6JA 4HNAB 2BZGA 3PEFA 1HR0B 3N2YA 4QNMA 3N7UA 1HEUA 3HDVA 4KO3S 1YVRA 4LMRA 1RMTA 4QU8A 3M2TA 4NBLA 2BFFA 3AK4A 3LLSA 3PV0A 1NVUQ 4J9UE 1QH1B 2H29A 2I0FA 3INNA 1NP6A 5AVSA 1LXCA 2D1TA 4R8MA 2OV8A 3LI2A 2Q1SA 2PZMA 1RPAA 1YR3A 2ILVA 3JQRA 3F96A 1ZWLA 3HB0A 2J5QA 1YA4A 3LC1O 1O5OA 3PKZA 2HPZA 3COWA 3F5MA 1VZ2A 1ZUIA 2IUUA 4D9HA 1BE1A 1MIHA 2WNSA 5LQUA 5CIYA 2P68A 1GCIA 5FADA 1ZM2A 1BMTA 2BWJA 1RTTA 2QT9A 3CF4G 3DH0A 2HF9A 5CM2Z 1I7LA 3AY3A 3UTDA 4RGBA 1M5RA 5GJBA 3M6FA 5H3CA 1TZBA 2DFVA 2R62A 3A0UA 2OZVA 3BS4A 2FW6A 3LV8A 5LQAA 2N3ZA 1ZN7A 3ETDA 2BZ1A 1ISGA 1LPAB 1OASA 4LNUB 5KDLA 3U3ZA 2G7ZA 1U28A 4CDNA 3IXLA 2O8FA 4RQAA 3ANNA 2HU2A 2WJJA 3MN1A 2CJYA 2Z3VA 4ZCQA 4GE0A 4TKVB 1T4BA 4ZAYA 1OGJA 2CWDA 4DL9A 3FYUB 1W59A 2UZ1B 1QE0A 3CZSA 3VSDA 4ENTA 3O1IC 3GELA 4BUJA 3IQGX 1XVAA 4GR9A 3MBKA 1T0JB 1GFZA 1E5LA 4FYPA 1BH2A 2GEKA 5DLQC 4FE3A 1KIAA 1KQGA 2IS1A 3V4PB 3ROTA 2V98A 1VSVA 2JLRA 2WEKA 4HRAA 4E5SA 1MGPA 1TA0A 3BQ9A 8MHTA 3BC1A 3DO6A 4F84A 1OFVA 1KMMA 3A6ZA 2XI4A 2BHLA 1JA1A 3SC3A 3NUGA 1UJ2A 4F96A 1J24A 3E35A 3I1YA 3AVTA 2EFJA 1U2SA 2PPVA 5CJPA 4EF5A 5BN5A 2GUGA 4TXMA 3R40A 4AKSA 1QDLB 1JIXA 1EZZA 4EQZA 1JMKC 3FAZA 3MWGA 3ZQKA 1CFJA 1VJ0A 1Y1SA 2PQ0A 3QMPA 1U2RA 2L2QA 4GEGA 4GWKA 3QF7A 2MSLA 5EN4A 4Z7JA 3EGDB 2F3PA 2LDXA 2OK8A 2CFRA 3BIOA 3R3ZA 1Z6TA 1R88A 1E61A 2YJGA 5I7AA 3HCRA 2KHOA 2QLFA 3T0GA 4NXNB 1UJ5A 4HD8A 5IDXA 1U8YA 5L3RA 1D9XA 2ZUFA 1T2FA 2AJ8A 1U90A 5FTMA 4Z7OB 1C7JA 4OXXA 4CT4B 1D2EA 2PXAA 3VMMA 1TKAA 5F2NA 2AZXA 3UYKA 2YI9A 2W2KB 5FPHA 3CPHA 3DEZA 3L4EA 4C0HA 3UMMA 1GCAA 2HA3A 5BN1A 2G1JA 3RANA 3P5SA 1V16A 5EGNA 4QWMA 2YHAA 3BGWA 1NSFA 1S89A 1SHUX 3F7TA 4DDHA 4F92B 2GA9D 1L5NA 1NX9A 4X24A 1I3LA 5K6AC 2LZ0A 3SM3A 1P74A 2Y93A 5CNMA 1SXGA 4BWYA 3KNZA 1EUCA 4BFTA 2E4VA 1VPVA 5DHPA 3H6KA 4Q3AA 2JI8A 1U6JA 4Q37A 4UTOA 4YGYA 4CIWA 1U1GA 4A03A 2FQQA 1BHSA 2ATCA 3OPNA 4E5VA 1RRGA 2FE4A 1DJPA 1AQIA 4NEHB 2HNAA 4RETA 1SUCA 4AS2A 5KNDA 4QIHA 4AZ3A 1LNQA 2Q62A 2B4AA 1NJ5A 1DO8A 2O2JA 2QSZA 4D2IA 4X5OA 3VYVA 3S7ZA 2NT4A 1CY7A 1PI3A 4UOQA 2DTXA 1VYTA 5IBPA 5CVTA 1W49A 3QE2A 2FLWA 1ZNZA 2J48A 3CONA 3E48A 2DB3A 3HVKA 4FHCA 1T2AA 1GL7A 1OZ0A 2YBEA 3BILA 3KL4A 2FG6C 4OL0A 4Q6WA 4XIIA 4R0MA 1CDDA 5HFAA 1JFTA 1Y6FA 3FETA 2VNKA 2OW7A 3DMTC 1E60A 3K8ZA 3AMVA 3BZBA 4KQEA 1T0HB 3QENA 3UMFA 2LWIA 5C1IA 4EGCB 3LPCA 1J5XA 4NU6A 1R33A 3GGOA 2I3ZA 4F46A 1M0EA 2OB1A 1PQYA 2CFCA 5E0OA 1SHTX 4FN5A 2XNDD 4ITVA 5HTOA 4MDHA 1CUHA 1DRVA 2ZUVA 4IWXA 4PZ9A 1MENA 1SOMA 3UAXA 2N46A 1K9VF 1KZGB 3FBWA 3KAJA 5HW0A 4KGZA 1UP4A 1SBCA 1ZUD1 4U7HA 1JWAB 3AUKA 5TF0A 4UTPA 3JWJA 1EHIA 4EZIA 3GJQA 1NP3A 1YBFA 2F3QA 2Q7XA 3WK6A 1CF4A 3GEDA 4QXAA 1K0UA 1DWPA 2BL4A 3QEAZ 4J0DA 3R7NA 1KA9H 2QP9X 5IT4A 1Y7HA 3T1OA 1RAEA 1BE6A 4E3ZA 1L5OA 4BPRA 4ENQA 1N57A 2EL9A 2JZNA 4PTZA 5A4DA 1ZCBA 1HYQA 3ZNNA 2CBZA 3DPPA 1R4NA 2X3FA 5JYDA 2VDNB 3MUNA 1CUBA 3SEZA 3SOPA 2ZXUA 4GZMA 5CVCA 2ZUTA 2C92A 2IZ5A 4OIFA 1R8JA 3R09A 3LCCA 4JR1A 2I67A 4F2GA 1OPRA 2GZ1A 3G6KA 4AB1A 3IPXA 5GAJA 5JCOC 2O2SA 4NYJR 1G6OA 1RXCA 2A57A 2WJPA 3CNQS 5JARA 2OBLA 5U4QA 3ADCA 4HWKA 4ZC8A 4EHDA 4YMUA 4ERNA 4LRYA 4P4GA 3X1JA 1UBTS 4B2YA 1JQJC 4LC9A 1PFWA 2A3RA 4PO2A 1Z62A 4PNHA 5I9TA 4CWAA 5KTRA 1QTNA 3HM2A 4KV9A 2XMPA 4ARZB 3QU4A 4JI6B 1GAJA 3WLKX 3D8NA 3IIEA 1UUFA 4WUTA 3TR6A 4PG5A 1AQNA 3CIOA 4DDVA 2QX9A 2UVQA 3ZHUA 3WDLA 1V8DA 2JI9A 4QJ4A 4AZ0A 1OROA 1K7YA 1ZXBA 1U00A 3UW1A 1X15A 5BNIA 1N0IA 2D4CA 5CX1B 3L1UA 3L0OA 4X7PA 1MO3A 3B3QA 3FGOA 4BZXA 5DBFA 6ADHA 1UK9A 3ROQA 1X1DA 2H2HA 3I9JA 4Q9DA 3BIJA 2IWRA 1ADYA 3E3AA 4BFLA 1VECA 4UM9D 4BLWA 2C7RA 3S2ZA 5EJEA 1C4XA 1J0XO 2WAAA 1KEEB 1GKLA 1RJGA 2C03A 3A1VA 2CLCX 3BXFA 1T9KA 3M1IA 2D7DA 4CR7A 2WJHA 2D1FA 3HCNA 3I76A 1VSBA 2Z5LA 1I4LA 3SVZA 5H16A 4MARA 3EZ6A 1X03A 1GQRA 4L3OA 4HWRA 5AK4A 3BWBA 3AERA 3B6EA 5IJAA 4WCFB 4UC0A 3WMFA 1RD4A 3U26A 2F64A 3O9MA 4FHGA 3ANXA 1YWGO 2GILA 2CK3A 2R8RA 4TXHA 4X61A 3CB4A 3KJNA 4MQ4A 4R6XA 3WKCA 3OU6A 4I5EA 1FQOA 2AK3A 4OYRA 4EFMA 1EINA 1ND6A 2HRZA 3OKFA 5BR7A 4Y6PA 1EFLA 2D0OB 3L8DA 2B5WA 1QKIA 4YLYA 5A9RA 2Q99A 1TLLA 3U0VA 4MGIR 1JIJA 3O74A 2ZDGA 1QQBA 1Y7PA 4KP7A 2QUAA 3HYNA 2B1JA 3KJHA 2JHPA 1U9JA 4QXOA 2VDRB 3K1AA 5F1PA 4QKQA 1HQYE 1TECE 2QW1A 3BMOB 1SXJA 1DG9A 2ZTLA 5T6MA 4MW4A 4KDEA 5IKMA 2WVAA 3H5VA 1NR5A 4XYEA 5E3HA 5KOYA 4FEAA 3D50A 2YQ5A 5C1PA 3QV1A 2GBLC 4PO1A 5DI3B 3T49A 1B3RA 2D54A 2P9BA 3OF5A 4XRGA 2ZCUA 1Q77A 3E9ZA 1ONPA 4YUVA 1YUNA 3LBHA 5IABA 1HNZB 4V0QA 4OLJA 2G7MC 1GTMA 3FHOA 2Z43A 3FGZA 5U4XA 3MTEA 4F91B 2RSLA 4GOXA 4BU0A 1GITA 1KEUA 5LQKA 2NWQA 1OWPA 2BFAA 4IFIA 3VI4B 4AROA 1E5DA 3CF6R 4O2BF 4RGYA 4U3JB 4A6PA 3AHIA 2Z1DA 2GPJA 3GJTA 1JIVA 4QGFA 4FKZA 4ML3A 5FL3A 5GONB 2CMHA 3ZWWA 2UUCB 3H2KA 1QONA 3PDIA 2Q4TA 3DE3X 4ZC1A 4QSMA 4NH4A 5EZYB 3UEOA 1NVKA 1U1IA 2C9ZA 1RP7A 1D6NA 2BGKA 1B23P 3AHHA 4W7SA 2A0WA 2LXNA 5E7JA 4QSHA 2F43B 1W1WA 5L4LA 1JYEA 2OGWA 1J99A 1YQTA 3LUGA 1VP9A 4F11A 5CLFA 1G1AA 2D1QA 4LEIA 4WACA 5KDOA 3ZHSA 4BV8A 4YH1A 4XWAA 2NO1A 1FU7A 1GPNA 3U4GA 1T2DA 1H0RA 5EKDA 4UBKA 4ZYXA 2OBMA 2PMKA 1BNCA 1VG0B 3KDAA 2EFGA 4K3UA 4RA6B 2B8JA 5D01A 4A4DA 4YYEA 4V0MA 3IELA 2NNWB 2VT3A 5HR5A 1FJHA 1U7DA 3W1EA 2CVFA 4XX0A 4GWGA 4YWHA 4ZT6A 4KJZA 1PX0A 4KLNA 3NHBA 5BNFA 3ZXXA 4EA9A 2FE1A 4P82A 5I7OA 5AHXA 3DLCA 4H18A 3PCTA 2R85A 4HG2A 4UASA 4XFKA 3FF1A 5KWEA 1BIFA 1V37A 2BKXA 3CT6A 4YO7A 4YUYA 1GRNA 3FUWA 4G37A 5G1OA 2PS9A 3UZUA 1A27A 3C8MA 3VGJA 1NLZA 3C1OA 4E31A 1PWHA 1RZ3A 4CF6A 5T57A 3S6JA 3V5NA 3RVBA 3IP9A 2B35A 1FFXB 1YS9A 2FSVC 4BE7B 4ZVNA 1ODCA 4DSAA 4Y3UA 3G0HA 1EK2A 5EJ2A 1VMIA 3IV6A 3R74A 3UH1A 3WWZA 1UJBA 1CIPA 1WSWA 3CZRA 1VHTA 2ZSIA 3DFUA 3OZWA 1JKMA 3BBLA 2D4HA 3RS9A 4Z1MA 1TM4E 1K6EA 1V9LA 2NXNA 3SIPA 4EHLA 1V8FA 5BP7A 4D3DA 1FYWA 3M9WA 5B3KA 3OC6A 1BX3A 5DHAA 3OQOA 2VJKA 5AI9A 2ACKA 1XZPA 1ZS9A 2QPLA 2ZRIA 4ACBA 4L5IA 3LBIA 4M9QA 1Z6YA 3V3TA 2Q9AA 3IQXA 1JJIA 3EY9A 3GZNB 3HYLA 1SNYA 2E9SA 3PF8A 4G4SO 5L6MB 2FEKA 4UULA 2XUOA 3GB9A 5K3FB 2RAPA 1ND5A 1KOGA 2ZVJA 2YWRA 3QNUA 3JALB 3JVUA 4K6OA 3W7BA 4P38A 1N2IA 1NW5A 3P2EA 1N7JA 1SQSA 2MSDB 4O1IA 3WRWA 1E4EA 3PUZA 3X1XA 1K3FA 5FT9A 5ALSA 4OP3A 2OG1A 3EC7A 3NRJA 3RS7A 4ONEA 2EW8A 2F7OA 2C8JA 2X3VA 3ANMA 3PQ4A 4X8LA 2A30A 2JJ8A 3VEAA 3KV3O 4WZAA 3NGMA 3U4AA 4POAA 1AO0A 1FLNA 5G0SA 1XNQB 3REQB 1NNI1 4HGQA 2W6MA 4XDYA 1TZ2A 1XRNA 2IC5A 3BD9A 3EFHA 4BUZA 1UOQA 2X7HA 3GDFA 4AO6A 1CU1A 3UAOA 2KM1A 2H7CA 2GK7A 2QU7A 1WSAA 3OC0A 5BNTA 2RBGA 1NUHA 1HLFA 1NIPA 3OP4A 3OT5A 4UEJA 3GI7A 5DDIP 4V1CI 5JZVA 2WQ6A 4D9IA 3ELYA 4QBGB 4WLUA 5JRZA 1WY7A 3HR7A 3A6FA 4HO1X 4RD1A 4TGLA 4X8HA 5ILGA 4IILA 4GXQA 3W9BA 5AD1A 1JPNA 2EVWX 3BCHA 1P45A 4WADA 1ZU4A 5K8IA 4M22A 3TCKA 4FILA 3A3YA 3AX6A 1UFKA 4JX9A 4NZMA 5C9ZA 1K08A 1GGHA 3DBLA 3MMSA 5DM70 3M6XA 2HWWA 1FNBA 5C1DA 4J29A 2VAMA 2EIHA 3OZBA 4MXDA 1E5XA 1JQDA 2HBZA 4QX6A 1SXJC 2IBSA 1LDGA 4BDSA 1Z7YA 1ZVMA 4PTLA 4QYIA 4ETNA 1ZBQA 4LDAA 2QXLA 2HMAA 2ZSJA 4WTOA 3NFRA 1V16B 3DDZX 4DJTA 3FRIA 3VR0A 1H0SA 3HB9A 4KR0A 1Z88A 1EM8B 5JS1A 3JVEA 3A0RB 2BKUA 1ZN8A 1N3BA 1U2DC 2Z83A 4BGVA 3G49A 4G1VA 4GUAA 5KVCA 4V0ME 4B2IA 3TEFA 2PN1A 2V9ZA 3LQ2A 2PA0A 4BZWA 2Z5GA 5FLXA 5H4HA 4IP0A 2WYUA 3ODGA 3DOIA 3GXBA 3AKDA 3D6VA 1TVKA 3EJ6A 3OFNA 4GL2A 1WW8A 3LE8A 3D59A 5H68A 1N7IA 4EQ6A 1S7CA 1Q5PA 4MUMA 3Q2IA 4EGSA 4G5HA 4OHYA 4K6CA 1RRKA 2AR7A 3KQSA 1MD9A 4E5MA 2XCRB 2QW0X 3HUDA 2J4DA 4E2ZA 1WZ2A 1DQZA 1V7ZA 1V1MB 5F7ZA 2AT1A 3BGOS 2NXJA 3FBTA 4N5NA 4RMNA 4JNCA 3HO8A 2AI1A 3PPXA 1NXVA 4KQXA 1KVSA 2FYVA 4BFVA 3WE7A 4M1ZA 2BSAA 2IHYA 4ZVTA 4JI1B 5BSGA 1JA9A 2AV6A 2MDTA 1C8BA 4IG9A 4AZSA 2DJIA 5H3HA 4DSNA 1R7RA 2I65A 2ZIXB 3F8SA 5JRDS 2RGYA 3AEXA 5DSXA 5CAEB 4WBNB 3M6AA 1EEXB 1Q1QA 4HH0A 4JP8A 1DP4A 5CPFA 2Z0NA 4EMUA 2XMGA 5JIBA 3OKPA 2J5RA 4MGEA 3G2HA 3HFSA 8ABPA 1H5UA 1GU7A 1TE2A 2PPLA 2XGGA 3CLTD 2FWJA 3F1LA 3WWEA 4AWXA 4F6RA 3AVOA 4OHWA 5FUVA 4F6RB 4QL3A 4E4RA 3AESA 2Q5IA 4PG7A 1D09A 1WSDA 2NVUB 2UXDB 1XFDA 3DP9A 1CT9A 3KE8A 1D6MA 2ZVQX 4D98A 2ERYA 2LR0A 2CB9A 2Q5QA 1XRRA 3T5TA 1YJQA 2DWCA 3VH2A 3ZCUA 1DRWA 1ZDMA 4DBLC 4B7XA 5JQWA 4KODA 3DX3A 1DCFA 1H2RS 1L5KA 3UN1A 2G77B 2QVBA 3A1UA 2R4UA 5K8JB 1V6AA 2IPOA 3AFNA 3GLVA 3DE5X 4E46A 1OX4A 2BRUC 1OFGA 1ZONA 3VVLA 3QXSA 4MPPA 5C5CA 1YS2X 5LP1A 3NP7A 3PC4A 4LJKA 1S4MA 1DC5A 5FNVF 4G65A 5YASA 4ZDIA 3K70D 2I91A 4PYNA 2C5HA 2CNWD 2Z58A 1KH1A 3ENQA 4G8JA 4R84A 1ZIPA 2DCMA 1ARZA 4UUBA 1DKRA 1Y4UA 2DT5A 1V5IA 121PA 4F6CA 2V3WA 5A4IS 3DWFA 3EVBA 2EKLA 3VJRA 2AI3A 1OIVA 1FX1A 2K2WA 2PZEA 2G9UA 1LS1A 2WUFA 3HJNA 3KC2A 4UDXX 3Q87B 1LS6A 1M74A 3PUKA 3I0ZA 4IQFA 1PEYA 3R8XA 1E6WA 1T4CB 1M8KA 4BLUA 2ZWOA 3IE0A 3J81A 1A9TA 1G2PA 3F9CA 4H1VA 3EWAA 4WH0A 4KPFC 5IN4A 1N5IA 3HXTA 2ID4A 5HTKA 1AA6A 4C87A 4MIYA 4ZOLF 3VNQA 1P60A 3IERA 4WCFA 3W5SA 4AG6A 4F9TA 2UYYA 5JNSA 1E92A 2RHGB 3I2GA 2Q1YA 4L9RA 4ASUA 4FFBB 4M89A 3ITKA 1TF7A 1R5JA 3BERA 4MKHA 3PA6A 1EFPA 4XKJA 1DOHA 1SOVA 2GBFA 1BDHA 3T3IA 4AWAA 3Q7SA 4QD3A 1Q0LA 1YGPA 2IIBA 3IAM1 5EQTA 2VBGA 3G2NA 5AVOA 1JJ7A 1YUBA 4G9BA 2HSGA 1T2EA 2OXEA 3KQMA 3PXBA 4XH9B 2HHHB 1ZMRA 1NBWB 2AVNA 3FNFA 4IGEA 4AT1A 3RVPA 3TLAA 4NQZA 3ZDRA 1U3TA 2IV2X 3KALA 3V7UA 1X2EA 1FVFA 4ARIA 1QIFA 4IIXA 4CCWA 4F1KA 4IWPA 5CA0F 5KYWA 3M4NA 2VK1A 3AR9A 3K9HA 4O0LA 2FXVA 4RLQA 1N0UA 3PFKA 3VHXB 4HDKB 1SHJA 3VNSA 2ZJ8A 4EUFA 4YR9A 4II3A 3K32A 4YP0A 4TLCA 4YCMA 1IOLA 4Z2YA 1IWBB 3PTLA 2VF2A 3NM6B 4FCWA 4HDSA 4ZCTA 1E1CA 2J3DA 2I6QA 5C53B 1G8KA 3LG2A 1I1NA 1RI4A 2ZB2A 1FMLA 5HPYB 2WHPB 1FY2A 4IUDS 2ND0A 4EBFA 1T2CA 4GWLA 4ABYA 3FCUB 4MSUA 1U2GA 1KJ8A 5CPBA 3ITEA 5FRDA 1NOIA 2HCTA 1A77A 1I4DD 3WTCA 1YACA 3DD5A 1BFUA 1XFAA 2P1ZA 2WFMA 2J3QA 4D5EA 5KBYA 1IZYA 1P2DA 3KIPA 2Z5FA 1WXFA 4M1QA 4ZI5A 4LTDA 1D8TA 4M3NA 1II8B 2VLBA 4ZQHA 3VUFA 4CM4B 3RRYA 3IVRA 1A4RA 3GEHA 1AS0A 4RFLA 3TSCA 1N6PA 4BZQA 3LPNA 1L7NA 3DE7X 1JHPA 4MI1A 3GEIA 4CFSA 1EFUA 4UBJA 3SFTA 5CFZA 1JHMA 4MW0A 3ZH2A 1QB7A 5AKLA 3BH7A 3R6TA 1MJHA 2F17A 2GPNA 1VYHA 5J2UA 4P3OA 4WN9A 4L85A 5JCZA 4M9ZA 3L7BA 2XCSB 1L2TA 1SQGA 2WDPA 3GGJA 1DELA 4LOHA 5I9SA 3WIBA 2F67A 3KYDA 5A3JA 1YK1A 3DWIA 4BO0A 5KX5B 5CTAA 1BZYA 2GCNA 4BMSA 5C7YA 4QASA 4ZI7A 4C7VA 2QD4A 1P7WA 5LJLA 3CVVA 2I7XA 1XLTA 4MR8A 4CKEB 2WFLB 3K71B 3C3JA 4DIDA 1G9TA 2O0HA 5M34A 1FDOA 4FYMA 1AJEA 2HY7A 2WMOB 4ZAWA 5IAJA 3T3DA 3HJGA 1PT6A 5BUQA 2HUPA 2WB2A 2FF5A 2WPDA 4JKYA 4UW9A 3RAGA 3BT7A 1LPBB 2LBPA 1Y1KE 2Y1WA 1M2EA 5COBA 1FFCA 2C20A 2FPPA 3I9V6 4I66A 5ENVA 3U44A 3UT5A 1DBPA 2IW1A 6PFKA 3NUZA 1ZNYA 1NFQA 3T7TA 2VOJA 1S9DA 4CF3A 5I51A 3QNJA 1GZ7A 1AIPA 3TL2A 4M37A 1LDBA 3QF4B 5GY7A 1CWUA 4CXMA 5BV1A 1EU1A 1L9XA 1NQAO 4L7VA 5FO1A 1XZAA 1AN9A 4N3BA 4HVCA 1O03A 1N6LA 4G0PA 4E94A 1PG2A 1Q11A 1ZD2P 4E14A 2C4VA 2Q8PA 2A5FA 2VXCA 1CZRA 2ZSFA 1QS0B 4Q7QA 1WCV1 2PO7A 2QRHA 3P2OA 1OXMA 3SYKA 1RE1A 4LBYA 4EO9A 2AFIA 2UZ3A 3MRTA 1XYYA 3T4AG 2VYNA 3V7FA 4PRZA 3TIIA 1U1CA 1E0KA 3A2LA 4RUKA 4IIBA 1DNPA 1YBHA 2H4ZA 5FBHA 4MP3A 2L18A 2QUJA 4HGZA 3AUJB 1P9RA 1Q74A 3LCVB 2R1TA 4JKOA 4WNAB 3SY8A 3W6ZA 4LF6B 3HJFA 1CZHA 3I2IA 5CVJA 1U7ZA 4URFA 2BFWA 3ZI7A 1KJQA 3L0CA 3HP1A 4FW9A 4TXNA 4MR7B 5GM1A 1QP4A 1UZLA 1ZUNB 4UEOA 5T3YA 4GYJA 3FSEA 2NXCA 2NU8A 1RJFA 1MRNA 4AJOA 4JU9A 2MSNA 3PI6A 4MUAA 1U3GA 3CNEA 2WMNB 4I9NA 1Y3FE 3GLGE 1Y98A 3X2FA 4LE2A 2QTZA 2BMJA 2GK6A 3Q85A 4O1MA 4YCAA 1FS5A 1ZIDA 4D6XA 1TA4A 4BX0A 2JLWA 2X2PA 2GM3A 2IVZA 2R6AA 5IJ9A 4FNMA 2FOXA 2VHJA 1UMCA 3KE9A 4B3GA 3PUWA 3BH0A 1GNSA 1KYXA 4K8RB 5HNKA 4FC7A 2D7JA 2FPIB 1O08A 1UJ6A 1K1EA 1B8OA 2JAQA 4UCWA 3ZKWB 4EM6A 4QULA 4R54A 3WGJA 2M2IA 1EVYA 2D5BA 2OFWA 4NMLA 4P3KA 4K1LA 4PSUA 4LISA 3D4NA 3IAM6 4JT4A 3OLVA 3RVRA 1O0BA 1ORIA 4BP1A 1X1SA 3KJEA 4TT3D 3SQMA 3TZCA 2QAGA 2W2NA 3MWFA 4GPIB 4IMRA 4JT9A 4WKOA 5EJAA 3THYA 1VFNA 2W0MA 2VUTA 1E2FA 4B2PA 3T1VA 1ZGZA 3E7DA 2A7XA 3CV3A 3CB2A 1QQ6A 5DF1A 4EZQA 3HDTA 1HE4A 2GN1A 2NLOA 3EG5A 5CB4B 1Y8CA 1PNTA 2HT6A 2FPXA 2GZ3A 2L42A 3AKCA 1PFYA 4Y6GB 1ENOA 5EWLA 2QTTA 3T5CA 4CI0B 1CQZA 2WJWA 3B60A 3I2WA 1DIBA 3M4YA 3OEED 1M54A 4PINA 2QTWB 5L4SA 3ZQJA 2X4GA 4X6UA 1XEFA 2CEAA 3AEZA 3FWHA 2I34A 3P32A 1BS2A 4JL9A 4OQMA 3NDBB 2DWOA 4TSKA 1DFHA 5A06A 3HCCA 3HDQA 5BSFA 1XMIA 1O5IA 4NHOA 1SBNE 3JRWA 3B1YA 4PRLA 4DM3A 4A0SA 2JGJA 2Q12A 2ZAYA 1A76A 1C1YA 1JJVA 3BJMA 5EHGA 3VO2A 3VVMA 1X19A 3QWFA 4Y7DA 4JUBA 3D0OA 4TRJA 1XPJA 1YQ9A 4DLAA 3FPGA 4XRRA 5AK6A 4MVJG 4PICA 3S28A 3UJPA 4F9EA 1TGVA 1Q0UA 2TRSB 4PNZA 1N3YA 2Y67A 1Z2NX 1ZNXA 5BSKA 6NULA 1BFKA 4ZT2A 4EUKA 4C43A 3KT6A 3PL5A 1H22A 1SCNE 1EQUA 1Z7GA 2G0TA 2OZLA 4P83A 4FYHA 1CHDA 3JQ7B 3C8UA 3AHGA 1YNSA 3DF7A 4NDAA 4HOYA 3IALA 3I83A 2DX7A 1FMJA 1NBOA 4NOMA 3FNQA 4HWTA 2D5LA 1CUXA 2BMDA 1R74A 2OBFA 1F6BA 2XCLA 3D8SA 3MWEB 4HQFA 4IY1A 4M54A 4EQ6B 5FUYA 1XTJA 4BB9A 2AOVA 2C3PA 4LV8B 2EG9A 1QC5A 3I8SA 5DEOA 2EERA 4RHFA 1Z06A 1MZPA 5A3QA 1E2IA 4LYEA 5PNTA 1ZR2A 3DMRA 4AJ4A 1PT5A 1OAKA 2B21A 4Y2HA 3ML1A 3T99A 4JOBA 2YV1A 4CM1A 5J43A 4NATA 5IT0A 2YL8A 2EFDB 3IBCA 3KTOA 1W36B 4YCCA 3RAEC 3K9LA 1ZK0A 4DRYA 1RI1A 3BH6A 3N9IA 5FWXA 4BNMA 1TIKA 1ZIXA 4IF4A 3FPSA 4WI1A 4ZO8A 1TFRA 4KE7A 3G0IA 4DAOA 4PS1A 4P98A 2FLVA 3AP3A 2K87A 4M1OA 1HWWA 2G0NA 3DDHA 2I6SA 1D2GA 1Z82A 2L82A 2TMKA 4I55B 4NJMB 5B2ZA 3I37X 1I6MA 5ALIA 1RWPA 4X44A 2C2KA 3GVXA 3GI1A 4G01B 4RYLA 5AJZA 4WY5A 2E37A 1FS4A 3ZH9B 2OVFA 3PR3A 3TZHA 4DUGD 1T5LA 1R3DA 1C2YA 1DZ3A 2DY0A 4JMLA 4E09A 4QFCA 1P1IA 1F5SA 1ODIA 1DV2A 2XBLA 2IQIA 4NV0A 1Z5UA 2QM0A 1EWTA 2VL7A 5HKKA 3EHEA 2XCTB 4RPKA 2D2FA 1JA0A 1NW4A 1SCJA 1FXWA 2PMDA 3MGGA 3W2TA 1YQQA 3F6CA 4LSWA 5KSZA 4NNJA 5KQLA 2P35A 4CL8A 2XCQA 3KRTA 4MQMA 3KJQA 3KKKA 4AUKA 1OLOA 3TYXA 1L7AA 1ZEJA 2IUYA 3EGVA 3ON5A 1QZZA 2G80A 3TLEA 3CZQA 1Q95A 4WVLA 1QFMA 4DEVA 1HE3A 3THXA 2C8LA 1RKUA 3NEAA 3QUCA 1GT6A 4HB3A 1J22A 4C7BA 2NTVA 4B6OA 1FLAA 4Q1FA 4R2LA 5AWFC 3O03A 3DDOA 5TRTA 2F7RA 3SZMA 4GMFA 4ETMA 3Q72A 2Z1NA 5KYXB 4EAQA 4CM4A 1S8AA 2O57A 1C9JA 4C4AA 3IAS1 3I9KA 4RVOA 1Q6YA 2I4RA 3EH2A 2R8ZA 3BXGA 3WLJA 3COYA 5CCDA 4KWTA 4CIAA 4MKRA 2V9CA 4R1PA 2FEPA 2OZPA 2V54A 3IGFA 3KLNA 3NWOA 3UY4A 5K9ZA 4M9RA 1XA3A 1EGHA 3L02A 1U4SA 3EDMA 4PWYA 4ENWA 2C9MA 4EY3A 1XHEA 5LOVA 5B1SA 2IH4A 1Y89A 1LBTA 3DBRB 3BE4A 2CUKA 1U0HC 4GMXA 2JCVA 2BFDB 4A0FA 1E5VA 1BJRE 1NDQA 2XNHA 3LJKA 3QLUC 3CBGA 4DHWA 2WLSA 4U1RA 3S3TA 4BNTA 4E03A 2QMEA 4FMCB 2AEEA 1U4OA 5F73A 5AW7A 1KK2A 1NLUA 1TYBE 3TMKA 3NHAA 5K0LA 3NRBA 3BMNA 2QJRA 5WRFA 3HUTA 3INTA 5EXEA 2XOXA 2F1AA 5DLEA 4TZKA 4BMNA 1YASA 1DO2A 3AU8A 3GPIA 3O1JC 3N5KA 2EDCA 5G0UA 1NF3A 2GPAA 5KYWB 3CVUA 2DHQA 1JE0A 3JQFC 2RG1A 3VI3B 1G55A 2P6MA 2IOHA 4JDUA 2NT3A 1FJ2A 3BX1A 3GRFA 4L4RA 5JZOA 3M6VA 4MLCA 4BJ3A 5JNVA 1HLPA 4GX1A 4B33A 1CJMA 2PKCA 2ECOA 2ZM6B 2OFXA 4HF7A 1LQ2A 3LT1A 2Z8XA 4DV0B 4E2WA 3D5TA 1QK5A 4PC2A 3T34A 4ZDKA 2A33A 2QZJA 4CKCB 1FFAA 3MK31 1EB8A 3ZJ5A 1DGQA 2HPAA 2NTNA 4ESHA 2JZCA 4B4DA 5IZ4A 3ZR4B 1QX3A 3UG7A 4W82A 2I5PO 3NAZA 3KM0A 1DKZA 3H9EO 2ZETA 3O38A 5LKAA 5BSUA 3AFHA 1I51A 1H94A 3ESDA 3GEPA 1Y63A 1FDSA 4XB1A 5DULA 1TYCA 4C7JA 3CH5A 3IPLA 1HKHA 3BUSA 1J7KA 3K4QA 3A3PA 3OPQA 4DXHA 4MLPA 4FOPA 3WC4A 5BSEA 4FYJA 3OIDA 2VQSA 3QBVA 3V7YA 1A98A 3P9QA 3RRJA 2ZB4A 2OBBA 3IS3A 4CLXA 4YN3A 1DC4A 1TO1E 2R4QA 2AVDA 2ZBVA 1PFVA 3GL9A 1A9OA 2VR1A 4OBXA 4YPFA 2Q2OA 2W2LD 4GUDA 2H1IA 5JY6A 2AYYA 4G5XA 2Q4OA 3KYDB 4WLVA 3VAAA 2H1OA 3O4GA 2J41A 1SK9A 2VZ8A 4K0RA 4ALLA 3B3FA 4LVOA 4CMCA 4IFBA 2BM1A 4FPXA 1SCIA 2OZKA 2Q1WA 2WOOA 4RL6A 4ZO9A 2ZR9A 2W0SA 4MS3A 4P33A 4OI1A 4C4TA 2GN4A 3G5MA 2IGBA 3IR6A 4LV6A 5M7EA 2QVXX 4KG7A 1ISJA 1Q1NA 1QKJA 3MBOA 5E6SA 1IEXA 2FPWA 2C78A 4WKPA 1CJSA 1TQTA 3EVDA 3P9KA 1U8AA 4HWGA 3NASA 2WY2D 3UQZA 2ZBRA 1U11A 1EGQA 3PC7A 2NZJA 4O2LA 3OQNA 3ZNQA 2IDJA 1WKCA 3AW8A 1M6VB 4J0QA 2W4IA 1MX9A 2QM8A 3B8HA 3H2GA 4NE9A 2RHTA 4A8JB 4N49A 2PS1A 2JRCA 3OCJA 3ZXYA 1F4LA 3R3JA 3CS3A 5CM9C 3IVGA 4NY1A 4WDRA 1C7EA 1WUHS 1D2MA 2MU1A 1NJGA 3R3VA 1NFFA 4JZKA 3SFVA 3NHZA 4L8VA 4FMPA 3I45A 4A6EA 5BN4A 3QW4B 4EVQA 3IXQA 3CKYA 1GZUA 1VHQA 1NKSA 1KFEB 1AGNA 1BU5A 1DJOA 3PF9A 2J45A 4FOSA 2VPYA 2BJHA 4QPJC 4N0PA 1XRPA 3N2LA 4DMKA 4W5NA 1EVLA 1Z7BA 3KYBA 5DM4A 2NU9B 3QVTA 2X9NA 3BFKA 1NWCA 2FHPA 3ETCA 2H4JA 2J31A 4LECA 4MYHA 1ECCA 1FF9A 1UQTA 3AH8A 4G4JA 2OMKA 5DX8A 4FUQA 5F2EA 3U1TA 2I33A 3UHAA 4YPOA 2CHEA 1JFLA 1PV4A 3W5DA 4BEWA 4JL8A 5ETJA 2BEVB 4FT4A 5K4AA 4TL7A 4JI7B 2Z0OA 4NKRA 3UCFA 1TM3E 4H3HB 1DEHA 3O7MA 4ZZ2A 5J59A 3V7NA 3GPBA 3GJ6A 5F5NA 3PWTA 2OCLA 5MN4A 1JF8A 5A02A 3HCOA 1MQ8B 1Z0JA 1W87A 3LF1A 2BTEA 4P84A 1OI3A 2PZBA 4NBVA 5M2QA 2QX7A 1SXQA 1NVEA 1ZG3A 2YWBA 3H99A 1N9ZA 4P86A 4YXWD 2IU3A 1XF1A 2OMEA 4ABTA 2WHXA 4JJIA 4CPDA 3TZQA 2Q6OA 4WW0A 3ZZMA 1XB2A 4QNRA 5T5QA 4K9LA 1F06A 4XWGA 4YJHA 3TNLA 1FFSA 2CDAA 3CO5A 3ZU3A 1ZJ4A 4PHGA 5FYQA 3J81k 1HX7A 2YW9A 5T4FA 1YIAA 1P0FA 4N8DA 3WYFA 2WF9A 1O6FA 2W2OA 3X44A 1RWNA 2O0JA 2E5LB 1JTFA 3OQMA 4MCJA 4XD7D 4BU1A 1M1NA 3U7JA 2PH5A 4FJ1A 3VAZA 1VSQA 1XZHA 3D8UA 4U02A 1OTXA 2IYRA 3ACBA 5CG1A 5I8WA 1Z63A 4LW8A 1KS2A 2CZCA 2YR0A 3T48A 1LC0A 4FCTA 1B7GO 4EPXA 4CUZA 3PNMA 2P6OA 1LH0A 4DJJA 3JYHA 4IM2A 3DZGA 3KG2A 4B4VA 3ZVKA 3AY7A 1T35A 4TYWA 2XWJI 1FFWA 1XMSA 2OLKA 3FSGD 3IIMA 3KXKA 1ZH0A 2JF0A 3NWBA 4KQKA 5A03A 2BE9A 4Y2UA 1QV9A 1DXYA 1U8TA 1VGRA 4HXYA 3X1WA 1NVTA 5CFQA 1WL8A 2V7WA 1WLSA 2XWBF 3GLSA 4PLPA 3V7WA 2PTHA 5ADHA 5SZIA 1DTWA 3KSBC 1VJDA 3GUZA 1D03A 3R1IA 1RWQA 3PHJA 1VJTA 1NPYA 1Q14A 2RH4A 1XN4A 3QFCA 1E3IA 2GUWA 3B6JA 4Z8XA 5L95A 5CCXA 4V0KA 1MX5A 3HDHA 3L7OA 3N8DA 4V39A 3UV6A 3MYRA 3N59A 4BEJA 3EIWA 4D8XA 5BN3A 5EHXA 2V7QA 1KH2A 4HLUA 2PWBA 1T0BA 2CCJA 2V7UA 2Z9DA 3ILVA 1NHGA 3FCCA 3ADOA 1L5RA 4GECA 4H7HA 2WT8A 1VI2A 3FFBA 1YJ5A 1KBQA 2GHRA 4JYBA 3ZJVA 1GGEA 3WZLA 1K4MA 3AEQB 3HABA 2YWJA 2B1RA 6REQA 5JQGF 2VAVA 4B3CA 5C7LO 2UZ0A 1B16A 4DOMA 1E20A 4P7FA 1PS3A 4L1KA 2OENG 3MWEA 5HQJA 1E8MA 1L4EA 2QMYA 1AG9A 1GG2A 2R9VA 3LFHA 4KSBA 3R7WB 3SMVA 2RAIA 1IMOA 2Y1CA 4V3CA 3T9CA 2EZ9A 1OV6A 2J4FA 3PR2B 4WHMA 5AO9A 5EMNA 3ND5A 5FWYB 4OJKA 4CMHA 1B6SA 3DTNA 4UVDA 4DR2B 3ESQA 1QGUA 2EKPA 2BR5A 2IYFA 1ZMBA 4OJNA 1P4JA 3O8CA 2D0PB 5BVHB 5KTKA 1DJNA 1KI6A 1MC8A 3ZV3A 2J0VA 3T95A 2HFJA 1ISPA 1FX0B 2I8LA 4DRZA 4A0HA 1GZ5A 2DFNA 4KCGA 3TL6A 1RRMA 1UJMA 2Q07A 4KFTA 4UU8A 3OFND 1PKXA 1WB6A 2QX8A 3LX4A 4TUYF 3R76A 3ZNPA 1I32A 1CZLA 1Q83A 1VJ1A 1YS6A 2CLKB 2HADA 3W79A 2OCAA 2QLJA 1BWSA 2EYQA 3SWWA 1HXKA 1R5EA 2WWFA 2X5CA 4GRDA 5HOEA 4RA9B 4KLCA 1U94A 4XSHA 3IJRA 3PLAE 4D9BA 4NFSA 3BLBA 1YOVB 5ER6A 2O7SA 2CJWB 4FINA 2AW3A 3BXZA 4P4UA 3FD8A 4NYMQ 5EMHA 4D25A 4MVWA 5DTJA 3HA2A 5IT9A 3ZD7A 2FU5C 1U0LA 1AUOA 2PMBA 3MF4A 2XE6A 3AI7A 3O2JA 1E3WA 3A4TA 3RIEA 3TR5A 4HYBA 2CXUA 1E3MA 4X94A 1ODJA 1X2BA 2XSZA 2YRXA 1V5WA 3F8WA 3ETHA 1ZNQO 5DT2A 3W77A 4NBKA 1ZD3A 4JBIA 4WPCA 4DABA 2C8VA 4Y30A 2QMOA 4Z9XA 1J00A 1GNQA 3BCUA 3OF3A 3PDUA 2DPMA 1QOPB 1V71A 3EJRA 1A9SA 3DC2A 4U63A 5AICA 5KB3A 5KVSA 1Z8HA 2AW5A 4RL4A 1XNGA 1TADA 4RSHA 4P54A 1NUAA 1JIQA 2ZPAA 1Q21A 1P2GA 3E7PA 3KJGA 3N87A 4TMVA 4GSKA 1VG9B 2AOUB 3RAPR 1TJYA 2XYPA 2QYTA 4AK9A 1ZR4A 2ZTUA 2EKBA 1HDXA 3BMQA 3FVQA 1UIMA 3H1GA 2YMQA 4G8BA 5AYVA 4C4OA 1J0CA 1RFGE 4A8HA 3WMWA 3E1GA 5LQMA 1KGDA 1WTAA 2ES4A 4DIKA 4MV4A 2ZPTX 8ATCA 4EB8A 2YJTD 1U8CB 1R27A 3OTOB 4WWHA 3I9FA 4H31A 2NV6A 3ZI0A 1A71A 1EWRA 3GUHA 3SZ3A 2ZRMA 4UHDA 3M89A 1H2AS 4LF8B 4M0KA 1R37A 1N6IA 5GONF 2W2VA 3TN7A 4M99A 3WQSB 5LIRA 3PNSA 2HMTA 1TKCA 5K20A 3F3MA 5EZYF 4WY2A 1AQ6A 1H6CA 1EA5A 3ICWA 4M0EA 4OBBA 2A5DA 1BCRB 3L6DA 2LD4A 4Q1EA 3EZLA 3L1JA 5LZ7A 4ED9A 1YKGA 3BMNB 2EJUA 2R8PA 4XI9A 4EX7A 4P2GA 4YAFA 3JQPA 5CLHA 4L8GA 3PC8A 1IN6A 3WYEA 3H2YA 4CU2A 1CDZA 5PGMA 1RACA 1F14A 1YK0A 3GFOA 3O47A 5HCNA 3DT9A 3TOCA 4C7KA 2XB6A 3O84A 5JBNA 2GH1A 4DCVA 3RS5A 2P4EA 4HNUA 1Z5GA 3NP9A 4XIYA 1E5QA 4TZ0A 2NUPA 3BA6A 2NUPB 2ORVA 3ESCA 1C41A 3EQ7A 4ID3A 4GKAA 2GEFA 3CZNA 2VDUE 1XRJA 2WD8A 5TNXA 3RO7A 3RYTC 4MIEA 1NC3A 3A6JA 3MMZA 1XCMA 3EZNA 2PT7A 1KMHB 3PI7A 3PRKE 4MWCA 1PUJA 2J9YB 1QFXA 1PGJA 2BHTA 2YL5A 5GV8A 4BCDA 3U19A 2YWEA 3H2ZA 1BKSB 1JFFA 4D0RA 1QPBA 1ZESA 3PGMA 3EVTA 4JN6B 3MZ0A 1ULHA 1V8PA 2GETA 4IHQA 1SWWA 3QEKA 4Q4HA 4L3WA 4RAQA 4YA6A 1TYDE 3ZVMA 4RK1A 4ZCLA 5AI4A 4GX2A 3C1UA 4JNEA 3DE1X 3PKIA 3QKRA 1Y8ZA 1P0IA 1V5FA 2DPLA 3ADKA 1KZ7B 2BFNA 3G1WA 2A5JA 2ZJFA 1OUMA 3G68A 5EPUA 2AMLA 2A35A 1WA5A 4QDJA 2FP4A 4EJMA 1ZA1A 3WGOA 1IXYA 1ZIYA 3R5TA 2A8YA 2MSCB 1ES9A 3ETGA 4ZTBA 2H0RA 4X9XA 2O2XA 3SQDA 3PQ3A 2I1QA 5L3VA 2QQEA 1XZQA 2XMRA 2G1PA 4K2AA 3HKCA 1EX9A 4CODB 4B3DA 2YDXA 1GL6A 1F3OA 5KOHA 4LF9B 4B3XA 2YW2A 4C2AA 3QTTA 3GF4A 2HQRA 2W90A 4O8ZA 1H23A 1XVIA 2GJ9A 3FCOA 4RF5A 2ORYA 4WZ6A 1C7QA 2IYUA 5ECGC 2R79A 1RP1A 1X1RA 4MRMA 1I4TD 3LLMA 3L8HA 3MXTA 3FDIA 3EGXB 3M82A 4UNSA 4D9KA 4AIRA 1XXLA 1VLLA 2R5NA 1E8NA 2BCEA 2QF7A 2K7ZA 3IBYA 5DV9A 3JAKA 4D46A 3JAKB 4F3KA 4G9GA 5KPJA 5J2TB 1ENZA 5J2TA 2CKMA 3NT5A 5G3ZA 3GDOA 3GX1A 1DB3A 1QSGA 3FYHA 2PRSA 4KACA 1WG8A 1X7DA 4M8LA 4D0SA 3UKDA 1H1DA 3JQBA 3ZWBA 1LI7A 1WQ1R 3ONWA 4JEUA 3B3AA 1WBDA 5IZCA 4MQBA 1IM2A 1G3IA 1KHTA 1IIBA 4YRAA 1L1EA 2ZJBA 1G8GA 1TF5A 1PQPA 1H3NA 1S3FA 3RWOA 4Q03A 2FI1A 5A04A 1JYFA 5KNCH 3U9SA 1T1IA 5K2MA 3KDPA 2B4YA 3IUMA 1YZTA 1D3AA 5L7TA 2L19A 4NBNA 1Z56C 2VXOA 1QIIA 3A37A 5FBKA 1H2XA 4BZZA 4R71A 4ISCA 1C3OB 5JAMA 4JXZA 1F8YA 4DIBA 5TT1A 1SU7A 3H4TA 1SVOA 1UT6A 3UHOA 3QKTA 4FFSA 3X1ZA 2HIMA 2WP0A 2H07A 1SIWA 1VE9A 2CE7A 1JAZA 2IOFK 3DZBA 2YMMA 3HO6A 2R5WA 1DAHA 2ZRBA 2HXYA 3LQ4A 1J8QA 1OXXK 2B9EA 2YV5A 5NULA 3FZEA 4RQTA 3ZX4A 2XDQA 3IDQA 1P77A 4OHXA 3OEHA 4CM5A 4MQFA 2H5EA 2PKRA 3OZTA 4HRYA 4IXTA 1Z17A 4KAXA 5HFNA 4QJ3A 2SICE 1KFBB 1FNDA 2GDZA 3S1LA 1MMFB 3BXXA 1Y5NA 2FR0A 2I3DA 3L92A 3M3HA 4MVCA 5CJ2A 2WU8A 4GVPA 2BFEB 1XPOA 1IHPA 3PTAA 2ID9A 4I9GA 2YOFA 2R751 3P5BA 3SXUA 1VHJA 2UYOA 1YI8A 3QLEA 1SGWA 2AHRA 4Q1BA 1S9HA 1KKUA 4I4TA 4M7PA 2R11A 2NZUG 3DYTA 3EIEA 3TIVA 4TWRA 3WKDA 3ENZA 4LSMA 1M1YB 4ARAA 4YUAA 4JEMA 4IW3B 5HKOA 5KVQA 3DX0A 4TS4A 3MM4A 5DB4A 4ZREA 3I5XA 4RWZA 2FSGA 7MDHA 4UD6A 1Y4DE 2Q3HA 4R7GA 3Q3JB 3FDFA 3GA7A 1Y8RA 2BH9A 2OB2A 4J0FA 3DQZA 3JQCA 3P9ZA 4K6GA 2E55A 2HLDD 1ORDA 3D1VA 1QYXA 2IZOA 1P61B 2G6BA 2KLHA 3CLHA 1WPQA 3O4JA 4W1PA 3RU9A 1EH5A 2M9MA 1M2GA 1SXHA 3T8YA 3U7QA 4ECAA 2OLJA 5E38A 4NECA 2RKWA 3AL3A 2M6KA 1G41A 1RVDA 1Q6ZA 1JHXA 3ACCA 1CB0A 1QB8A 4LNAA 4ZQFA 4UHCA 5BOSB 5CXSA 1P2UA 1XJ0A 2KB0A 5DP1A 5DO9A 1XL1A 3K4HA 2VHYA 4LF5B 1QQ5A 1YONA 5MN5A 3TVDA 1PO7A 2OR3A 2Q8QA 1RYBA 3DAFA 3GUUA 4U6NA 4PLTA 4UZEA 2IV3A 3WI7A 3L7CA 1RAIA 3IMFA 1RHJA 3NHWA 5T41A 4AKIA 4QEDA 4FNAA 1CRZA 4O4JA 2V3CC 3VNVA 2ND1A 1AU9A 2BEKA 4B9QA 3WGYA 4LK3A 5JHHB 1MKYA 3PNQA 1A9RA 1W9MA 2P8JA 2BMAA 3ISJA 2C3OA 2JIZD 2G4CA 1BDIA 1KR2A 4XCVA 1K7EB 4OCZA 1NYQA 2HBYA 4LXHA 4EG1A 4UZFA 1WPRA 1VZ3A 2QRQA 1TM2A 2D0IA 3N39C 3WGVA 3QOXA 2YY6A 3HZRA 4X1YB 1Y3DE 5DIFA 4RSRA 4C01A 1XHFA 2A0UA 2RCNA 2ZEJA 2ZBFA 3FPJA 4H7PA 4LCEA 2HN9A 3GJ4A 3LAWA 4M8NE 1XZKA 4E5PA 3KUUA 3USES 1ZSYA 3N6XA 1JVSA 3QBDA 4LDJA 4Z9FA 3H05A 2IYSA 3WR5A 4PLYA 5C4IA 4AJIA 4GS5A 1W0JA 1AT1A 2XZPA 3RG2A 3U4QB 1XDDA 5AH0A 5DVZA 4ND8A 4QVGA 5AW5A 5I7WA 1J06A 1XDBA 3LA8A 3QPAA 4S1TA 3EG9A 1U1EA 9GPBA 4L75A 3U3RA 1OLSB 5HIAA 3PHBE 1H2YA 5CYPA 2BGTA 1QS0A 3X43A 2HQBA 3M6MD 2EJVA 2A9QA 2QXYA 4OATA 1IOVA 1L8QA 2J3KA 3N8IA 1G18A 2PKWA 4OP1A 1ZD1A 1UJNA 4JITA 1FFXA 2WRZA 5DWQA 2JIDA 5DJ5A 2OM6A 3EGIA 4D5GA 3NWPA 1FFYA 1ZP6A 2ZTSA 1HLGA 2PSSA 5AW0A 3NEYA 4I4CA 3DVRX 4MV8A 1R5OA 1FRFS 3OD5A 1R00A 2AD1A 3RUHA 5A4JA 1GNRA 1SC6A 2TMDA 2DFPA 2YFKA 2ZU0C 3QU9A 4A27A 1USKA 2C9CA 3HXLA 4MAMA 1MA0A 3H83A 2XQFA 5SYAA 4NOLA 2AR0A 1DDGA 3NONA 1FCJA 2VTKA 2YYZA 4TWAA 3A3NA 1CF9A 1G8PA 1L5QA 1SHZA 1JAYA 2X58A 1A9YA 3FB4A 1U9CA 2NX2A 3EOZA 4H4DA 1FYVA 4LQLA 5IJ9B 1PNQA 2BI7A 5JMPA 5CA0B 2QVGA 5LZ2A 2WQZA 4Q9HA 2J7PA 2ZGVA 3A06A 3X1DA 4A2WA 2AYXA 1K5DA 3GZ4A 5LL6P 4F2DA 1NQVA 3JYNA 3REFA 3HQ4O 3JQBC 3DOOA 2JS7A 3OJFA 4L51A 4TV8B 3AR4A 4BQSA 1LLFA 2HYDA 3WIUA 1KR5A 3PNBA 2ZT8A 3C97A 4GZLA 1EBBA 4RFVA 5KU1A 1GG5A 2GBPA 3GYBA 1G8HA 4OA8A 4B47A 4B32A 3FYTA 5KNDD 1PZGA 3O2QB 3WB0A 1ZVKA 1G2OA 2PVSA 5DBHX 1LPOA 3RIMA 3A1CA 3NVKI 1PJCA 1ESNA 1XRSB 3AUXA 4I14A 1YJ8A 4GX5A 1T9DA 2V4UA 4N5LA 1EK5A 2QRNA 4LBZA 4KLZA 4Q02A 2VTVA 3DHNA 4IWOA 1AHNA 1PT8A 3EASA 1JG7A 4L57A 5B1YA 4FM9A 1RHKA 4LQDA 5CD1A 1POXA 1GUDA 2V7QD 1Z0AA 3GEGA 4K7JA 1LZKA 3SF0A 1YR8A 4ATNA 3C3CA 2OG2A 4HAZA 5JZBA 2QNIA 4R2XA 1C4KA 4PBSA 1CR2A 5DGXA 5JS6A 3FMGA 4BQEA 2E3JA 3WLQA 2DWQA 4GNKA 2H4HA 4XGIA 3JQ9C 4ER0A 4AN0A 2C5SA 5AI8A 4CTMA 5HZGA 2WD7A 1ZMTA 2D06A 4I50B 4LF4B 4AUNA 4AO8A 1HV8A 2Y05A 1XLUA 3DTVD 4MZXA 4PAOA 4XYGA 4KX5A 4Y0VA 2D62A 3K6RA 4YB8A 1EBUA 3SPXA 1GY8A 3M5DA 4RVNA 1NG1A 4EPRA 2YXDA 5AIBA 3A6LA 3GU3A 4AZGA 3I6MA 3EPHA 1SBTA 1C14A 2VPWA 1FFDA 2EJTA 1JAXA 1XYVA 4G0VA 5BY2A 4GKJB 1QHSA 3OEYA 1PNVA 4DUZB 2PLNA 2YKGA 1NBAA 3BVWA 2XTAA 4FLFA 1P7VA 4KX3A 2RAVA 3WNDA 2P7IA 3RROA 5FNVB 4B4UA 4N54A 3ACDA 3L79A 5DOVA 2P41A 5AOBA 2KYRA 4OHRA 1GSHA 4HYQA 1USVA 4NFLA 3ROKA 1VKRA 1G3RA 4TPKA 2WTAA 5ALZA 3H2JA 1RXVA 1I1HA 1X1QA 2NUTA 5KIAA 4ARVA 1H2EA 1A3CA 1NPDA 1OX5A 3BMXA 3ZIAD 1NUSA 3AY6A 3F1KA 2IYTA 5AKZA 2C4NA 3TRKA 2LRHA 1IG0A 1YDEA 3WMEA 3O7WA 4WBNF 2PUEA 1H9CA 3SDSA 1DEKA 1D1SA 3T52A 3UWDA 2PWPA 3TIXB 1KMHA 1PNOA 1HXHA 2ODTX 2BGLA 4MWZA 1K8ZB 2W43A 3N86A 4F3YA 1QFYA 2WMDA 3CEMA 2MINA 1VHLA 1DKXA 1YRYE 1Z0DA 3CEHA 5H82A 3RSLA 4JYZA 4DLPA 2I4MA 1XAJA 3SR4A 3ZHTA 5JJCA 1RXWA 2JIMA 1U9IA 1XRLA 1YQEA 3RYFB 4UUAA 4LFCB 4ZZIA 3T1HB 2WM2A 2P9TA 3SX0A 2HA5A 2C58A 1J1IA 1KC3A 2WU3A 1JDZA 4RZHA 1WHSB 4TKUA 2CXPA 4Z1MD 3EDRA 4E7OA 5JOQA 2ETXA 5DYWA 3U62A 4H27A 1EP9A 4G6ZA 2UVPA 3D3NA 1YZNA 1HRDA 2PUHA 4WKGA 2OCIA 4EZWA 4LC0A 5HZHA 1M2WA 1GPUA 3FA2A 4DEXA 1KRXA 2VCEA 3T06B 4DR5B 3JVIA 5CLLA 1OBFO 3DPIA 1WCYA 3ZPXA 1N78A 2KX7A 2YXBA 3U49A 3U13A 1Z83A 4UAGA 5AKHA 5KI6A 4ND6A 3KSZO 3LQKA 5E6UB 5AQ1A 5EHZA 1TYEB 2M32A 5JR3A 2C2HA 2G0AA 2XF2A 3F3YA 4KMRA 2YJ6A 2FW0A 3FWNA 4YIKA 4CM8A 4DDTA 4FHDA 2H0AA 3P27A 2OZLB 1M1XB 3P9XA 5KSYA 3BMCB 2CMFA 4P5PA 4BVFA 4ENPA 2NO9A 1UKAA 5LYJF 1L4GA 3L1IA 4KE8A 4V2IA 4WV3A 5BWNA 3WQRA 2B98A 2IY8A 4QJIA 4WZAE 1HQCA 5D5QA 1E1QD 3E4DA 1E2NA 1FUYB 1RYMA 2PWYA 3T47A 4IS3A 3I12A 4EPVA 5HK9A 2QQ0A 1S8NA 3K70B 5CT9A 1CIJA 3VR5D 1GKUB 1X94A 1QWSA 1AURA 1JEQB 2NTJA 2ZR7A 3KCNA 1QGAA 4KFUA 2GX6A 4L4XA 3N1UA 5FWDA 4JLNA 3R9WA 2TECE 4N8SA 1KF0A 3AF3A 4L16A 3LPAA 1SVSA 1C30B 1BDMA 2PH3A 4CV3A 3FIJA 3IQEA 4P31A 5BR8B 4B4WA 1JKFA 3LUDA 5A9TA 1C9YA 1M5TA 2BPOA 3KZMA 4RD6A 2WV7A 3PBKA 4K6KA 5CX1A 2ICAA 4RCZA 4QGGA 4FC6A 3LUHA 2WWWA 5ICGA 4QOSA 3KKNA 2WWIA 1QWOA 4UDOA 4U7FA 2OCPA 4O4JB 1R1DA 2C1EA 2WSMA 4NABA 1E6MA 3MJDA 2NV2B 4P3YA 5CW1A 1P6QA 2G88A 3DC7A 4G81A 3U40A 3D31A 3H7IA 1CEEA 3KKEA 1ZW1A 2PRKA 4G63A 1H6AA 2QXUA 3G8BA 1YU9A 1XK6A 5B7QA 2JH8A 3EVEA 3LF2A 2DSTA 2C5AA 4RWEA 4RTMA 3KB1A 1ZZEA 4G09A 2Y0PA 1NWHA 1AQYA 3B89A 3AI1A 5F2OA 3M83A 1OJLA 1CUZA 2H7VA 4OIMA 2EBUA 2FFJA 4CMGA 1VLHA 2EHJA 5CBPA 2EEZA 1TB4A 3FDJA 3R20A 3RYIB 2ARKA 4F4UA 3AWIA 5ALTA 4RKWA 1PJ3A 5JECA 5KOJA 3HVRA 5DN6D 1S4QA 3QXHA 2IT1A 4OB7A 4MO2A 2Z2IA 3Q4GA 1ZVJA 2ZJ3A 1ATIA 5EUBA 4G86A 4DZTA 2ECFA 2A5YB 4G0OA 1M2NA 4Q7JB 4QJBA 4WOBA 4OP2A 1D4OA 3WL7A 2DKFA 1QQTA 3LH5A 3VSAA 3I58A 2WWXA 2LCQA 3D3KA 2V03A 3AB3A 4A0QA 1P5HA 4BVLA 1Z7EA 5AW2A 5B3JA 2C57A 4ZZ0A 2PQ2A 4OSEA 4BBAA 1I7PA 1ZITA 4Y2GA 3RABA 1TQ4A 4CMIA 2V0GA 4PC3A 1Y5RA 5JNUA 4MHTA 1PD1A 3W7AA 1QIGA 2AN5A 4D56A 4XWTA 4RK6A 4EG6A 2R1ZA 1THMA 2WWGA 4P5DA 1TEZA 1L4UA 4BBPA 4UKDA 3R0JA 3FRJA 4E70A 5IN5A 3V55A 2Q50A 3LCMA 4MMYB 2QJOA 1R34A 2CD9A 2G40A 1B8UA 1WPXA 1ZYLA 4W5WA 3OM1A 4RVDA 1U3DA 3BTOA 2BEJA 3FAKA 3JPWA 4CEIB 3ZDXB 4KNVA 3UMBA 3CLRC 3HVIA 3TNYA 1LQUA 4YCBA 5SYNA 2XF8A 4OQYA 1J5EB 3KFXA 1A2QA 3CR8A 1N2GA 3HBFA 2H8GA 4PIMA 1G7CA 4DCPA 4YJKA 1JVBA 2RK3A 3KQWA 1QRDA 2QTMA 2NU6A 3HPQA 3ZVNA 1KYWA 4RV5A 4DA0A 4NNPA 2CSUA 5IC6A 1P1JA 5JSHA 4RHCA 4D3SA 3LIPA 5C18A 3GNLA 2QTCA 1YFLA 3B3JA 3CVWA 3V42A 2YNMA 1SXJE 2WG0A 4JC5A 5FTWA 1LX7A 3H2SA 1J33A 1ZJ6A 1BQEA 4HYTA 3ECCA 3GLKA 3C3WA 3ZE7A 4O4HF 1LDNA 2BVNA 1WR8A 5IX8A 1EDBA 3T1YB 3I8OA 5ALEA 5I7HA 2R48A 3USZA 2GKSA 3EZ2A 3OY7A 5K0CA 5IM5A 3QG5A 3QE9Y 1T6ZA 4KXFB 5BQ5A 1MAAA 3LL4A 1PJZA 4MVJM 5AOAA 1N2CA 3RLIA 5M29A 3HZHA 3LWBA 1LPNA 4IEEA 5JAZA 3VH1A 3HJHA 3IESA 3Q40A 3DZKA 2QQGA 1E0JA 4V1CA 2XMDA 1GFWA 3L3OM 1L1QA 2D3WA 2XLCA 4RF4A 4XJXA 3UXMA 3ZVRA 2HM7A 1NY5A 1M8PA 4KPUA 3TOSA 1CJTC 5K3FA 1I5RA 2P62A 3C5HA 2JJYA 3K96A 3ZEAA 4QM7A 4B43A 3ROGA 2ODAA 2W71A 3EQZA 2Z6VA 4X3CA 1URUA 2CJXA 4G1FA 4ZJZA 5JH7A 5LYJB 1I3MA 2R1TB 3EFBA 1Y48E 3CG4A 3HB7A 2ZE6A 3PFWO 2J32A 2QTVA 1JHVA 1NXSA 3DGEC 4I4LA 4AMUA 4EYQA 5AM2A 4XPZA 5FUQA 3COPA 2EFCB 4OQ4A 3NT2A 3T3MB 1Z4NA 4QPCA 4DQDA 5JO0A 5G2OA 3QUTA 4GOLD 4JAVC 4Q4AB 3KS9A 1T9HA 3QX9A 3G9ZA 3T1TA 2GDJA 2DMRA 4BB5A 4XJVA 5LNK1 2TMGA 1F0PA 2X15A 1T6XA 1CRLA 1QAOA 1M6HA 2VWGA 1RQRA 3AL2A 3LLCA 1CUYA 4HEA1 3WNVA 4BASA 3BDIA 2NYVA 3A1DA 1Z37A 3A1SA 1KDVA 4BAGA 2JGIA 3PX3A 4JOQA 2IHUA 4OXNA 3OY2A 3EGOA 3GEMA 3AJAA 2P65A 3MG9A 4AXBA 3P9PA 1PUXA 4BO4A 4KO1S 4PYJA 5KWSA 3CX3A 4Q24A 4YX9A 4EZYA 3IOMA 2YIBA 1F9EA 1BMQA 2PNFA 3FUVA 4K2HA 3RADC 3PD0A 4L5JA 1IZ0A 4N39A 4OUDA 5TJ9A 3O9VA 2DOKA 2FPSA 3F2IA 4WESB 3E15A 3T7CA 2QD1A 2PRYA 3GWZA 1L7MA 3DHWC 2V59A 3E9EA 2Q2VA 3O5AA 1L5YA 4FGWA 3BXPA 5REQB 3ZZ0A 4DA4A 4EH1A 6ABPA 1W29A 5F35A 3VR4A 3N2IA 4R51A 4TN5A 2VYVD 2H54A 1SUDA 2NPFA 4DMUB 2K2QB 3NORA 3OQPA 3OOWA 1Y3BE 3LCRA 1ADFA 3NALA 3U09A 2KHZA 1W0JD 3PP8A 3ERCA 3VTAA 1QUFA 1IDN1 3JQEA 2A9RA 2VJDA 2C9DA 4OQZA 1NW8A 1SQ5A 3JWPA 1QH0A 4YMSA 5FTKA 3W9UA 4BOYA 5JXWA 3GVIA 1HORA 4GXRA 1AUPA 1YH3A 3C6QA 2OQVA 3MXOA 1HOTA 3DDFA 2QD5A 2GNAA 4ODIA 4UU0A 5E95A 5K1ZA 4B83A 4BKQA 4DNFA 4FLEA 4EHJA 2YHBA 4QOEA 3LS2A 3OEHD 3RWBA 5HBRA 1RZVA 3CVYA 5JFOA 2BGWA 3ES9A 3VPGA 4CHGA 2GLXA 5FBWB 4URWR 4OJTA 2XGJA 1PYOA 1ESDA 2YHIA 3GROA 1HKUA 4RE6A 3C6ZA 1N92A 4G4SP 3CURA 3F5DA 4L73A 3ZY6A 1EFCA 4ADSG 1Z45A 1L9KA 3OZ7A 3CUEF 1YWMA 2FJ0A 2WE8A 5JSUA 4RIHA 4URVR 5ENZA 1IPEA 1P4RA 2PD3A 3C70A 2B37A 1F5NA 3OSZA 4HDAA 1E32A 1XEXA 1V5GA 4H9GA 3VKVA 2JFZA 2HTEA 3GZTB 1S1CA 4JLKA 2RARA 4UJ5A 4WVFA 3DO8A 2IV7A 1V7QA 1KMIY 3I92A 2C4MA 4L74A 4XTRA 3UJ3X 4D1YA 2ZJ2A 3BXEA 1FTWA 4HAWA 4X54A 5BSMA 5T7BA 1KRHA 1WNTA 2W6ID 3IDFA 1A82A 3OA2A 1XCJA 4KQGA 4LQ4A 4YNBA 4DB2A 1XI2A 1GR1A 1KL7A 2IUTA 1DVRA 4LYGA 5K8CA 5KTTA 3W6PA 4B3MB 2CFTA 4CE6A 3AP1A 1GU1A 4IRUB 1RR6A 1WB5A 3HRIA 3LSYA 1DE0A 1EX7A 1Q19A 4IDAA 1GT91 4DMMA 3ASVA 3B38A 2QX4A 5K0JA 1RCFA 3QLJA 3G8DA 3KFVA 2RBKA 3D1LA 3STUA 4AUEA 1TA9A 5CRIA 3RVSA 2ZIXA 4X6LA 4CM8B 4KITB 4EZTA 3B70A 3CC8A 3C6XA 2X4LA 4UFOA 5A05A 2ENWA 3LGSA 1XA4A 3Q8LA 1JSLA 4B3HA 4IVNA 4F93B 4IV8A 1JILA 1EK6A 1HDRA 1OAOA 1TQSA 1PLKA 5TGTA 2P2ZA 2X6QA 4DDKA 3IMCA 1O95C 3MGBA 2FN9A 3DG9A 4ZJPA 4I46A 3PGA1 5JALA 4PC6A 1NM5A 4UPVA 1GZVA 1I1OA 2I3GA 1EWYA 3T46A 1KJIA 1IJFA 3FTDA 1G3QA 3G85A 4PAWA 1K6XA 4TZTA 4GM1A 4QGAA 3OSUA 1U2PA 5F9MA 3FR8A 5AK3A 2LVBA 4MOWA 4CZ2A 3RVKA 3GLGB 2PUWA 4WOJA 2YTZA 4C4SA 1YXMA 1N0WA 1ACLA 1NMYA 1SEVA 2F59A 3PQFA 4FDTA 2C4UA 4E5DA 1ESZA 2BSXA 3HB4X 3PICA 1P2VA 4INOA 2RONA 1BOOA 5BMVF 5A9SA 1QO9A 2VUIB 4IEIA 5DSTA 7GPBA 3OT1A 1HSOA 2A0YA 4RPIA 4BX3A 1P9WA 1FQJA 2B8NA 2HREA 5D3MA 5FB3A 5EUCA 1IY0A 1KWGA 1X92A 4UHKA 3C6MA 1ONOA 5H3LA 5IKEA 1PZMA 4QNNA 1RHUA 3TK1A 3L06A 1EA7A 1MO5A 1CKEA 2PRIA 1QRTA 5CYGA 4DQ0A 821PA 1P8JA 1QGUB 3PL1A 5C34B 4OQNA 4JC0A 1GQSA 4FMCF 1AK9A 4E0BA 3PUJA 1KIFA 1ZK2A 3DL2A 3BA1A 2W8ZA 4F71A 2A5GA 1Y4SA 2QENA 2HV9A 4KIFA 4PSDA 3Q0TA 3GDHA 3OJOA 4UXHA 3L4JA 5KQMA 1Z4OA 3L6OO 1X6VA 1UF9A 3FPLA 3OLCX 1DQPA 4H6PA 3G0DA 4RF2A 4D80A 1QIKA 3IVAA 5BVGB 3PE4A 3EEIA 2Q9BA 5E9JA 2GWHA 2W2TA 3PFHA 1YZFA 1EG2A 4BFCA 2OQRA 1AF4A 2JKYA 2R97A 2XYQA 4IVQA 1ONSA 3E8MA 4QARA 3RGWS 3TRIA 5LM3A 1TKRA 4W99A 4EW6A 5JBIA 3OICA 3DW3X 4Q82A 1KPGA 5FO0A 3DF9A 4F56A 1I49A 1K8XB 1OT5A 1WVIA 2I7CA 2CJWA 2W2LA 1DWQA 3VZQA 2FKNA 3PXEA 4YI3A 3L40A 2VXYA 2POCA 3BE6A 4AKVA 2HA6A 1JU3A 4YREA 2WIAA 3MTDA 4R31A 4DJAA 4DWVA 3BD8A 3E81A 5F64A 1IY2A 1XKQA 4DBZA 3SBEA 3MTAA 3PX7A 1A8UA 2A7QA 5D2CA 2AF3C 4HDSB 4IBOA 3ZY3A 5ALOA 3ADPA 1U6IA 4HXEB 1LK5A 4RH1A 5HILA 3VA7A 2CXHA 3IEIA 3FOZA 4UM9B 3IKJA 2L17A 3ONEA 2ZIZA 3AVXA 4H6IA 2AUNA 8ADHA 1QMGA 3HR8A 2XCUA 3LTEA 1T4GA 4JSYA 4HR1A 2AJLI 3VR5A 4KN6A 2P1RA 2GPTA 1RKQA 1W19A 1JL3A 2CT8A 3D4OA 4EZPA 2GO1A 1KI4A 1SCBA 4OAPA 3C1TA 2FSPA 4WAUA 3EODA 1NDHA 1S7GA 2W6OA 3A6GA 3HGMA 4G0XA 5LC1A 1PYGA 2ADOA 2F8MA 5E4FA 1NQWA 3BTSA 3G0OA 2R25B 2XUHA 2C4TA 4KXMA 4PLHA 2REQA 4AVYA 1E1RD 3G2PA 3LHFA 1P4SA 4DPKA 2Z1MA 1L7DA 3NDRA 2ZZMA 2R1VB 4JT2A 1REQA 3OJ0A 4NULA 4ZO4A 5ALHA 3GN1A 1X74A 3C3KA 4EZOA 1GSAA 5ALUA 3KSMA 5CX4A 3WQHA 3DHEA 5CHEA 5CA1B 4DT1B 2VK2A 2Z57A 2JD2A 3FNHA 3U17A 1FYDA 4DT1A 5BW8A 4MJ3A 1KYQA 3IEUA 2BM9A 2JD0A 2Z4SA 1EVZA 4WBSA 4NBUA 4XX0B 2YHUA 3DEAA 3SI7A 3FVWA 5CFPA 3MS2A 4PAMA 2AB0A 2MYTA 2OFOA 3R7FA 1LEHA 5M04A 4JV5B 2ALWA 1YUMA 4JB0A 1C50A 2X6TA 2HJ9A 3RT1A 3LKDA 2O5CA 4RTJA 1T3TA 1AGXA 3LTNC 4XVQA 3F5FA 1S2NA 3L0IB 1DAMA 4MV9A 4QA9A 5A7GA 3UK7A 4DCJA 2EDAA 3L46A 5COQA 5CLJA 3UPUA 4BFXA 3E03A 4IYJA 2WFZA 1P44A 1M66A 3H11B 3D3WA 2OC4A 2QRPA 3OX4A 3PFBA 4KVAA 1NY6A 4O2AF 3ROEA 2V97A 2D59A 5CDFA 4B09A 1Z16A 4IDFA 1OZAA 1LBEA 2WK1A 1C8VB 2I66A 2PYDA 2QRGA 3BIWA 1D5CA 4MULA 3TQCA 3UA4A 1EUZA 1LRLA 4KR7A 1KSJA 2CY0A 5LP6A 3RC9A 1VG1A 1BGXT 4PSKA 1JTVA 4BO8A 1UK8A 3K0SA 3SR3A 1X7YB 1WZEA 1VE6A 4Q7KA 3VNRA 5KSOA 3HVHA 4OREX 3AW9A 3LRTA 2QR5A 1P81A 4MGHA 4AZIA 5E1DA 1WB9A 3ENVA 1OAAA 2ENUA 1IRXA 1RJ9B 3EMBA 4DR7B 1G4HA 5LVAA 5DN6A 2V6FA 1UADA 3AOEC 4G0MA 4C0AC 3Q10A 1F6DA 3JWHA 3ER6A 5AKKA 3N28A 3Q88A 3G82C 1MAWA 1HG1A 1VCIA 3PNPA 5FUWA 4AS3A 4C0BA 1ELOA 2QN7A 2Q28A 1EXNA 3RNLA 4D57A 5HM8A 5KREA 2FPIA 5FR2A 4OSOA 2D2EA 3MAGA 4UCFA 4DG5A 4OKIA 2XIQA 3VYWA 1XMJA 2G5CA 1SCDA 1W1IA 3J7AC 1OU0A 4HV4A 5E3IA 3JX9A 1EVKA 1WEKA 4HTFB 1ZUNA 4U7WA 1VB3A 4TT8A 5EI5A 5A4AA 5DM1A 3C6BA 5DNYB 1Q20A 4DXDA 1BCSB 1ZH8A 1ZAYA 4QDUA 5IW8A 3DS8A 1F4PA 5TPZA 5KYGA 1T29A 4ZT5A 4AUMA 2XVMA 2E18A 1R8YA 3IUEA 4GP9A 1E3DA 3R4CA 2EFHB 4Q47A 3C48A 4IIYA 4RZXA 4DYLA 5EZ5A 2QBYB 3W5BA 4G5QA 4L08A 5BT9A 5LBTA 2CDNA 2DRIA 3A7EA 4FDLA 4YRTA 3KR9A 4KPEC 1K5HA 2WJIA 3AUSA 2HFKA 1IULA 4KHZA 4BVBA 2CNWA 3SVTA 1M6VA 3AI3A 3CUSA 5BOSA 1T5DX 2YKTA 1A9QA 1JLLB 5TB5A 3T7SA 4BO1A 1ENPA 1FDTA 1DLIA 4AVMA 4H6VA 4RTOA 1BQ4A 4MVJE 3ZD9A 1WD7A 5LB2A 2ZRQA 3OI7A 3GCXA 4KWCA 3WSTA 4QTTB 2XXJA 1LF0A 4FU0A 4JUAA 1MFZA 4ZAFA 4QXMA 4H6XA 4Z3DA 5UKDA 3OQ6A 3QA9A 5ITWA 4X71A 2GKOA 3ZCVA 4CQLA 5CB4A 2XMBA 3DMNA 2RKBA 4LRSB 2E4ZA 3N2NA 4S1OA 1N3IA 1WKVA 2EC5A 2OGUA 3COZA 4EHAA 5BMVB 3UAWA 2Q5CA 4FXOA 2IP2A 4JH0A 1X39A 5DE3A 1QZXA 1KFKB 1JR4A 3GLRA 4X1KB 4LHWA 2ATEA 2QV0A 4X45A 1E64A 3I28A 4XDHA 1YQUA 5FD8A 1V3UA 4W9NA 2JRLA 1C4WA 3OE7D 3QVSA 3ZKWA 3IUPA 1Y80A 1YHYA 2OOSA 2VAPA 4QOJA 1DJLA 3I2YX 3GJ8A 3FUXA 1DKUA 4I08A 3T5BA 4O3MA 3RRMA 4BNKA 4MVJD 2C4HA 4WJZA 3SIXA 2ST1A 3K53A 2C88A 1SXJD 3MINB 4QQFA 4URYR 5ERGB 1B41A 4EKGA 2YWCA 3UMJA 4A0GA 3U4DA 5DNUA 1BXGA 3HLTA 1P3Y1 2XPCA 2PU5A 4KIKB 4ES6A 2INGX 1PG5A 4R5JA 1DBWA 2BY4A 4CQMB 4Y9TA 1JR3D 2DUMA 1WCIB 4MMZB 4AN1A 1NIJA 4ZD6A 2O2CA 4M98A 4CM3A 3F98A 3MRSA 1D5WA 4NE7A 1EVJA 4MQEA 5JY1A 2ROQA 5J9FA 3R5XA 4NU0A 1EAYA 4EB0A 4HEQA 2IYOA 3T4XA 4EENA 1RBYA 2QMZA 3NHFA 2NW6A 2VG8A 4UMDA 1XZGA 4FGKA 5F5LA 1H1LB 3FNEA 4O4LA 4ZHSA 4ZOLB 5IJWA 3JYLA 5JSQA 3NOOA 4IDBA 3ZD8A 3MC1A 3L1HA 4MS1A 3LW8A 4R4JA 3T0IA 3H0CA 2JIZA 2P9YA 1C1DB 2GFHA 3E7WA 4DR1B 5DTRA 3CCFA 4R5GA 2H2AA 2G06A 3M34A