3O3MB

(r)-2-hydroxyisocaproyl-coa dehydratase
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
373
structure length
373
Chain Sequence
MEAILSKMKEVVENPNAAVKKYKSETGKKAIGCFPVYCPEEIIHAAGMLPVGIWGGQTELDLAKQYFPAFACSIMQSCLEYGLKGAYDELSGVIIPGMCDTLICLGQNWKSAVPHIKYISLVHPQNRKLEAGVKYLISEYKGVKRELEEICGYEIEEAKIHESIEVYNEHRKTMRDFVEVAYKHSNTIKPSIRSLVIKSGFFMRKEEHTELVKDLIAKLNAMPEEVCSGKKVLLTGILADSKDILDILEDNNISVVADDLAQETRQFRTDVPAGDDALERLARQWSNIEGCSLAYDPKKKRGSLIVDEVKKKDIDGVIFCMMKFCDPEEYDYPLVRKDIEDSGIPTLYVEIDQQTQNNEQARTRIQTFAEMMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alpha subunit 2-hydroxyisocaproyl-CoA dehydratase
publication title Structural Basis for Reductive Radical Formation and Electron Recycling in (R)-2-Hydroxyisocaproyl-CoA Dehydratase.
pubmed doi rcsb
source organism Clostridium difficile
molecule tags Lyase
total genus 144
structure length 373
sequence length 373
chains with identical sequence D
ec nomenclature ec 4.2.1.157: (R)-2-hydroxyisocaproyl-CoA dehydratase.
pdb deposition date 2010-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06050 HGD-D 2-hydroxyglutaryl-CoA dehydratase, D-component
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.370 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3o3mB01
3.40.50.11890 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3o3mB02
3.40.50.11900 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3o3mB03
3O3MB 3O3NB 3O3OB
chains in the Genus database with same CATH superfamily
1ABFA 5SZIA 2J6IA 4HCJA 4AY2A 3GGPA 1W73A 3ES9A 1IATA 1DBRA 2JGRA 1A8QA 4QSMA 3WHPA 4RA9A 2RHRA 1M2OB 4G89A 5IASA 5LR6A 4M83A 2ZCUA 4EZXA 3EZYA 1E96A 3A7EA 3LVFO 1A98A 3PC3A 2Y4NA 1QWNA 2YWCA 4HEA1 2QQEA 2HX1A 1UXIA 3VOBA 4UEKA 1OROA 3B2NA 2WJHA 3QEAZ 3BM5A 3OX1A 2IZOA 1XDZA 2PX8A 2VHVA 4ZN6A 2JFXA 2NXWA 4KYUA 2L69A 4QDTA 2MWMA 3C70A 3MWDB 5ARCA 9LDTA 5LN1A 5B12A 1Z5UA 1H1LA 3FSRA 1IFXA 1LZKA 1QB7A 1HORA 2RCNA 1A8HA 4FQ5A 4GXRA 4NFSA 4Z0NA 5I7AA 4C3ZA 1SN7A 1DO8A 1RBQA 2QPAA 3GIWA 1IVYA 3KAPA 4HGOA 4G86A 4Y6GB 2G71A 1X13A 2FN7A 2VG8A 3E9EA 3GDWA 3HVJA 4HI0E 5AVKA 4F11A 4MI1A 1T2AA 2ZKIA 1AIPA 3BE8A 2VUTA 4L8LA 4MVYA 4QYIB 5AKZA 1OTYA 5MFPA 3DFMA 3H18A 2XNHA 3CKLA 1DBIA 3OZRA 1CEXA 4Q7MB 3GRFA 3WWOA 4P81A 3M3HA 5FHQA 2CB0A 4ENVA 1P8AA 1MX1A 1E3EA 1GQYA 1LNZA 4ARZB 1X39A 2Y71A 3DM9B 3IQGX 4ZVUA 4RTLA 1SQ5A 3EQ6A 4TT8A 1X8KA 1SKYB 2RH9B 4KTTE 2OZNB 3KR1A 4LTMA 4DY4A 5CFZA 3IEVA 4RPKA 4XOIA 3CBGA 4DA7A 1LBQA 3JSAA 4HZUA 1P18A 4DJTA 2FI1A 3W6NA 2DPXA 1XQ9A 4LJ4A 4H7EA 1DAPA 2JH8A 3VU9A 1IOLA 3PU6A 4A8JB 5KTOA 4RUKA 5AVWA 3WG9A 1FPMA 2ORYA 1QLJA 3FTNA 1X94A 2AJCA 2O4CA 2QPOA 4EZNA 1IY2A 2EGHA 3KSRA 1KU0A 1T25A 4H6XA 1C9EA 1T8PA 4FC7A 1M3SA 3HN6A 2ZZNA 4AZHA 1XELA 2R7AA 3FW1A 3VHRA 1A2OA 3N0TA 3NPMA 1FZQA 2PKWA 3VYVA 2AK3A 2BEWA 4EO9A 4XEHA 4C0SA 3OCJA 4O59O 1EP3B 2WM9B 2CDCA 5BWCA 2HN9A 1CUUA 2Y66A 3CO5A 5B30A 3I1IA 1VHQA 3G7UA 3N7UA 2JKVA 1NNI1 3OMWA 4J0QA 4W7HA 4XKJA 4NVRA 4NG5A 2R68A 4LFCB 2VP4A 3TW8B 1XTBA 1JXQA 3VVBA 2WM8A 2QAJA 4U7PB 4DHEA 4BEJA 2E4VA 2HTEA 2WP8J 3KQVA 5CX4A 4YRRA 4G26A 1QHYA 2MI7A 1QIIA 4GOND 4UDNA 3CT6A 3ICCA 1Z0SA 1ZDMA 4TMYA 3OKCA 2GDZA 1P4RA 2XF8A 4O33A 4LF8B 1OZGA 1KJYA 2IXFA 3FRJA 3WBJA 1JR3E 1F14A 1MC4A 5BRJA 1X0XA 5CVDA 4G1EB 3AONB 4P54A 1J99A 3AVPA 4LRQA 2P0AA 1PZGA 6PFKA 3HCDA 3DJYA 4MVJI 2OD2A 1R8QA 1PGQA 2DVMA 3TSZA 4MYTA 3PNKA 4P7FA 3RTEA 3RODA 1G21E 4TLMB 3S1AB 4JI8B 2ZITA 5LA6A 2Z6AA 3G5LA 2XCLA 3K8YA 2DR3A 4YRPA 1TECE 1Q3HA 1ZK4A 3LVRE 4JL9A 2BKAA 4IDPA 3SQLA 1ZM3A 2J48A 3EPRA 1L7AA 1TKAA 2A4KA 2C61A 4R2XA 3TOCA 1LC3A 2HXSA 2Y68A 3ADKA 4QOIA 1JYSA 3HWX1 1H0KA 4RE6A 4CFZA 1E3QA 1XZGA 1QS0A 2RHBA 3NH6A 3P2MA 4JWEA 4FQ8A 2C2GA 2PPLA 5CYOA 5CPFA 1FK8A 4A4DA 4CQNA 1GRCA 4JN4A 4N6NA 3WMXA 2QX9A 4XPIA 4IXDA 1MOPA 1RJEA 2IZZA 1DRWA 4IJ6A 5KOYA 4A91A 2QLNA 5AXAA 2OYCA 3ZCQA 2BH2A 1O03A 1M34A 4OB8A 4RD4A 4AN1A 1JR6A 1GVNB 4ZEMA 2FW9A 3AW8A 4XCQA 1QIHA 1NRXA 3H1BA 3NXKA 4INZA 3IUQA 1EQAA 1WO8A 2OP1A 1D8TA 1JHZA 3FHLA 3G2KA 3T12A 5I7UA 3KJXA 1GL7A 4AKEA 1N57A 3IUPA 2HZBA 4AB1A 3CCBA 4BGDA 1JBKA 1QJCA 2JLAA 3F6YA 3R40A 2NUAB 4D98A 4CLRA 3HZOA 3RS7A 4EY8A 4CEJB 4UXHA 4IWXA 4FR2A 1RP1A 4CIYA 2N47A 1RJGA 4AW9A 3D0RA 2H54A 2JFHA 2JASA 4I36A 1YQ9A 4O4HB 2EKPA 3H17A 3LSTA 1GP2A 1RMQA 1BZYA 3TLXA 3NAMA 3UJPA 4HQRA 1KI7A 3E3MA 2C7BA 2JBWA 4FX5A 3K8ZA 2M2IA 2DZDA 1M6VA 2OGTA 3W8FA 4J3NA 4O2AB 1MVLA 2EHDA 4C05A 3ZHSA 8MHTA 2YL8A 2H5IA 2ZJ2A 2X4DA 1MDBA 2PA0A 3KT6A 1KK0A 3PR1A 1IIRA 2WG0A 2J6BA 5DBEX 5FORA 5J5AA 2O2HA 4WH0A 3H5TA 2H3EA 3D4ZA 2IRWA 4MUNA 1PL8A 1MZPA 1FFDA 3COYA 3X44A 3U3KA 1JWLA 2VP5A 4HNVA 4HV4A 1JJIA 1K7FB 3SN6A 4EG7A 5L4LA 4KPEC 4IJUA 4D9HA 2ONCA 4IIUA 4TQUS 3RPMA 1I4LD 3ZBPA 4MRMA 1YR7A 3VU8A 3MUFA 4AZ3B 2RC6A 1HTTA 4KIJA 3OCCA 4B3HA 4I9FA 1QOZA 4JXJA 1M2FA 1XRPA 1P9WA 3CHYA 4BNZA 2P67A 4E70A 5JFTA 2DQSA 2I65A 3O91A 2ZIZA 1E2NA 2F64A 4YGYA 4KFCA 1C3OB 3BXPA 2RGUA 2J8ZA 4OSOA 2J31A 4WKBA 2V6MA 1G9XA 2O0LA 3HH8A 1XZAA 1KFJB 3PI7A 1E3WB 1I4LA 2A30A 2FR1A 2HMTA 4XJSA 5AHOA 1TRHA 3MVEA 1WUJS 3PNQA 4LJRA 1FUIA 3CS3A 4FE7A 3TI9A 1L5HB 3CLVA 3EA5A 1BGWA 4DR5B 1XYYA 4JQYA 4PSUA 2BFMA 4QXMA 4C7KA 1OH8A 1WDWB 2XUQA 4UFNA 3A31A 1YT5A 3E3AA 2MR6A 2QLMA 1SJ9A 3FE2A 1OWMA 3QNUA 4J1TA 3SJCA 4CKEB 3VI3B 2G8NA 4JCOA 3NBXX 2PUEA 1Q7RA 5DW3A 1P1BA 1Z5OA 2Q5CA 3ICVA 3SJUA 1I01A 3L4BC 3RARA 3TZ6A 4Z7JA 4QTZA 1RJDA 1S2LA 1D2HA 1UJ2A 3PF9A 4YECA 3MILA 2EL9A 3QNMA 3X1YA 1RS0A 1AZLA 3WSTA 3SDBA 4BB6A 1BXGB 5AXBA 3L0OA 2C1XA 1T0HB 4U63A 1BJRE 1JL3A 1XDUA 1E9EA 1PFUA 3CX3A 1J1IA 3OLZA 3QVTA 2W42A 2IP4A 4FONA 1F0KA 1WIWA 5KAPA 3TDMA 2OESA 2Q6LA 4M7PA 2NZ8A 4B1FA 1U3GA 3F1LA 2X0JA 1DOHA 2B1IA 3JQCA 3UMVA 1WXGA 3NJ4A 2KI5A 4BN4A 5JJIA 1F6WA 4HPXB 2YMQA 5B55A 1NW4A 3JV7A 3TZLA 4FDMA 2FSGA 4OF4A 2PXXA 2BGNA 3A27A 4BEWA 2VDMB 3KETA 4QUJA 3FMPB 3KBBA 2N1BA 4P4NA 4DUPA 1RM5A 3Q0KA 1TUIA 1K75A 1ORVA 2DLNA 2HWKA 4HLCA 4ND8B 4K2HA 3ZV3A 4CN8A 2W2NA 2RJ3A 1UMCA 1ZJ6A 3LQ4A 3HA5A 3FMFA 2O8BA 1T6BY 1OTHA 2YUTA 3L6BA 1I4DD 5DHSA 1J09A 5H80A 6REQA 1Z4KA 2JAWA 2QUKA 4BFYA 1LUAA 4NF2A 3QKSB 4MWGA 4BQNA 2PVSA 5CYPA 4RJTA 2V03A 3LWDA 4D8VA 5LQAA 1V3UA 1XKQA 4PC3A 4X44A 3IUYA 4D99A 1KYTA 4CMGA 2QTZA 2ZVDA 2CVZA 2BEJA 1ZI8A 3JQ9A 1YWGO 3QVWA 1I4DA 3A6HA 3WWZA 3CG0A 3GGSA 4AWAA 3UAYA 2C8KA 3T4UA 1PWHA 4M76B 3EDYA 3SZGA 4KE7A 1XPOA 1MAHA 5D3ZA 3ZBTA 1H2YA 2IL1A 4J2HA 1RQXA 1UL1X 2O1SA 2OYRA 5IRCD 3OZGA 3MWEB 2R751 2VL7A 4RDHA 2O59A 1CLEA 3E18A 2QZZA 5C52B 5U1PA 1Y8AA 3ABHA 1HNZB 2F1OA 3T34A 1Z2PX 3N2EA 5IW8A 4YPFA 1DUSA 5LIPA 5KVCA 3O8QA 3H1FA 4BYMA 4GLBA 3S81A 3F7WA 1RM0A 2YUIA 2VPZA 2D2IA 4KOEC 4UATA 4L72A 4UZFA 4G5SA 2HWYA 3ZE1B 1VIYA 2BFCA 1IBSA 5EIBD 2CCKA 2RIPA 5T3UA 4E13A 4EB0A 1SXJD 5ALJA 3QJGA 5LD2C 2C7QA 5CDFE 3KUCA 4LJ8A 4EYEA 1V48A 4G0UA 1V1MB 3U44B 2IKQA 5CHEA 3ZLBA 3ZHOA 4H6HA 4X6XA 1KETA 1ZD8A 2WR8A 2GF2A 4CF4A 3RUIA 2R5WA 1V47A 4D97A 5GVSA 2AC7A 1U5BA 1FSGA 3D9QX 4CIXA 1SXJA 3TLZA 5KVAA 5EL0A 5TPZD 5LLDA 1W0CA 1X7XA 4CT4B 1U0NA 1L4UA 3EZGA 4KHZA 3CSDA 4G1FA 4GM0A 3LIIA 3RYHA 421PA 2UUOA 3QBEA 3ZWMA 1R5EA 2IDZA 2Q9CA 3HXLA 3PX2A 1NR1A 3ZI4A 1DHTA 1QG2A 1YMUA 4MW5A 4E03A 4DHWA 1I13A 2JDID 2V0CA 2CV1A 1JLRA 1GV1A 3U56A 1TAGA 2GHRA 5TPZA 1ML4A 2P8JA 4MJXA 3I32A 4UPEA 4JYMA 3ICWA 1QQ5A 3UKDA 3L05A 3QEMA 5EP2A 2YS6A 1TJPB 1XEWY 4YPOA 3I2YX 5A4FS 4DLYA 3GLRA 2WUDA 4D5GA 1ZUHA 1SQGA 2W6ZA 4PO9A 2LXYA 3EVFA 5DMXA 4R2HA 4JI3B 2JDIA 3L8GA 5DBFA 1ONPA 3CH6A 3EG9B 1NQ5A 4M0LA 1U0FA 4PO3X 3C87A 2PFSA 1DS6A 5TMDA 3U49A 1N1GA 5BORA 3PT5A 3KKNA 5P21A 5DT9A 2PG3A 2WIAA 2YWXA 3P9QA 4PPQA 3I64A 3C4QA 3EOBI 3O82A 4ZPJA 2RH5A 4ZAGA 1JXOA 3KDPA 2I2BA 2F3SA 1H9CA 2FEKA 1KO5A 1Z28A 4GZ5A 1X80A 5AKLA 1U0BB 2A59A 4UQLA 1HR0B 4BLOA 4JJKA 2ZUTA 5BUCA 4OXKA 4HYBA 2MYUA 1ULBA 4WLOA 2GPBA 2WE8A 1P45A 3V1UA 4F38A 1M7HA 1TYBE 2B1JA 3EF1A 4XB1A 3BLBA 3N05A 1R12A 3GI1A 3AHDA 4S2UA 2P1ZA 5ALIA 4OHYA 2BTQA 1CS0B 2EKDA 4UUAA 3OKAA 1U6JA 1WBBA 4IUYA 4A0RA 3G0CA 1PLKA 3G3EA 3LCMA 3WP0A 2C2ZA 1XDDA 1A5SB 1EYZA 4AZTA 1DCKA 1OC2A 2RARA 5DOVA 4B3CA 3DWIA 3LWZA 4E7OA 4TKMA 4RNDB 3DLPX 1UQRA 3PPXA 5TIIA 1R5JA 3Q2KA 1IOWA 2ZSKA 3EODA 3GAFA 4IEIA 4KN8A 1K2WA 3PLNA 1UK6A 5HJ2A 5JYDA 4B4VA 1GGVA 3QEOA 1SULA 3LKVA 4CKYA 3BVVA 1M75A 2ID4A 3AFIA 4ZQFA 1XMSA 3WLRA 4B3BA 4BNNA 1LJ8A 4CZ2A 1HDCA 2RKWA 4TZTA 1EFTA 2J46A 2FW8A 1JAHA 3PR3A 1AURA 3N28A 4IS3A 4Q7KA 3GGDA 2XD4A 1N9KA 4ZANA 2NU8A 1R33A 1NRJB 4GSKA 4ER6A 2VZ9A 1QUEA 5B5SA 5GM2A 2POQX 4MVJH 4TMTA 4M0CA 4F0JA 3AYZB 5CB8A 4MDFA 1SO8A 5KKNB 2Z5GA 3OIWA 1L5YA 4QHSA 4EB3A 4I1PA 5HKOA 2VJNA 4FYXA 2OV8A 3FN4A 4JITA 3MWKA 4ALLA 3ZW9A 5ETJA 2ACEA 3RROA 4CKWA 5IXYA 1J2JA 2D4CA 2C5LA 1I2CA 2YFKA 2QGFA 2D5AA 3LCVB 5AKXA 3OZTA 4J2TA 1JAXA 4DY6A 4Z53A 3RVKA 5TLSA 4FMBB 1KPHA 4EY7A 4D56A 1K86A 4K9LA 3RYFB 2DTEA 5AVRA 4KMRA 1RLOA 4H3HB 5BY2A 4V2UA 3MJTA 1UPUA 1MC1A 1RYEA 3T41A 3VAYA 1IBRA 3I9V1 4DV5B 3G6KA 1J9EA 1LBIA 1LPOA 3E9QA 4R2IA 5CLJA 4IFTA 3ZNNA 5I8PA 2O48X 4ARIA 1M33A 5GGYA 3A9SA 3OHPA 4CIDA 1FTYA 3L8MA 3LVTA 2XMSA 3DKKA 4I1YA 4ZU1X 1YZNA 5H70A 4NJMA 3CBQA 3HB9A 5TPWB 4DYLA 1UPCA 1WHSB 3CSUA 3QUSA 4MV9A 1ZYLA 1N9GA 2VAXA 3JYPA 5FA5A 3T7JA 3KJFA 5J4LA 3RVPA 2AE2A 3OIDA 3HSSA 4FJ2A 4ND5A 5T4BA 2XTJA 5JY6A 3E05A 4H4DA 1I3OA 1JLSA 4WA7A 4CGYA 3C15C 4I81A 4B4UA 2QX4A 2NVWA 1ADBA 1W6UA 1JI3A 2JD2A 3OJOA 5D1HA 4F9TA 3ZDXB 2PTHA 3P4YA 2HJGA 3I2GA 4AXBA 2CLFB 1QIEA 1QPGA 4WFJA 3HKEB 3CNEA 3OESA 2PNJA 2IU3A 1QE0A 3VDRA 1Q0TA 4FHDA 4MNTA 4I5FA 1MEEA 3R24A 1XCBA 3F8TA 1PBNA 3JWGA 3GA5A 2VTKA 3W7VA 4BV3A 3OQMA 1MQ9A 3YASA 3T3IA 3IMGA 4DN6A 1D1PA 3B6MA 2WJJA 1UK8A 2ZJ6A 4P6VF 5F9MA 5LDGA 4MSUA 4ZZIA 2K5UA 3EF3A 2OMKA 4RELA 4DDMA 4DG8A 1W7AA 1NQAO 4EK9A 2NO6A 1ZI6A 1PJQA 1Q7GA 1EI9A 3OE5A 1Y9DA 3LT5A 3VPAA 4RPJA 1Y4UA 1PL0A 2HEIA 1NBIA 4C1BA 2NUPA 1T5BA 3DBOB 3D2AA 4AM8A 3AI1A 4X8OA 4J4TA 1C4XA 4KFUA 4P3XA 4ATNA 3EW9A 1XN4A 4WTOA 3W6ZA 4WY2A 2QD4A 2VA8A 3MBKA 5E38A 1MD9A 2Y0EA 5BN3A 2R84A 3AJAA 2HH9A 3FUUA 3G2LA 1KDZA 5KTRA 5A71A 2P9ZA 4X8MA 4LHZA 1B74A 5EXEA 5TJ9A 4I1QA 2VH2A 2NVUA 4H31A 5AK5A 2A9OA 2WTBA 1GL6A 3EIHA 3GFBA 3PHCA 2PZGA 3PRHA 3R09A 3HYTA 3K1AB 4FZRA 1HI9A 3LBAA 3GPLA 3VH3A 1L3IA 4IDOA 3U7RA 1T9CA 2ZB3A 5GOZA 4K0RA 4QXAA 3IS3A 1NV9A 1V43A 1YRHA 3EK2A 2WMNB 3PWZA 4RFSB 4W7SA 1VJ1A 2NIPA 1PF7E 2C9YA 2PTGA 2WFZA 4I9UA 3LX5A 4QGGA 3RDPA 3SAJA 5ICGA 3TW6A 3A0UA 2Y0PA 1DAIA 3C4JA 2N75A 3K9LA 2IYTA 2WHQA 3NM4A 4FCVA 1IZZA 4R7GA 4OHZA 2H9IA 3BWCA 1YDHA 5AUQA 4PHHA 2JANA 1RHKA 2GKOA 3ST7A 2GD0A 4P2BA 3Q10A 5A06A 3TZQA 1AJEA 5KC9A 3DDCA 3LJKA 3MSXA 3OI7A 3V4VB 4NCIA 1CT9A 1HURA 4PLYA 4HTFB 3BD7A 5CYGA 5KVVA 1H3NA 2JKYA 5UKDA 5KQMA 2HZ7A 5FHRA 1U3UA 2RJNA 1PR9A 1QXSA 1Y6FA 1VKRA 1YVRA 2GAAA 1WTAA 2I3ZA 2ZR8A 5K4HA 5FWYA 5CP8A 1H9BA 2XECA 3NVAA 3K9GA 1GYPA 3PTLA 4R1OA 4YB8A 3WFIA 4YAUA 3SFTA 3QPBA 3MBOA 4XSHA 1DKXA 1VB5A 2X3VA 1X7YA 1LK7A 1L2TA 4V24A 4RXUA 5LQDA 2OENG 2EFHB 3HUTA 3CE6A 4QTXA 3ZZ1A 3BBPA 4HQKA 1IULA 4WGFA 5T4FA 3ELBA 3PGJA 3SSMA 4DCVA 4Z4CA 1F0YA 3I9JA 4WL0A 4II2A 1GNVA 2WWGA 5E3IA 4GP7A 1LV8A 3VPHA 7MHTA 3LRPA 1D4ZA 1U00A 3C8UA 3PHLA 4ZCPA 2YJ5A 2P8SA 4LK3A 5DSTA 5KWSA 3MJSA 1JFLA 3VDXA 2JPDA 4KH0A 3PA8A 2ZRFA 3U9LA 1RYMA 3F7MA 1O6FA 3KC2A 4BX0A 5TQVA 4LWOA 1L5FA 1ZH4A 1NE2A 5GVRA 2GRUA 1CY0A 3I4FA 3EOZA 3HVIA 2P5SA 1G60A 5FEUA 4B2LA 2PANA 3HZRA 4ALMA 4DR2B 1JP7A 2ALJA 2RCYA 4D92A 2VKQA 4LXUA 1OD6A 2IUSA 3SSNA 1B6RA 1Y9ZA 4GU5A 3UGTA 5L53A 2IPMA 4ATMA 1YE5A 5J2UB 2UZAA 2I1WA 1W9MA 2ZBEA 1QC5A 2PBZA 4GMDA 3VRHA 4A0GA 2BMVA 4RA6A 4DIFA 1EDBA 1DRKA 5EUCA 2PO5A 5CBPB 4A0QA 4TTAA 3LT0A 3TG8A 1JA9A 2A2ZA 3B5EA 3JWIA 4PRKA 3REFA 3K5HA 1W9HA 5KU7A 5BOVA 2W22A 5LP6B 3P0JA 1NLZA 4OQYA 3LU1A 2IQ5A 4ER0A 4ZOAA 1KORA 1FBTA 5HILA 4A8TA 4MDEA 5I9LA 1DHRA 4N48A 1LDEA 2IZ1A 2QSYA 3G0DA 5A05A 3Q7PA 1U28C 4BU1A 5BNZA 2PN1A 3N2ZB 1U1DA 1TYEB 5T6MA 4ZCTA 4AQYB 3CZ4A 1RAEA 3LCRA 2O2GA 4FYYA 3RPEA 3ZWOA 4EFDA 2WZBA 1JT9A 3KQHA 5DLQC 4NONA 1WSAA 2BFBA 2X8WA 1Y63A 3OHSX 4V1CA 1ORDA 1SWVA 1NG1A 2V74B 1T8WA 3H9JA 3RHFA 2RONA 2QENA 3COPA 3LOUA 2W2KB 1CUEA 3WA7A 5EFZA 3FJOA 2ACKA 5IYZA 1Z73A 2VEOA 1VXRA 5EFOA 5E84A 3UAVA 4FFMA 2XBMA 3JYNA 3ZV4A 2PQ0A 4DMUB 3UK0A 3V4FA 1ETUA 1ORHA 2DECA 1KJJA 3NBUA 1QOPB 4DA8A 3ZNOA 2QVYX 5JD3A 2A9PA 1OYWA 2GN1A 3IYLW 3FYCA 5CPBA 3RIXA 3C74A 2VKTA 2MYNA 4CM9D 3NHWA 1U4NA 2FPPA 2RGEA 4WD3A 5JYCA 3K0AA 3EGDA 4R40A 3AG5A 3JQGA 4RV4A 4HB4A 3O95A 5LVAA 4PGFA 4XGIA 5I9IA 4US1R 1EK6A 1ISIA 1IBLB 1DUIA 1RVV1 1G1AA 4JOBA 4WN9B 2PRKA 3IR7A 1H42A 5BXQC 3F7NA 5TARA 4I6GA 4DCMA 4EHBA 3HO6A 2PIAA 4I4NA 4J1TC 3HKCA 1W88B 3UTDA 3UB4A 2IH4A 2JLVA 1DIGA 1NP3A 2CMFA 4CCSA 4CM9A 5KOHB 4PG4A 5C5BA 1A88A 5CVVA 3V4PB 5KSZA 1E2LA 1N2JA 2ODPA 3PDJA 4Q9DA 1N5JA 2AD1A 4LTDA 1X1RA 5ECDA 3UIEA 4KLCA 4YR9A 2FPLA 3EQ9A 4LRYA 4NU8X 2ECFA 2JKZA 1T0PA 3L5KA 4X7MA 2EJTA 3MWLA 4GOJA 2BFEB 2ZJYA 4EFMA 3LQRA 3OAAD 3NDIA 1VE1A 2H57A 4JHLA 1QVAA 4TYPA 5FT9A 1Z25A 5FLXA 3SBXA 1BHSA 1S4QA 4G4SO 4KQ2A 4W1RA 4HF7A 1U7DA 5AOAA 2JI7A 1Q74A 2JHFA 4RDIA 4FOPA 2JFPA 4U00A 3UHFA 2EKZA 1ZU4A 2PJDA 3ZU2A 1Z36A 3KQLA 2P0EA 2Y1FA 3TSAA 2R8BA 2XQKA 3QX7A 4WLVA 4QLBA 4OATA 1GPBA 3QWAA 2XT0A 3OAAA 2FTKE 1KE1A 1FRZA 1Z13A 3S2UA 2P0YA 2RIRA 3ETDA 4NL4H 3CV5A 5HIKA 1KVTA 3Q7RA 3AUTA 3RVNA 1U2EA 5DULA 2EFGA 3HM2A 2QRUA 2QJWA 5A0TA 2CN1A 1ZK0A 1UC9A 3LNCA 3SEQA 3WLTA 4NJOA 3I3OA 1TRKA 1ZK2A 5CK5A 3D3QA 1JJAA 4Z4QA 1EVEA 2C77A 2LDXA 4QDJA 3ZJ5A 3ETJA 3GJ5A 3CKDA 3EAFA 5K8LA 2W2QA 3DPUA 1Z5ZA 1QQ7A 2C7GA 3B89A 2YKTA 3N8GA 4E4YA 1B6SA 2VCEA 2WF7A 2X7HA 1IZYA 1I7PA 4BFWA 5F51A 3OPYB 5DNWA 3REQB 1YULA 4UAJA 4DR7B 1TJ4A 2G08A 1P2GA 2O2SA 3P96A 4RH3A 3L01A 3OC6A 4G6ZA 1IBKB 3OQJA 5H0IA 3SYTA 5I47A 1UMBA 1FTSA 1FTGA 3IURA 1ZNQO 4Z99A 5A5FA 1STOA 3T5TA 4P0QB 3AILA 3LECA 1YH3A 3WZ2A 1MIOB 5CFPA 3QUAA 1SH7A 1WZUA 2AZDA 2ZSUA 3O8LA 4FK8A 3MMNA 3G2PA 1XZPA 4MUIA 4XTCS 1XTJA 3BEDA 2HQBA 1YOVB 2Y1DA 3A6KA 1JQJC 1FIUA 3W2TA 4E08A 3OA2A 5EXTA 2H5EA 4X6YA 1I7SB 4MVJE 2AVDA 1ZN2A 1RKQA 2YASA 1YJ5A 5EJ2A 2E4YA 2OQIA 5IU6A 3R6GA 4UOQA 1DGQA 4ZOLB 1FSFA 3K15A 4Q1BA 1SZDA 3MN1A 3TO5A 1BVHA 1NX9A 4AL4A 3PDCA 2H11A 3MS2A 4GMFA 3L0ZA 4FOSA 1FFBA 4BQQA 2D8MA 4UXJA 5D5HA 4AMZA 1JHMA 1CP3A 2YV5A 4PHCA 4Z9BA 4LF7B 2FMKA 1LBEA 1O2DA 4UTRA 4QVIA 2GJ4A 2R5NA 2XQVA 3DYVA 3OZ7A 5CURA 5EGNA 5EIBC 3EFHA 3I42A 3UV6A 4B48A 3AHGA 1SXJC 3Q6NA 4XGKA 3R6DA 3T7SA 2D3WA 3CF6R 2I6GA 3AEUB 1CQIB 3DPSA 4BV8A 3KVNA 1G5HA 5FLEX 4WDRA 2XTZA 5ESWA 5A6SB 2WHRA 3GAZA 3SEZA 1TQDA 3JVEA 4LYHA 2OKCA 3SJZA 1JZTA 1QKIA 2QYOA 3OUUA 4ERNA 4M46A 1XEXA 1D0IA 1ZCJA 4OJQA 4ZODA 3EXEB 2BSQA 5DGDA 3EIXA 1JHAA 1UKCA 3BMQB 1D2MA 3HNPA 1E1CA 2HV8A 4HXFB 4K5QA 4LXYA 2OM6A 2D5CA 4U5XA 5H59A 5FBKA 3EIWA 4JWKA 1NW8A 5AKYA 2D1SA 3Q3VA 5EQDA 2ETVA 3D8NA 3KJHA 3KQOA 3D6HA 3QVJA 5FX2A 1GPWB 2Q5OA 1RWKA 4QASA 4K86A 4NS4A 3TWOA 5BMVF 2GCIA 1MV8A 2ECQA 2VZ8A 3QMWA 4W6ZA 2I76A 1U31A 5ILOA 2JLYA 3DB2A 3H9EO 2R25B 3G0IA 4JI5B 2AUTA 4YJGA 3KXKA 2VUIB 2WMOB 3M4NA 2KQUA 1RM3A 1ENYA 4UUBA 4LOAA 3AUAA 1JIUA 1UMDA 2QUZA 2Y6UA 1QP4A 1ZRNA 2XNDD 2AEFA 2CKDA 1Y4ZA 5J59A 2NYUA 2P6NA 4EA7A 3VEBA 2YIDA 3EXFA 1ZQ1A 2FV8A 4TGLA 2EDAA 5HK9A 4P31A 1P81A 1Y89A 3NTUA 4MHOA 4XIIA 5HQJA 1WU7A 2YVQA 4F72A 4D42A 3NW9A 5KYVA 3PDIA 1IOVA 1T5TA 3CEPB 3LM8A 3WLKX 2Q62A 2M6RA 1WCXA 2ZBFA 1GD1O 5LYJB 3LPAA 3H5NA 4MV6A 3VPCA 4P32A 3K71B 3NRCA 5H81A 2XNDA 2ZANA 1T3TA 5B3JA 3EC1A 2PJZA 5I51A 1OVMA 1BN6A 1DAHA 1YHNA 3FKQA 4BC1A 4BUCA 1B6TA 4Z4GA 3ML1A 2EG5A 2P3LA 5AVTA 2WJ3A 2M32A 3EQ7A 3CWQA 3ZHZA 4B0PA 3JATA 1QGZA 1U9IA 3LFUA 2IS2A 4IDBA 2X0RA 4BEVA 2IS4A 1ZUNA 1QZ3A 3P1JA 3KZVA 2XYRA 3JZIA 1Y81A 2CF5A 3L1IA 1LDNA 5L6MB 2OBYA 4ZYUA 4HS4A 4YJ2B 1W2GA 3PYXA 1X9GA 4YRJA 1PGJA 2QXYA 1O7DC 1MC5A 2HUNA 1KXJA 1LRJA 3D4YA 1TM3E 4MRNA 4NBWA 4QXQA 2VSFA 4EF5A 2VSOA 4HGZA 4NYIR 5BW5A 4YS6A 1V2HE 4ZCQA 4V0SA 3NR2A 4YRDA 3WL6A 3ZVRA 3IP7A 3KK0A 5CYFA 3DLHA 2F18A 2ATCA 3ICQB 3FDZA 5K8IA 1TA0A 1Z35A 4MP8A 4PTYA 4QNMA 3LW8A 4GLJA 4TVSA 4JX8A 4QXPA 3RSQA 4XIJA 3H8JA 7AT1A 1S3SA 3SR0A 3VX3A 5JSHA 4WADA 3S4YA 3HQ4O 3WL8A 1GG8A 2PEYA 3T9AA 2P9TA 4L8FA 4WK4B 2Z2YA 2ANCA 1FLDA 4ME6A 1V1RB 1TYDE 4BMDA 1G8GA 1PP4A 1AKQA 2JRCA 1Z6QA 1ECPA 2WHPB 4HZIA 3TGPA 3OWHA 4H59A 1KY3A 4DLSA 3ZHQA 1S7GA 1Z38A 4TROA 2DBQA 3TX6A 5BWBA 4KR3A 1FSPA 1KY5A 2UZ1B 4BQIA 2R86A 2SCUB 1X8LA 4CV0A 5ADWA 3E9NA 4KLRA 3H2SA 4X95A 1SC9A 2I99A 2R00A 4GNRA 1JALA 5JSYA 5CDUA 4ZYVA 3U4QA 3QYJA 3KEQA 1F38A 2O6HA 3MINA 1XTPA 2FFJA 4RMJA 3FDJA 1R64A 4JROA 4N8EA 1ZLYA 3VO2A 1JEQB 4H1UA 4HGPA 4NNPA 4M2LA 3VBEA 3V2GA 2BELA 3ACDA 2FLVA 1MBZA 3HR8A 4DF3A 4G36A 4DCCA 2X3XA 1Q1QA 2EYQA 1H1DA 1Y8RA 4CM3A 4EB8A 5BSFA 3O9MA 1ADJA 4IFEA 3U3JA 4BKUA 3QVVA 4ZQGA 5F7ZA 2ADOA 5HF8A 5E7IA 3T7IA 1ZOSA 2QTVB 5JPDA 1KK1A 4LZPA 1A5AB 2WG1A 4NI5A 1JBEA 4AECA 5IULC 2YWBA 3JQFA 2XXAB 2R1TB 2XKBA 4LBZA 1ZY2A 3KLOA 3VHLB 3QP9A 2WTNA 2W8ZA 3L7CA 1IRXA 1QIMA 5SV2A 5HUHA 3MB5A 1TU0A 2RI0A 1BHO1 1V3TA 3CF4G 3P27A 4O0MA 5BQOA 4LPKA 4CWAA 4QO8A 1YQGA 3OLCX 2NU7A 3JZDA 4IXNA 3CLUD 3M33A 1KFKB 2J0EA 3ZG6A 3I0NA 4GMXA 5JATA 2BM9A 4O4JB 1EE1A 1T4DA 1C81A 1KERA 4LYFA 4F86A 3BFXA 4B3TB 3TL6A 3LF2A 2QZSA 5KVQA 3UWPA 3DW3X 4L9SA 3FDFA 1YUNA 3JCZA 1EFRD 3KQNA 3O92A 3C45A 3ELUA 3CUEF 5EZ5A 4MS1B 1TXGA 1UFQA 3IQHX 4UBJA 2FZ5A 3IMEA 1EVZA 1IRIA 4F2HA 2CHQA 2X5OA 3G5TA 2ZKLA 3I04M 3K2EA 3ZR4B 3A1FA 3FTPA 2DCUA 1EFDN 3NDBB 3QPCA 3BD6A 3DYTA 1E2QA 3QWHA 1EFRA 1HE5A 1VIMA 4PQGA 5U9CA 2DY0A 4MVWA 3AOEA 1PR3A 3BH7A 5F1YA 4CMEA 3Q5GA 1KIMA 3DD1A 2E82A 4X90A 1KR5A 2ZB2A 2G0AA 1KOGA 5BRNA 2FEOA 3TJMA 5I9SA 4D8XA 1ZSNA 2ECOA 2WAOA 3E48A 3MPOA 3RI3A 3IQXA 1U5CA 1NKVA 4WECA 3D7SA 1I4TD 4HX2A 3ONVA 4RK5A 5ITSA 3KSBC 2VLBA 2X4LA 1WBDA 2ZRBA 3Q98A 1ZGBA 4ZAZA 1WMDA 2ZUVA 2Z83A 4P9NA 4CQLB 2O7VA 2Q6OA 1TFRA 1NVDA 2PX6A 3QVXA 3W8NA 3OX2A 1V96A 3M4XA 2QRZA 1WXEA 3TSOA 3UXMA 5IN4A 1SPXA 3LDFA 4GHWA 3IEMA 3ZHTA 2K2WA 3T3GA 2VJDA 2BYTA 1QLWA 1I4TA 3I8OA 1F7VA 3TLJA 2Z6UA 1N32B 2EJVA 5IDYA 1V37A 5BW4A 1N5LA 1HPLA 4KDFA 2O3RA 4OL9A 1R34A 4TSRA 2VR1A 1E9AA 4L5JA 4Q15A 4EHFA 1YZUA 4XWWA 1OH5A 5E9WA 1QONA 2DFTA 4JQOA 2JW5A 4O1IA 4YFYA 4AJ4A 2FUCA 5BURA 4HC4A 4TMXA 2PX0A 2QVCA 1TUEA 4RZXA 5A9SB 4URZR 2O8EA 1YVUA 4KU4A 3ABIA 1NNUA 3WGIA 5FI3A 4Y9DA 2PD6A 1GR0A 4DANA 5HVNA 3CRRA 5EEHA 2PAAA 2RH8A 3P0FA 2YXBA 4MWSA 1URPA 3EFOA 1UPAA 1XA0A 4TV8B 2Y0BA 4Q4CA 1E6KA 1FRFS 1W47A 2ZTUA 4FU0A 2HCJB 3CU5A 4PBRA 4RABA 4S1TA 2REXB 3C39A 2AW3A 1FDUA 3MT7A 1SXGA 1U9JA 3D81A 3T47A 3WK4A 3RS3A 2ERCA 2GBPA 1XCLA 1RM4A 1LNQA 3QOYA 4KSCA 3ZBUA 3D64A 4B44A 2HRBA 1A1VA 1OV4A 2IYZA 1R9GA 2Z58A 4LCJA 3AF1A 1HGXA 3GIDA 2Z9DA 1V9LA 3RFUA 2FE4A 2AUNA 3TQQA 3SS7X 3A10A 5TKYA 1GUZA 1FU4A 2WV7A 2H1SA 4D26A 1RKVA 2OB2A 1AZSC 1HDEA 3A6GA 2YJGA 4DQLA 4GMGA 1ID1A 2F7SA 2V6IA 1QF6A 2AXNA 3PC4A 2CT8A 4C07A 3EVGA 5CCBA 3RWMB 5K8TA 1XNHA 1DKYA 2P5TB 4WA8A 3RUEA 3WSVA 1LH0A 3DWFA 1SIBE 4MQBA 1IY9A 4MVJD 2AL7A 2UVPB 1U4SA 4QDUA 3TUIC 4AI6A 1VE9A 1O97D 4IUCS 4Q3EA 4YMSA 2ET6A 1NOIA 4RL6A 1PK7A 2J33A 3JR3A 1JQEA 1ZWWA 4NATA 4Y30A 2WUFA 5AM4A 4B7XA 1PIWA 2Q6KA 1VLLA 3F7TA 4HNQA 4WZAE 1C7IA 1JPUA 4ZQEA 4HNAA 1GPAA 4CKBB 3AR9A 5A9TA 1F2UA 1YASA 3ZEAA 4E5SA 3GV0A 5GONA 3PCRB 4RX1A 4MVJA 3WGKA 1TPYA 3HCOA 3PNOA 1OPRA 2OCBA 2C07A 1KO4A 2VUUA 2KE5A 1PG0A 2GBIA 4L51A 1TQSA 4MPPA 4QUGA 1CX9B 1SUEA 6NULA 2QNBA 2WYHA 3Q7TA 4CVNA 4L9AA 2XJ9A 4W1SA 4WINA 3TS1A 4PN7A 4WRRA 1TF7A 4UNPA 221PA 2XMGA 2ZOSA 3F3SA 4JGBA 5BNFA 4EB6B 5C8DA 4GFDA 4MWDA 3KOUA 2D5LA 1T3HA 1H4TA 3QVLA 2QYTA 4QNRA 1YA4A 1X7DA 3ECCA 3OWXA 4L15A 3T9EA 2BFDB 1D2CA 2YMLA 3Q72A 5DGXA 4Q7JB 2MCFA 3WKDA 2AFVA 4EJ6A 2VYQA 3LP8A 1ZHHA 3D8SA 1LXCA 2GM3A 3IGFA 4LHSA 3N7AA 4OK3A 4DTIA 4JC5A 1Z3IX 3WZMA 3EQ8A 4G0ZA 4BNMA 1USWA 1ENPA 1M2NA 1QTNA 1OI4A 1DJMA 3KSAC 1UQUA 1MABB 3ZJYA 3FB1A 3VTFA 3DF9A 2YN0A 3GCDA 4CODB 3AR3A 3PVCA 4IV0A 4NYMR 3TL2A 2ZW9A 3NB0A 3CGGA 4IW0A 4DUYB 3LZ6A 1RBZA 3AHIA 3B1VA 4RANA 5FFFA 5LLSA 2NO1A 5KX5B 5EMNA 1YJXA 2E4WA 1P2FA 5EP1A 4PYNA 2D0DA 2GF0A 4Q21A 1TCCA 2ZSBA 4UQOA 2WIKA 4KDEA 1SCUA 4Q9AA 5C46F 3VR2D 1XVLA 3CF0A 3FCUB 1IEQA 2QLJA 3C5VA 3K0HA 1M2HA 4WI1A 3N2LA 3U4CA 2V5VA 4O5AA 4BMOB 4REOA 3H86A 4QGSA 1JHQA 4LNAA 1P2UA 1L4GA 1RXSA 2DXIA 5IM5A 4Z4IA 1ESDA 4LBWA 3R0QA 2O19A 2VCHA 4DJDC 1HLFA 3K9QO 3L84A 3FYUA 4RENA 3PNBA 5J1TB 4AZBA 1DKPA 4DJ5X 2FUEA 1ZN9A 3VR2A 3PXCX 3Q2IA 1DB3A 3EDCA 5E2IA 2YWFA 4G5YA 5MHTA 1N9ZA 4FTWA 5AW4A 2IXEA 3CVXA 1FVHA 3EJWA 1RPNA 2R48A 1FLAA 1YRAA 5THKA 4HDKA 2WDZA 1P1FA 1Y9EA 4GGMX 4BMVA 5CXQA 2YX1A 2GJ8A 2W9XA 1A8SA 1BE1A 3G2NA 2B5VA 1YQDA 3KJQA 4MPJA 4X7BA 2FSVA 1KEPA 2Q4DA 3O31A 4KQ6A 4B47A 5A4JA 1RQ2A 2OO7A 2QT9A 1WRBA 1ZMXA 2GN6A 3D7KA 3SOZA 3DLBA 4D25A 1R5OA 4YT5A 4N7MA 821PA 1B41A 4DA6A 4NPAA 3LT1A 2PQMA 3EVZA 3NFYA 1C0IA 4QWMA 3AL0C 1HE1C 3D3NA 2VJPA 4X71A 5LPNA 1TKBA 2UUCB 4D8WA 2FSFA 2AJLI 3FB4A 4LMRA 4MTLA 5LB2A 4UM7A 5MFZA 1L4HA 1HNNA 2HSDA 4TWIA 3HJFA 2O8CB 3DMHA 3ISVA 2HV9A 3QE0A 1M2VA 1W1IA 3W3AH 1IN8A 5C1PA 2AKYA 4L1KA 2ZB4A 3X2FA 3O93A 3CR8A 4R5LA 3QA3E 1FFXB 2C92A 4AVMA 3ER9B 2EFEB 1G20E 1Q1EA 3I12A 3FYSA 3GUCA 3ROGA 5I7FA 3FIUA 4RHCA 1A7JA 4BLSA 1TVKB 1IXRC 2C96A 2Y1XA 1WS6A 1EDZA 5A9SA 3AUYA 4YDQA 4Y2HA 2FLKA 3FFAA 4CG0A 2O8DA 1JB1A 1DIOB 4LV5B 1JG4A 1H5NA 2HRCA 2NAPA 3AUFA 3BTUA 3GEIA 1K08A 1ZC4A 4J94A 5A03A 1XMXA 1E5TA 2BWJA 2CJWA 2JRLA 3BB4A 3PHGA 4KYTA 2QVGA 2NU9A 4BNYA 4D02A 1XRQA 2QR2A 1NR7A 4FDLA 3ET4A 1UKEA 4JVMA 3BWVA 2FEMA 4K40A 3DF7A 4BHTA 2IOQA 5A1JA 5HPYB 2IODA 1V0JA 2CE7A 1PHRA 2HDWA 2G9ZA 3MJDA 3N0RA 1K7EB 3NRBA 3NTXA 4PZYA 5AK6A 2Q7OE 4B71A 3DKVA 4DLLA 5ICCA 3GZJA 1QH0A 4PO2A 3B7GA 5AJYA 5FBVB 1UMKA 2WY2D 2YZNA 4UCXA 4PGGA 1AA6A 3PEYA 4GECA 2DTDA 5AJWA 4EPRA 4ETWA 3FUWA 4B3XA 4MQUA 2XTMA 3JD1A 4ZOCA 2PSHA 4ZGBA 4GL4A 2HK6A 4AMYA 4Y7DA 3TGWA 1AXGA 2FJUA 1PS3A 3AP2A 1SUBA 4HXGA 3NGMA 2PSSA 1XXHB 3FLMA 1XEWX 1RZ3A 2EU8A 4F01A 3JXEA 4LHEA 4GP9A 4D8JA 2H5LA 3I01M 4NBVA 5EJFA 5IANA 4LIPD 4HYEA 4PPNA 2O3QA 3ZWXA 2JLXA 2AN4A 2D3TA 3EJSA 3HWWA 5E3HA 1O6GA 2IC5A 2Z3VA 3A7DA 4HQLA 1WP9A 2OCYC 2IH2A 8AT1A 1DIHA 1NVAA 1EWTA 1S2DA 3OUZA 5CX1A 3F73A 1MO4A 3HDYA 3L4SO 3SC6A 4LQDA 4M1ZA 2IE0A 3FF4A 3JRNA 3CUVA 4FFVA 2IU0A 1U2QA 1PWEA 4RVSA 1KP3A 4RJJA 1FXSA 3S8YA 4D0LB 2GOYA 2I0FA 3B7PA 3FYDA 4QFCA 4ZREA 3LXXA 3EGVA 2HHLA 4D4GA 1LQ2A 1HV8A 1J5XA 3ET5A 3GFRA 5E1BA 1JIJA 4RTNA 1Y7HA 4WY5A 1IM8A 2ZRGA 4XX0B 5C4GB 3FUVA 4OJKA 1SC4A 2MYTA 2PKCA 4B43A 2Y77A 2VQFB 2BUCA 1IOZA 5ALVA 4RADA 3TMAA 2IHYA 3MWJA 4Z0PA 3K5PA 3MTEA 3M6LA 2YY6A 5DIZA 2ZQ5A 2FP3A 3JQRA 1TCUA 3IMCA 4GXTA 2ZULA 2OXTA 3ZDAA 2QLFA 4QPNA 1BH6A 2X6TA 4WFQA 1T3LA 1JKJB 1L4EA 1PNVA 1RRFA 2QVZX 4P1ZA 4BQOA 4ECEA 5B3JC 5JZ9A 1CVLA 2BGWA 1DKNA 4L0DA 1CUIA 2J0VA 1OAAA 3KHKA 1NVEA 2AOUA 3FCCA 3CPHA 3RRJA 8GPBA 5ED4A 1K8QA 2MHCA 3DM5A 1CUAA 3ZLVA 1OBOA 4LNUA 5TGTA 4BWYA 3DFUA 3A6PC 4E09A 4I08A 2XNCA 2G80A 4YRGA 4E6PA 4DJEC 5EOVA 1FS6A 1USVA 1WPXA 2BGMA 3PUVA 4IBOA 2GZ1A 3PQ7A 2GI4A 1PEAA 2C20A 3U7EB 3VM6A 1PDWA 5E4FA 1WCV1 4B7UA 1DSSG 3HL4A 4G37A 1D6SA 4M9CA 1U0SY 2RSLA 3ZDDA 2ZT7A 3OE7D 4ZP1A 2DP4E 3BWMA 3OPVA 5FUXA 2ZZKA 5KYWB 1R6TA 1S2OA 3W2EA 3D2LA 3F74A 3GEEA 1R50A 5EE5B 5G4LA 1QYIA 4FFLA 5ENDA 1TMYA 1Y0BA 2LW7A 3UMMA 5KWVA 1EK5A 1FVXA 2C2KA 2JIDA 3GN2A 2H59A 5F33A 4KNYA 4MKGA 3F46A 3TLGB 1A04A 4B7AA 1VIAA 1Z7EA 3QIAA 3OE7A 4BQFA 2GA8A 3QE9Y 1RZRD 2CXSA 1Q0HA 2ZU6A 3II6X 3EVBA 6Q21A 2HYIC 1RI2A 1K97A 1Y8QA 1UJ4A 3FUTA 4J9VA 1IUNA 2BMFA 5TEVA 3FRIA 4K9KA 4FFOA 1DPFA 1FYVA 1ODJA 4PSDA 2Q21A 4ZRMA 5JAUA 3MRVA 4RS4A 2GK7A 1W0JD 4MZDA 4DGQA 2ATIA 4KXUA 2UXBB 3JX9A 2QJTA 3KTOA 3JPWA 1II8B 2YJ4A 2VWQA 1JHXA 3QUQA 1SCNE 3B1XA 1TTHA 1UCFA 4L6IA 4MWTA 4UM9D 5GADl 1Q6YA 2QXTA 1CRZA 2PXAA 1XZ8A 2R4TA 2G36A 2I87A 2B0JA 2ZEJA 5KCMA 5FOQA 4PYQA 1C8VB 3BFJA 2R00C 1AGRA 4YA6A 3A9CA 3VOAA 3GLFE 1VG1A 1W0JA 3P97A 1BKDR 3ZDBA 2XA2A 1ZEJA 2WD7B 1IY1A 4JEHA 1RHRA 2FPKA 2A7QA 3DQQA 1K7XB 5LBIA 1ZZGA 3L3BA 4WBNB 2GZAA 4XQ0A 4D4JA 3HSKA 3OURA 4OMDA 4YC7A 2GYYA 2VHUA 3VVLA 2J9FB 2J3LA 1JGTA 3JW8A 1W85A 3KSZO 1HYEA 2WRZA 4QG3A 3DZIA 3JQFC 1AO0A 3EUAA 1GNRA 3FPLA 4JUIA 1AUVA 3IV7A 1W581 3QNJA 1P5HA 1QWSA 2JF0A 3NAGA 3DBRB 3OTQA 4IHAA 5J4KA 1QP8A 4B35A 4RJKA 4BJ1A 4C29A 1XTKA 3ZS9A 1F0NA 3H1AA 2VYFA 5AOCA 1OXVA 1RZUA 4IM2A 1LVUA 4ILEA 3K8OE 1BWPA 2F6RA 1QHHA 2H16A 4OY3A 3MGBA 1M2KA 3WB2A 1C0KA 3ZWNA 5ALLA 2P5YA 4DLVA 3BORA 3O9VA 5EXPA 4CR7A 4DW8A 1Z0JA 2J0SA 5JC1A 5KYXB 4CF5A 4TUYF 2VPQA 4BMYA 5KWJA 2GT1A 4LKOA 4PWZA 1WOYA 1REQA 3GI7A 2X7JA 3CLUC 3RWOA 1OW3B 3BZBA 2VTDA 2ZSIA 1BC5A 3IXMA 4LZJA 4TS9A 3RV4A 3ZDCA 4C4RA 1FTNA 4L85A 2R8YA 4N8DA 5JBNA 2JFFA 5HBGA 2NVOA 2J87A 4HKTA 5BSEA 4K6KA 1NN5A 3F98A 5EUBA 1NVGA 4ARBA 3HHEA 4QAJA 2ERYA 5K4GA 1V8PA 4P4LA 4HR1B 2FF7A 4DARA 5AVXA 1NUQA 3RVRA 2IYQA 3AOEC 4QG7A 4MRPA 1RI4A 1IQUA 2OC9A 3M2TA 4PV7A 3OLXA 3KR2A 5AW9A 4CMEC 1DT3A 1JDSA 2YKGA 3L8ZA 2E85A 2FPWA 4BQEA 2X9VA 2W70A 4MIYA 3MS7A 1G3MA 4QICA 4BFTA 3RAFC 2AE1A 4PZ9A 5H9WA 1WXIA 1IB0A 5EA2A 3C1AA 3MAJA 2G6TA 1KBOA 2F9MA 3KP1A 1VGVA 4YRNA 4ESVA 5IKOA 4MWOA 2HU7A 4KGXA 2G4LA 3VPGA 3PENA 1O3YA 2CNBA 2VJQA 5K0LA 1A8PA 1WMSA 4MCJA 3AZPA 1AHNA 1JIIA 1VI6A 3PUYA 3K1TA 1UEXC 3O38A 1CRQA 4MKFA 2OCGA 1SEVA 1IY0A 1BCRA 5ALNA 4DLPA 2GTHA 3HRKA 4KK4A 3LI2A 4R5IA 4FOOA 4HOYA 4FCWA 4N5DA 4NJEA 2OWDA 2BR3A 2FPIB 5B58T 3S0JA 3QENA 3SZRA 1QPZA 1M1YE 2JGJA 4EW6A 2A1IA 4GUDA 3ZS8A 5KINB 4KG7A 2FEWB 1SUAA 2E4XA 3KR0A 4RZHA 4DE5A 4YCCA 2JGEA 2ZI9A 2PV0A 1SU6A 1U11A 1XZNA 3KB6A 4P0TA 5J9FA 4C89A 2VDOB 3C16C 3UBTA 3HYCA 1QMPA 1XL0A 3HI6A 3VU1A 4N8SA 1ATIA 2H29A 5KAMA 2R4UA 2WD9A 1E3IA 3ZHYA 1LZLA 2VI5A 2WHEA 4BOYA 1QKKA 2IIVA 1UIRA 3JARB 4PZUA 5K0NA 4Q3NA 1TNDA 2QN3A 3TE6A 3BWXA 5L3QA 3DYIA 5EJ8A 2H1VA 3UVEA 3WL7A 4LJ9A 4PRZA 1VLZA 5KQRA 1VHWA 4B8ZA 4DRYA 1WCIA 3MTDA 2B9EA 3VHXA 4K9MA 2Y92A 1PYGA 4LGMA 4JS0A 1K9VF 1E4YA 4TMWA 1HLGA 2OGZA 4U7HA 3G82C 2F1HA 1Q84A 1SB9A 1SVMA 2JJQA 3FY4A 3HGQA 4KO3S 2JLZA 2FDCA 4QJ3A 3MSCA 3RUHA 1GKLA 3NOQA 3P0EA 4XVQA 4QNNA 4KVAA 2I4RA 2WYUA 5E1DA 1DQZA 3SX4A 1W5SA 3D5EA 4YJHB 2W8BB 3VNSA 4JQSA 4PM4A 2ZT8A 1PU2A 2VWHA 4KLNA 4B6PA 4D0GA 2OE2A 1GLGA 3RO7A 1D2GA 4LXGA 3I6BA 5T6BA 1FYXA 2YNMD 4D9EA 3UMCA 1ZC3A 3E53A 4GQBA 4EHDA 2QGZA 5AVZA 3KO8A 4HEJA 4XWAA 4FMCF 2Z8YA 2IY9A 3TFQA 2C7PA 4PYMA 1RACA 1YCGA 4Z9YA 1MJGM 1OIXA 4TLDA 2HJRA 3QWFA 3H6KA 5FNVA 4R05A 3EHDA 3G2OA 4B9QA 5F76A 5K4AA 4ADSG 1A77A 3DEKA 1CR4A 4L3OA 2XWBF 4AJHA 1HK7A 5JVDF 4X8LA 2VBIA 2WYWA 2YNMA 1KS9A 1USKA 3FBWA 4WBXC 5CB4A 1GARA 1SHZA 2QZ4A 4ARUA 3BH6A 4PGHA 5I45A 5KKCA 2CSXA 3E9DA 5JSZB 4O4IB 3QU5A 1J5PA 1XG5A 2JFOA 3AZOA 2XZPA 1CUBA 3BFVA 3NG1A 4IM3A 3EMKA 5C9ZA 3K0SA 1BE0A 1G20A 3H0EA 4GZLA 5EIFA 4FNGA 1X7ZA 4PX9A 5EJIA 5BV2P 1A9YA 2PMRA 4OXQA 1X2BA 3RWBA 4C4OA 1IUKA 4OM7A 5K01A 1E2EA 1P61B 1THGA 3OQ6A 3ZGVA 4DOMA 4C3VA 3AJDA 1II0A 2BI4A 1O97C 4O4LB 4L27A 4Y9UA 2IPNA 2ZIVB 1QHFA 3M9LA 4HNHA 1I10A 1J8DA 4CMIA 9GPBA 3QA9A 1QSGA 3O4VA 3QXHA 3IHLA 4AKTA 2Q4RA 4Z9XA 3T0IA 4P3PA 1F5NA 1ZD2P 2PH7A 4YI5A 4H15A 2X22A 4I4CA 4JOSA 1K98A 2GXSA 3KCQA 4MS4A 3ZV5A 4ESEA 3DH0A 4N5HX 1J56A 1F3OA 1TL7C 2OORA 4Z3DA 1LF5A 1R4AA 3GP8A 4HGNA 4E2WA 4JLPA 3CAZA 1ZVQA 1TT5B 4AK9A 3KAJA 1G8FA 2VDNB 2YRFA 1MAUA 3NIDB 4PZAA 4N54A 4OI1A 2FW6A 2WIJA 4C5BA 4HWGA 4DEVA 3ZWKA 4ND4A 1L8LA 4JSTA 4GVLA 4PY2A 4X1YA 4CM4A 3NPAA 4WE3A 4DZZA 3BH0A 5ARBA 3LVQE 4DUGD 1DBVO 4MKXA 2OO5A 1UM9A 1RT9A 2P30A 3AHEA 4DXDA 1NHGA 4ZCIA 3R7WB 4PZ0A 3VPSA 4EF4A 4FD3A 2D4AA 3MTBA 3GJRA 1Z0ZA 3ROMA 5HGXA 4WGGA 3TSWA 2JGIA 3QXCA 3DKIA 4JC8A 5H8WA 4G8JA 4GPIB 4U9HS 2FX3A 2YL9A 4ZCLA 2AC2A 3N2YA 5C4MA 5EMMA 2I7TA 1QLHA 1V4NA 2LRHA 1X6VA 3QVGA 4O4HF 3KNZA 2Z3WA 3NHPA 4MCAA 1V16B 2ZREA 2D1TA 2PPVA 3PNVA 4H1HA 1W36B 1OMOA 1RW4A 3OLYA 2JFZA 5A3RA 3KQUA 3BWYA 3QVMA 2A9QA 3EIEA 2D1FA 3OT1B 4HB2A 5TV2A 3FYUC 4IJVA 1OH6A 3M5DA 1L9XA 4O2AF 3V48A 1I4OA 1TM5E 4K8RB 1DKUA 4REQA 1LB1B 1JIKA 2BF7A 2G5TA 4DMLA 2WE7A 4EUFA 2VQDA 1AKWA 2NP7A 2HA4A 5CCEA 1P5FA 4HS9A 1R5BA 4QOEA 4HLNA 1SVKA 3EEIA 3A05A 4P7GA 2ZSFA 1BJKA 2FSVC 4WQMA 3V00A 4BJ6A 1JXAA 2HWUA 5JYEA 1YB1A 3ANMA 4Q6BA 3WGJA 1JDPA 1T1IA 1BE8A 2J5RA 1YBHA 1NPDA 5DT2A 2QAGA 4JXZA 1U7OA 5ALWA 5MGNA 3W05A 2EFJA 3WGLA 2BUAA 3QWBA 3M81A 4D0NA 4N18A 3K16A 1HZZA 2VYND 3L2OB 5K0JA 3RGWS 2AN9A 3OZAA 1POWA 3SVTA 4NBKA 5H1YA 5L3ZA 3EXG2 3IUJA 4ETIA 1ISRA 1OYYA 2E21A 2D06A 1CQXA 1EJ6A 1V4VA 1KHHA 2WKQA 4ENRA 5BUQA 2CB9A 1NYTA 3EPJA 1H85A 5LZ7A 3UGQA 5HRUA 1B73A 1I51A 2DUNA 4LCEA 3K2QA 1M76A 4UW9A 4EFLA 3AYXB 1P2DA 2VYNA 3BDAA 5DGCA 4EA8A 3E4CA 2GWRA 3GN1A 3H4TA 3T5GA 5K05A 1J33A 2IBMA 2DUMA 2XE7A 1SD2A 4MRVA 1CZNA 3UAOA 3VGJA 4WVLA 3MLBA 5JI2E 4AZCB 1DWUA 3ZQ6A 3ZWPA 5A5EA 4O25A 4E21A 1PKXA 3A28A 3D4LA 3UYLA 1PL7A 3W79A 5AESA 1X7WA 5DYYA 4FFBA 4Y2JA 1SCAA 2J0UA 4X5OA 4R6XA 1YMVA 3BAZA 7ABPA 4CM1A 4OFWA 5FBHA 1T35A 4TLAA 1ZIXA 5G3YA 4XZ3A 5FUQA 5L3VA 5EHGA 1SC1A 4UM5A 4BMCA 3VA7A 4G0VA 4F21A 2XOXA 3V7YA 1P0QA 4GZMA 1OZFA 1BYIA 2X5NA 3TQRA 3TKAA 4ZYYA 4NAUA 4D5EA 2O2YA 3M83A 2EW2A 3EUWA 4AY5A 3IH5A 3K31A 4DJJA 1WWKA 1CZLA 2HRZA 3HKDA 3H8SA 4NZNA 2A9JA 2VCYA 4M1TA 5E8RA 1EQUA 4J16A 5BW6B 3UHPA 3TJZA 1DC3A 3I30X 3PC6A 1XMVA 1CLUA 1HE4A 5I5EA 1VYUA 4JUDX 3MPUA 3HS3A 1ICEA 2ZUBA 4E14A 1Q1GA 3DGFC 3HBFA 3MWYW 2RFLA 1A69A 4ZHQB 2JEOA 2ONJA 2GM9A 1EHIA 1MFPA 3S70A 2PGJA 4D3YA 5CXUA 4CKCA 4R8RA 5JQGA 2G83A 2YCBA 3W4IA 1BN7A 4TQGA 1U0TA 1UXHA 2CCGA 2WF6A 3IKMB 2FQXA 3IQWA 2DU8A 2XQFA 3HPQA 3LV8A 3UM9A 4AWXA 4UDXX 3KZMA 1TQ6A 3M6AA 1UDCA 5CM2Z 5ADVA 2GEVA 3DMDA 3GX1A 3IAS6 4QTTB 1LSSA 3DS8A 1D09A 1F12A 1JUDA 1T4BA 5CMLA 4EJFA 2Q3FA 4YMIA 4RPIA 3L07A 3OCVA 1HQCA 3EC7A 1K5DA 2MTBA 2A86A 4B3SB 1K7YA 1CU1A 1BD3A 5DEIA 1ULAA 3SNKA 4MYCA 1DQYA 1EWYA 1Z4LA 1K6MA 1JAZA 2FFQA 4QBFA 5ENVA 5REQB 3LKDA 2FFAA 4BNWA 1SFRA 6CHYA 2PZAA 2P6MA 4TTPA 4ZI7A 5ITZB 3VNAA 4C6TA 3VJRA 4NCKA 2OSBA 4GZ6A 2QRGA 1MORA 2GD6A 3CJTA 3I45A 1O5OA 2DT8A 2B83A 5DXFA 3L7AA 1RYYA 4PPGA 5EWJA 3RC9A 1SVSA 2VTBB 2H1OA 3UUFA 4ZCMA 4NIMA 2GZSA 1E60A 1RTKA 3OCXA 4IQ0A 4BJ5A 4RH1A 2ZIFA 5DLDA 3I8XA 4HNGA 3KYDA 2DR2A 4AF7A 1AHHA 3LGAA 3HRIA 3LW7A 1NATA 3NBFA 2YFQA 4QT0A 5CW2A 5FPHA 2CNLA 3HCCA 1E2UA 3W8RA 1AQJA 4G5QA 5BN1A 3CPJB 3HU3A 2BFFB 3H4VA 5LMNB 3UJBA 5CLQA 5TS3A 1WVMA 3KPYA 4WDQA 2FSHA 1KY4A 1UP4A 4KUEA 3SZ3A 5B7QA 5JNRA 1D5WA 4PSVA 1JTFA 1ORRA 4EGJA 2ZYAA 2NSDA 2F43A 2FXIA 1ZPDA 4IJQA 4ZEWA 4EQ6B 3V34A 2A0FA 4PYIA 1J6UA 1FL9A 1OJ7A 1T36A 2Y9MB 4NZYA 4D3DA 4P08A 1OLOA 4BZZA 1QH8B 5CNKA 4NENB 5DXAA 4EDHA 2O14A 3L7KA 5IF9A 1I24A 4NQZA 1ISPA 3N2NA 2X6RA 4OIMA 4E5MA 4DR6B 4NFHA 1DL5A 1T8TA 5EHZA 2E4AA 4BO8A 5F2NA 1QFMA 4J3FA 5EIHA 3WGHA 5FLKA 5B6IA 3FNBA 3GMTA 4U2KA 1HT2E 1L1RA 1THMA 4FWTA 3MCTA 2VJOA 1VMEA 5IG2A 4UMDA 1J0CA 1QFJA 4YLYA 3W2IA 5IJ0B 1AQIA 1Z4OA 3QFCA 4DIEA 3HCBA 4RQAA 3LOQA 3SHFA 3ZGYA 4C0HA 4YT8A 4BZQA 2ILVA 3PHIA 4B4KA 1YL7A 2AFHB 2OGSA 1KMNA 4YRZA 4YRMA 4QQ8A 1FFHA 2PRIA 4MAAA 2F4NA 2DE0X 1E7YA 2PE5A 4B8WA 4FSXA 2ZR7A 1SVLA 4IXWA 4QZVA 3EY9A 1Y4DE 1SD1A 1TFUA 4BN0A 4DUZB 1IH8A 3DTTA 3EZNA 4ND6A 3T5AA 1MC8A 4KWHA 4TL6A 5HF6A 5FOSA 3ZV6A 1KOLA 3UITA 1RHQA 1XU7A 2NZWA 4DXHA 3W1WA 2QZPA 3PPVA 3DX4A 5D6OA 4OQNA 3K1ZA 4TVBA 3OQVA 2OCLA 3X1KA 4HH1A 4NSWA 4B4DA 4ZKDA 5K8JB 1FSSA 4P98A 3AVQA 4P4UA 3ZWWA 1NDUA 4AJLA 2X1LA 4HNTA 3T5MA 3BZUA 3R0IA 3SC3A 1PS0A 4F9FA 1RWOA 3DBHB 2COKA 3CZQA 3PQ4A 3EJQA 1RHUA 3A06A 3NJ8A 3F6BX 4G9BA 1T29A 4P5EA 2NUTA 4F5ZA 4IMRA 4N3BA 4A2CA 2XAUA 1M5TA 2GCPA 2SHKA 2LIPA 4H0CA 3AHFA 4A73A 2ZPTX 1XZKA 4FOLA 3ORQA 1UBLS 5DK6A 3B6IA 1G19A 2R96A 3A1CA 3OJWA 2JBAB 1KIFA 2ROQA 4PPFA 3H83A 2GCGA 2ECPA 2YWRA 3ANNA 3N6XA 4J0CA 1GU0A 4RDXA 4QPDA 2FHPA 5JPCA 1OUMA 3W3AD 4WEQA 5EYPB 1E94E 1D9XA 2QP4A 4L9WA 4X62B 3CX8A 4DPKA 5B2EA 5JNTA 4GZ3A 1GXSA 4XAQA 3GA7A 1JJBA 3FWZA 4ED9A 4CGZA 2DWUA 1L8OA 2ORWA 4YO7A 1EWRA 4RCZA 4TKUA 3VQTA 4DNQA 5IF3A 1GKUB 3OCWA 1EUQA 4K9DA 1ECFA 1G5FA 5A0FA 1NBWB 1RWVA 5C18A 3H2IA 4MITA 5JCJD 1J2RA 4MUBA 3CXUA 1EGAA 1HWYA 1S8FA 3W3AA 1XZDA 3U7FB 2J3JA 4JODA 5DHAA 4B3RB 3PVZA 3HVHA 4OAOA 1NN1A 1HFEL 5JSFA 4LDRA 3KU1A 4YRIA 1GFIA 2ZAMA 4TUYA 4KWIA 3H97A 3LYLA 2GJAA 3DAPA 1Z33A 5JCJA 2X8BA 3PTZA 4TMVA 1I94B 1LBSA 3C43A 4M98A 1ODKA 2EARA 2IYXA 3I6YA 1TDJA 3GZTB 3OJLA 1JDTA 3DX3A 2D2FA 2Z4RA 4NOMA 2XUAA 5JXGA 3G2MA 3OTOB 1MN6A 1J49A 3D3EA 3OCYA 3DOUA 4D3XA 1C3VA 4JWIA 4X6UA 1FX1A 4RKWA 3WDLA 16PKA 4LGVA 2R11A 1J4AA 2BEUA 3E0QA 3K94A 1R6DA 3MAAC 3E5NA 4IRXA 1AK9A 3SOGA 2HKIA 5H4HA 2QTCA 3UFXA 1WUTA 2R8ZA 1VJ0A 1NM5A 4KTVE 5IT0A 2HXYA 2YL5A 2LVBA 3IE0A 1SBIA 5DCLA 1GUDA 1ACJA 4NECA 1JHVA 3L1UA 2O23A 4TTRA 1M2OA 4HQOA 2IEBA 1JWBB 3A4IA 1BDJA 1T91A 5C0OE 5DX1A 2PUBA 1FUKA 3FSGD 4RKRA 1EHYA 1O57A 4CT5A 4A6XA 1QMGA 2C5GA 2C4TA 4FT2A 4PAOA 3STXA 5JJLA 2H3HA 1QO9A 4I8XA 3ANXA 2VO1A 4CV2A 3DCJA 2FJ0A 3JZFA 3PFNA 4YP6A 1CJUC 1HE3A 3PXDA 3HLTA 5DEOA 3MWDA 2Z5VA 4BCDA 1ZH2A 4I66A 3AJRA 4EELA 4H3SA 1T4MA 1RC8A 2XYVA 2V7BA 3PC8A 3BHJA 2GNPA 3FSGA 4IDFA 4MLDA 1EESA 1E99A 2Z6QA 1G8JA 2A5JA 3W8DA 2I2DA 3GNQA 4G09A 4M49A 3JWHA 2GPJA 1DTWA 3O5AA 2GERA 3KUDA 3QPAA 1M2EA 3AM5A 1RADA 1YRYE 2OM2A 3GLGB 4DLXA 5F5LA 4ZVSA 4DR3B 1C1HA 3IMFA 3GW8A 4KE6A 4A03A 1UBUS 5JW6A 2OXFA 2OAQ1 2W6ID 3NKVA 1JFRA 3KLPX 4IV5A 2DPMA 3QI7A 1NUPA 1VPLA 2FB9A 3W6PA 4C06A 4ER7A 5F7OA 1I1OA 1EXWA 1MKYA 2BZSA 3DNMA 4B84A 2DEUA 2XDWA 2G88A 3AF2A 3C3BA 4TQAA 4CLEA 1A9QA 2Q0HA 1UXOA 2W6OA 2ZBRA 3NCHA 2QN9A 2FHSA 3IR5A 2OKGA 4BFSA 1RAAA 2W6IA 4HDCA 4O2BA 3SF8A 3X43A 4NY1A 3AVOA 3NONA 5E6UB 2D5IA 4U3JA 4K46A 5CRIA 2OV4A 1L1QA 2DYKA 2BMEA 1BQ3A 1SHTX 5AO9A 4IFBA 1FRVA 2ZRHA 3I1YA 4MV3A 3H5IA 5TQ0A 4N47A 4C5CA 4D82A 5JJBA 4R1MA 1LPMA 4MYHA 1EUZA 1QYDA 2G5CA 2IZ0A 1ZMRA 3HWRA 1J23A 1W5BA 2YNMC 3L04A 1R8JA 5ALTA 3ICOA 3NDPA 4WJLA 4YRBA 1B8UA 2X3UA 1NJSA 2XCIA 2PD3A 3VPBA 3NHFA 1K6EA 5HKLA 2H9YA 1IBCA 3PHJA 3L7JA 4GI5A 1NPTO 1C8LA 3QJ5A 4ZC1A 1WD7A 4YLEA 2QVBA 2CC2A 4M0FA 5D5PA 1C7QA 3MGKA 3RIGA 4JI7B 1NVKA 1EX7A 2GILA 4LUCA 3TW8A 2P62A 3ICPA 3W5AA 2GQ0A 3DJFA 2L42A 1CF4A 3SC2B 4BLPA 1DV2A 1JMYA 1U9ZA 5JH7A 3WDSA 1H66A 2CF6A 3S99A 1GFSA 4KPFC 4KR9A 1A2QA 2YXEA 1OASA 1ZH0A 3KUXA 4F4IA 3TTUA 4ENQA 1PR2A 1VYTA 2G40A 3P2JA 3DULA 3JSXA 3T4AG 1DJQA 5DI3B 3C6ZA 1BAPA 2DQ4A 3QVUA 5AVSA 3W5VA 1XPJA 3V32A 5LXTB 4AWBA 4MAFA 2OILA 3C7DB 1GPH1 1VJDA 4G5HA 1F48A 3HO1A 1ZD1A 1F1JA 3PTAA 3S1AA 2ND0A 1AQUA 2HIAA 2PYDA 3T3EA 2BFAA 4LDPA 4IWPA 3FGPA 3GRKA 4LSMA 2PZLA 5JJKA 2IEGA 2GHQA 3FXAA 1DMRA 2OO5C 3ONEA 2JAHA 3QF4A 3V2HA 2RGWA 3OD1A 4UEJA 5DDIP 5NLLA 4A7PA 1FOEB 2BONA 3C8MA 2ZE5A 3CRW1 2HM7A 1D03A 2ZUDA 4GE3A 5HA5A 5J2UF 3NBMA 4Q1AA 2ZI5A 4F1WA 2EGGA 1E6LA 3U4MA 2PMEA 1KHTA 4KXYA 5F4BA 1V8FA 4D9FA 4AG3A 3N5CA 4IHQA 4Q4HA 2O2DA 2CXPA 2Y67A 3HA2A 2PZFA 2BP7B 2Q5JA 3HJBA 4L2IB 4M9UA 5B1IA 2CXNA 1TE2A 3RVJA 3S40A 2PU5A 1Z16A 4ESOA 5BV7A 2HOQA 3C3PA 3CIOA 3WFZA 2JLSA 4KIWA 1FY2A 1Q0SA 2QROA 3CF4A 2GO1A 1JSXA 3DDHA 3FPEA 4RKQA 4P0PB 2B8JA 4TLBA 3H8VA 3INYA 5LU9A 8ATCA 1R4MA 1A8UA 4K81B 3MT8A 2NO7A 3BXHA 4G0MA 5K03A 3EBLA 1IXZA 3P0IA 4XGRA 2Q8PA 1HSZA 2CEKA 3Q87B 3WISA 1K0FA 3PBKA 1KWGA 1U7XA 2P90A 4IHJA 4J0EA 5LWQA 3PUIA 4CEJA 3UXYA 5COBA 3E7XA 4MEAA 4OQLA 3TR6A 4RM2A 2ONKA 1DO2A 1JFFA 2NWQA 1GJRA 3D0QA 3EGIA 4WVFA 4QT4A 3CEMA 3EMDA 2HIMA 1PT7A 3ZBQA 3FUXA 2BE9A 3KLMX 5BW8A 3L8HA 4AKHA 1GAEO 1SB8A 2QAGC 4LC9A 1FFEA 3GXBA 4YJKA 3R7LA 5H9VA 4R71A 4P33A 4Y1EA 3PUZA 2WZQA 4Y2QA 1JG7A 2R65A 1WSDA 4C0BA 4C4AA 3M82A 1HT0A 5C3UA 2WMYA 2FW7A 3U17A 2E1RA 3RYIA 5D01A 4YH1A 4ND1A 4B46A 4DPMA 4KFSA 1K8ZB 3OEED 4M1YA 3OA0A 1DADA 2XKKA 2CW5A 5A0VA 2Q3MA 3FI9A 3KB2A 4H1WA 4LWPA 1WR8A 1YQUA 2QRLA 5KC8A 3QTBA 4FD2A 5DM1A 1HKUA 3V1LA 3NH9A 2P9BA 4KBFA 2KLHA 5JAIA 1P4GA 1ISSA 2BGLA 3CG4A 3WNDA 1KZHA 4TWZA 4AJPA 2C4VA 1OLXB 2E5WA 5F2EA 5BOSA 3FOFC 3GFTA 1R7RA 3VNBA 4O5OA 1Z63A 3N70A 4Y6QA 3OEEA 4PCVA 3K5IA 2NO9A 3EMBA 1KP9A 4G5OA 5DBOA 3ZHBA 1U9YA 4A36A 2IUEA 1YQEA 4ALKA 3CVOA 4X91A 3RRFA 1A3CA 2FAXA 3RFXA 4BWFB 2AI2A 3R9XB 3DC2A 3NATA 1AS2A 4PF1A 1C3OA 1C7ZA 4E2XA 2EZTA 3Q3EA 4FM3A 3FPKA 4TWJA 3HFRA 3PXAA 3VZQA 5BSUA 1RQPA 2I2WA 3UJDA 1TGYA 5HCIA 4IZ6A 2FFBA 4M8LA 2J3IA 4TYQA 1DWPA 5I9NA 2Q5EA 1QP7A 4Q82A 4GOLD 1GDHA 4RF2A 1AKTA 1GLVA 1W93A 4CKEA 1U8AA 3RW9A 1NVUQ 1G2IA 2WUWE 3H8WA 3HYNA 4QELA 3VU3A 3I62A 3LIPA 4E88A 4RIEA 2V6BA 1F8XA 2AB0A 2MR5A 5IM4F 4TSFD 5ER9A 2FZCA 4J16C 5IP5A 5ELXA 5FIGA 2I4TA 3LWBA 1IQ0A 1T24A 2DOKA 5JYBA 3MIIA 2QU7A 4HDMB 1DC5A 3DNFA 4ZQCB 3R6LA 4GWGA 1YWMA 1RQLA 3KWJA 3LA6A 4HNRA 2J7KA 4UMFA 1W1WA 3LLCA 1L7BA 4Y67A 4RK1A 3BHIA 4C4XA 4H6IA 1LC0A 1R0ZA 5K3FB 4CTNA 3QA8A 1N5OX 2E87A 2QTNA 1OT5A 1E4EB 1FTQA 2ZRNA 3DZDA 3EN0A 3K30A 1SHKA 2NXCA 2NXNA 3ASZA 4TSFA 1QP0A 1OZHA 2QW8A 4E3ZA 5KTSA 4M7RA 4YFVA 4IH9A 3DDUA 2FR0A 3CB4A 1Q0RA 1T3ZA 5BSHA 1TZKA 3CLRC 1LX7A 3OJCA 2X3YA 3P52A 2C00A 1GZHB 4QECA 2W6MA 2UYHA 1PLJA 3EGXB 3NVMB 3UAGA 1NSYA 4ENTA 1SIOA 1I6MA 1MIHA 2QTTA 3I9FA 4TXMA 2PWYA 2XDQB 5F1KA 4YV0A 4M7WA 4OKSA 3FZQA 1GRNA 3HHPA 3CIFA 4DGSA 1FP7A 1G3UA 4RV9A 4CLOB 1U2RA 2B5OA 2QBYA 4XB2A 1OB2A 5CVTA 1Z12A 4OLJA 2J5BA 2WKPA 1WKCA 4FIZA 1AKRA 3PX3A 5AW5A 3GG9A 2QVLA 3UT5B 3DQZA 1UQTA 1R9MA 2JIMA 4WY8A 3OJFA 4TKVB 2R6DA 2ZIEA 1JAIA 2DUUA 3AR4A 4NZZA 3WYCA 1AO3A 5I7WA 1BHQ1 1JTEA 1PFQA 4HQ6A 1P1HA 2XKJE 1KVSA 4P2GA 4RWZA 5TF4A 1CE8B 1H94A 1ESEA 4ZOLF 3OX3A 1I0LA 3PKZA 4YN3A 3VFDA 2XBUA 3EVDA 4Z2AA 1IVSA 4J29A 4AVYA 3UAWA 3L0SA 3MWEA 1TVEA 3BQNB 4IIJA 3W5IA 4BX2A 1N75A 1SCIA 4Q9LA 3PS9A 4R3NA 4GSYA 1QRSA 1J7KA 1GFZA 3PEFA 1EK1A 1KGSA 4UKDA 3ZKWB 3U61B 4QM6A 3CB2A 3JASB 2CLSA 2I55A 1IY8A 3E70C 1D1SA 2EX1A 3MCZA 3RV0A 1PSDA 4HUQA 2CFOA 3W6OA 4PZPA 4P4SA 4EZYA 4G67A 4BFXA 2RGDA 3I2FA 2OFOA 2BEKA 2WJGA 5AJUA 2IKSA 2TMDA 3NRJA 1TCBA 2HWXA 1MB2A 1EP1B 3GUVA 1VRVA 1VKNA 2FRVA 2NV0A 1V1MA 4C4SA 4ZPXA 3ITDA 2QRNA 2H18A 1UZNA 2XVZA 2AFIB 1KQOA 4TWRA 1XCJA 5IVIA 1QG6A 1IAQA 4G1UC 3KTDA 4TS3A 4NCAA 1FNMA 1YB2A 3KQTA 2JGDB 2C9ZA 2VF5X 1XE3A 1KMMA 3DZBA 4FKBA 2UZ3A 4UBIA 1X74A 2FGKA 4C2UA 3D6AA 2J45A 4V0ME 2WIBA 1ESCA 7MDHA 1X14A 2FSPA 4GIBA 3D6TB 4LECA 4PR3A 2ZAYA 4REMA 4UHEA 4XYBA 3HVKA 5FP0A 4KO4S 2Q28A 4INOA 3S2IA 1RQ7A 1R15A 2JIZD 3WADA 4TV9B 4AULA 2V0GA 3IEKA 1HFWA 3O03A 5CTAA 5P8WA 3RVQA 2HSJA 2ISQA 4Q4AA 3UH1A 1BMTA 1XDGA 1A5BB 4FLEA 3SHOA 2IJGX 3SGLA 4US2R 2WU8A 1X87A 3JQPA 2BBTA 4AD8A 1NIJA 4KGZA 1N33B 3IXQA 1Z2EA 4UNIA 4BE7B 2GBCA 4MKHA 3ORFA 1T4CB 3N5KA 2FUKA 4M86A 3BXFA 3LF1A 2Y1KA 4KVGA 2V65A 1QF7A 1YI1A 2BBOA 2JIZA 3ECSA 4FT4A 4B3IA 4EZUA 4LMBA 2MSCB 3LPMA 4GDMA 4I5GA 1QAQA 5AOBA 3TQFA 4Z5XA 2XYHA 2BKUA 4PPYA 3GQVA 4J3JA 3SX2A 3H75A 3R0XA 4JLDA 3UAXA 3ZYCA 3GZ4A 5AIAA 2YH2A 1QG0A 3MOSA 3R44A 3W7AA 3ITEA 1S5PA 3ROKA 3ZDQA 4M9SA 3E22B 2AR9A 2EJUA 4TWBA 3A3PA 1K4KA 1UBEA 1Z74A 3CO0S 2C4MA 2G1KA 5E6RA 2E5LB 3QNWA 5FTKA 2RHJA 1ZXLA 3GLHB 3T3DA 4EG8A 1FW6A 3K7EA 4YJ3B 5EJ4A 1Z2NX 1B0ZA 1P0IA 1BGVA 4MLPA 3QE6A 1E1LA 5GMOA 2JLWA 3EOAI 4OLAA 2FMTA 1Z83A 3PZRA 5FOTA 4E81A 2ZS8A 2GCNA 3DXZA 3HACA 4YJFB 2BY4A 4YJ2F 4MQFA 1PVDA 2ACWA 4KAAA 4QD3A 1KYXA 4IWQA 2FQYA 2PLRA 4BRWA 3H42B 4M37A 2BDUA 4WNAA 1C8KA 4I1OA 4I8DA 1Q1BA 4XQ9A 4XI9A 1R0SA 2JGKA 4C0XA 1N2SA 4BVHA 1O08A 4Y2TA 2WF5A 2ZDGA 3OP4A 4R2MA 1TYAE 1WDMA 5IEBA 4YT2A 5EHXA 3HBJA 2QTBA 3U4HA 2G1AA 3BSWA 2H4FA 4CR8A 3WTBA 1N78A 2F8SA 4RHTA 3HTXA 4MGKR 2I29A 1A2KC 1NOJA 2AR0A 1BFKA 4LRSB 1KNQA 5IBPA 4XVCA 4FI3C 5J1SB 3QKWA 3RT7A 4YEDA 3JVIA 4JGIA 4RKYA 4DREA 3ORYA 3V8QA 4FGLA 1IU9A 3W6UA 4WCFB 1UANA 2DFDA 3TXXA 2RGRA 2MJLA 4X8HA 2O0HA 2QS9A 3PIDA 4GGOA 3IJRA 4JBXA 1Y6QA 2X86A 5AK4A 1V3QE 1XOIA 1LDYA 1JLMA 2HCTA 2HBZA 1G3RA 2QT1A 4UVIA 2IP2A 4IDDA 2O05A 3ZDEA 2DKFA 3S44A 4F3YA 3HDQA 1XR3A 3IULA 5JCXA 4QEDA 2JIQA 3M1AA 3ORHA 1HG1A 2E7ZA 3WGOA 4L4YA 4MR9B 1KSHA 3M9XA 1U3VA 1KQ3A 2BM0A 1I3MA 3AO0B 5BSWA 3PD7A 1PJCA 3C6YA 5TVGA 3LYHA 2QD1A 4GT1A 3RSFA 3RS9A 5A1TA 4PLTA 3AF0A 1C9KA 1JQDA 2HBQA 1GTMA 3G6WA 1NM5C 4XWYA 3SE0A 1JG2A 4C08A 3A2KA 2W6PA 1V8BA 1J22A 1CETA 1I32A 2Z0MA 2WAYA 1C3EA 1F2TA 1GTG1 1NWCA 1ZCAA 3JZMA 2ONZA 1WHSA 5HXAA 1INLA 2QI9F 5CDGA 1NMYA 1TT7A 3GF4A 3JQ7B 1GEGA 2DHEA 2C9MA 3DUWA 2VNIA 3MNFA 3QFHA 1L4YA 2A0KA 5KOIA 5JNVA 3FFTA 1Z6AA 1GTZA 2LPMA 1W46A 4AUKA 2D2EA 2ZRLA 4YAEA 5TT0A 1JNXX 2GVDC 2H2WA 1Z7GA 2REQB 2HQ1A 2FOLA 1EUCB 3DMTC 2ZS7A 3MTGA 2YVLA 4Y2XA 4X64B 1ES9A 2B20A 2ZB7A 1I3CA 1V2GA 3UG6A 1JFSA 4N49A 5JADA 1QORA 4O4JF 3BRQA 4B2YA 5K0SA 2D54A 2QMYA 4G24A 2OBLA 4JYBA 1FRNA 5BWOA 4XFDA 4X65B 3UMSA 4ETMA 3PI6A 2IA5A 5LZ4A 3BRWA 3NETA 1FLVA 4IY1A 5ALOA 1PJZA 5LD2B 4OX9Y 1AMUA 2YC4C 2DFVA 3COSA 1DC8A 1YVEI 2J9XB 3GBVA 3NM6B 4GLLA 2JI8A 4MP3A 2NTYC 1V45E 4R2LA 3T5BA 4LX0A 4M8SA 3VO8A 4DB4A 3IDOA 3QV2A 4Q3KA 5IKEA 3AKDA 2DJ5A 2W2VA 1V11B 4QOFA 2HRRA 3LTNC 2JCYA 3H2JA 3VEAA 1II9A 5EEGA 4W9MC 4QBIA 4RAOA 1ISJA 1JKMA 1CV2A 5BN5B 3MFQA 4F8JA 4R9SA 1FP6A 1TM4E 3I5XA 2AEMA 5I3ZA 4P93A 1SZPA 2N42A 5EIAA 5FWNA 3GYGA 1ZGZA 3C97A 5H16A 2B4RO 4X41A 2CNNA 2RGNA 1U2ZA 3NHMA 1VC2A 4I3HA 1A8IA 2AOTB 3WLMA 3ZYZA 5BPHA 3VKGA 2VF7A 2NUBA 3TQSA 1JEJA 2YJ6A 3ZWVA 4XUEA 3WLNA 2DLDA 1Z82A 4D7AA 5KHLB 1NJGA 1TIBA 2J9ZB 1SR8A 1NVXQ 3SQOA 3LGSA 3OSZA 1DAMA 1X86B 2VPYA 2QJFA 4UXIA 1UJ6A 3E5RA 1GZ3A 8ABPA 2MINA 4TX1A 5FF9A 1TD9A 2Q2VA 4ENUA 2XMRA 5CDTA 2OHXA 4Q4JA 1UODA 2JCSA 4EEKA 1I7QB 2BHTA 3Q9LA 1P2VA 2OFXA 5BV1A 4MB6A 3IJ5A 2KHOA 2GKGA 4XWOA 3GR6A 3A1EA 1TAQA 3SU8A 1UK7A 2YWJA 4UQPA 3DPQA 4I5DA 2V54A 3ZXXA 4OI2A 3EZXA 1WEHA 3X1MA 3PGKA 1U9CA 1IAVA 3OTIA 1O1YA 2WHXA 4J1NA 1TCVA 2FUNB 1P7PA 2PSEA 2XUDA 4JLJA 4Z9AA 2TSYB 3ROXA 1M6NA