3T46A

Crystal structure of staphylococcal complement inhibitor d (scin-d) at 1.5 angstrom
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
75
structure length
75
Chain Sequence
HQALVDQLHELIANTDLNKLSYLNLDAFQKRDILAAHYIAKSAIRTKNLDQMTKAKQRLESIYNSISNPLHSQNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords SCIN-D
publication title Diversity in the C3b Convertase Contact Residues and Tertiary Structures of the Staphylococcal Complement Inhibitor (SCIN) Protein Family.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 27
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2011-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3t46A00
4H6HA 3DPPA 4EZOA 4R5IA 5E84A 5TKYA 3T47A 2QFFA 4EZUA 4H6IA 4JWEA 4B9QA 1DKYA 4EZNA 3DPQA 4R5KA 4EZQA 4EZZA 3T49A 4F00A 3T48A 4EZRA 2QXLA 1DKZA 3L3OM 3T4AG 4R5LA 4EZPA 4F01A 2KHOA 4JN4A 3OHXM 3D2FA 4R5JA 3QNJA 4EZWA 4EZXA 3C7NA 3DPOA 4EZYA 3D2EA 4HYBA 4JWCA 4EZSA 4E81A 4EZTA 1DKXA 4JNEA 4JNFA 4JWDA 4EZVA 1U00A 2WINM 4JWIA 4R5GA 4HY9A 3T46A 4PO2A
chains in the Genus database with same CATH superfamily
3EJTA 2YLLA 4JWEA 4HR1A 4I1QA 1E9VA 4EZPA 3OHXM 3EJSA 3D2EA 4E81A 2EFLA 1DKXA 2D4CA 3SYVA 2F1AA 4KIKB 4R5GA 4EZOA 2Z8YA 5E84A 2YL6A 2EWFA 3T48A 3BLBA 3B53X 3HAHA 3LMFA 3UITA 1UPXA 3G9GA 2YKTA 3D50A 4JLCA 4IM0A 1JQKA 2GF4A 1O7DC 3EJQA 2QFFA 2NCZA 3DX2A 2OBLA 3T49A 2EFKA 3SOGA 1WDZA 3DX3A 4G6QA 4IWPA 1LQ7A 3RV0A 2GA9D 3PLTA 3Q84A 3Q0KA 3DPPA 4AZGA 1TQUA 4E3CA 2QXLA 4IM2A 1TQWA 2LXYA 3I39X 4HYBA 4WPEA 2ALWA 2QKWA 2X3WA 4JNEA 4JWDA 4EZVA 1HTYA 2YIBA 1PS3A 3KDRA 3BUPA 2JNKA 2Z0OA 4UDYX 4AZ6A 1SU7A 4AZCB 4R5KA 2RAIA 2WYHA 1OA1A 3I2WA 3D2FA 1O7DB 1I4LA 2ZXQA 4KIKA 2ND1A 3B52X 3BUDA 3VEBA 2ELBA 2F7QA 3T46A 5TKYA 3CAZA 2FYVA 2JNSA 4FZPA 2FICA 3O3MB 2RT6A 3DPOA 3KAVA 3D51A 4AKVA 3CV5A 2OZNB 5FLEX 2RAJA 3VEAA 1SU6A 4EZRA 1GN9A 1DKZA 4FM3A 3BVWA 1QWUA 4R5JA 3QNJA 3D4YA 1QX1A 4DCNC 1ZYLA 4NSWA 3L3PA 3LLLA 3OK8A 1R5EA 3T47A 4H6IA 3OWGA 4FZSA 3QNIA 3T4AG 3DX4A 4EZSA 1E1DA 1MJGA 3DYTA 1SU8A 3I01A 3BUIA 1GNTA 4JL9A 2F7OA 4NPHA 4IW0A 3HAJA 2F18A 2PMRA 2YLAA 4EZUA 1TQSA 5FIGA 4B9QA 2C08A 2LM0A 4F01A 1R33A 1GNLA 3ACOA 1URUA 3BUQA 4EZYA 3EJPA 1SUFA 5C5BB 3F7WA 4FZOA 4ATMA 4D8JA 3BUBA 1TQVA 3QWEA 1I49A 3ZEDA 2PY6A 4H8SA 4IWQA 2ND0A 3QA8A 2KHOA 3BVTA 3CKDA 1I4TA 2F7RA 2X3VA 3FD9A 2OO2A 2YIAA 4EZWA 3BVUA 4WPCA 3ERCC 1QWNA 3DPQA 3M3WA 4EZQA 3L3OM 4M0MA 4JN4A 3ABHA 4AVMA 4JWCA 3EJRA 2X3XA 4NQIA 4AZ7A 3VKHA 4IWOA 4R5IA 1OAOA 2RAKA 2YI8A 2EX3B 2YL9A 3CZNA 4UDXX 2MI7A 5KBPA 3HAIA 2O0I1 2OW7A 3ER8C 3A98A 4IM3A 2WINM 3QE6A 1OA0A 4PO2A 2OBMA 1ZWWA 4AZHA 2YL5A 4BNEA 3DX0A 5C5BA 4HR1B 1E2UA 3EJUA 2D1LA 4DYLA 4AZ5A 4EZTA 2GAFD 2F1BA 3GI7A 1HWWA 2Z0VA 4AZCA 1I4DA 1Y2OA 4AZBA 1HXKA 1DKYA 4F00A 2V0OA 3BVXA 3DDFA 1YWMA 3DX1A 3RPMA 2OW6A 2X5CA 4AZIA 3ER9B 2Q13A 4JWIA 1X03A 4H6HA 3CZSA 4EZNA 3O3NB 4EZZA 3BVVA 1X04A 4R5LA 4EZXA 2Q12A 2F7PA 3I04A 2YL8A 3C7NA 2YI9A 2Z0NA 2N3KA 3O3OB 4JNFA 1U00A 4HY9A 3B51X 2YIVX 3RV1A 3D52A 3LVTA 3CVRA 2WYIA 3D4ZA 3KAWA 1TQTA 1W9MA 1R34A 3DDGA
chains in the Genus database with same CATH topology
4JL9A 4NPHA 4IW0A 3KDRA 4EZUA 4JWEA 4UDYX 2OBMA 5FIGA 4B9QA 4HR1A 1SU7A 4R5KA 2LM0A 1E9VA 4EZPA 4HR1B 4F01A 1OA1A 1E2UA 3D2FA 3OHXM 1GNLA 4EZYA 3D2EA 1SUFA 4KIKA 2ND1A 3F7WA 4E81A 3B52X 4EZTA 1DKXA 2GAFD 3VEBA 4D8JA 4KIKB 4R5GA 3GI7A 3T46A 4EZOA 2Z8YA 5E84A 5TKYA 1DKYA 2EWFA 4F00A 3T48A 3ZEDA 2PY6A 4IWQA 2ND0A 2JNSA 3QA8A 2KHOA 3B53X 3O3MB 2RT6A 3DPOA 3LMFA 3KAVA 3UITA 1UPXA 3FD9A 2X5CA 4PO2A 3ER9B 4JLCA 4IM0A 4JWIA 2YIAA 1JQKA 4EZWA 4H6HA 3ERCC 5FLEX 2QFFA 2NCZA 2OBLA 4EZNA 3DPQA 3VEAA 3O3NB 1W9MA 4EZQA 4EZZA 3T49A 1SU6A 4EZRA 1GN9A 1DKZA 4FM3A 3L3OM 4R5LA 4M0MA 4JN4A 4R5JA 4EZXA 3QNJA 3I04A 3C7NA 4G6QA 4JWCA 2YI9A 4IWPA 3RV0A 2GA9D 1ZYLA 2N3KA 3O3OB 4JNFA 1U00A 4HY9A 3VKHA 4IWOA 3DPPA 4R5IA 3T47A 1OAOA 4H6IA 3B51X 2YIVX 4E3CA 3OWGA 3RV1A 2YI8A 2EX3B 2QXLA 4UDXX 3T4AG 4IM2A 4EZSA 3I39X 4HYBA 1E1DA 1MJGA 3ER8C 3A98A 3KAWA 4JNEA 4JWDA 4EZVA 1SU8A 4IM3A 2WINM 3I01A 2YIBA 1OA0A 1GNTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H6H A;  3DPP A;  4EZO A;  4R5I A;  5E84 A;  5TKY A;  3T47 A;  2QFF A;  4EZU A;  4H6I A;  4JWE A;  4B9Q A;  1DKY A;  4EZN A;  3DPQ A;  4R5K A;  4EZQ A;  4EZZ A;  3T49 A;  4F00 A;  3T48 A;  4EZR A;  2QXL A;  1DKZ A;  3L3O M;  3T4A G;  4R5L A;  4EZP A;  4F01 A;  2KHO A;  4JN4 A;  3OHX M;  3D2F A;  4R5J A;  3QNJ A;  4EZW A;  4EZX A;  3C7N A;  3DPO A;  4EZY A;  3D2E A;  4HYB A;  4JWC A;  4EZS A;  4E81 A;  4EZT A;  1DKX A;  4JNE A;  4JNF A;  4JWD A;  4EZV A;  1U00 A;  2WIN M;  4JWI A;  4R5G A;  4HY9 A;  3T46 A;  4PO2 A; 
#chains in the Genus database with same CATH topology
 3EJT A;  2YLL A;  4JWE A;  4HR1 A;  4I1Q A;  1E9V A;  4EZP A;  3OHX M;  3EJS A;  3D2E A;  4E81 A;  2EFL A;  1DKX A;  2D4C A;  3SYV A;  2F1A A;  4KIK B;  4R5G A;  4EZO A;  2Z8Y A;  5E84 A;  2YL6 A;  2EWF A;  3T48 A;  3BLB A;  3B53 X;  3HAH A;  3LMF A;  3UIT A;  1UPX A;  3G9G A;  2YKT A;  3D50 A;  4JLC A;  4IM0 A;  1JQK A;  2GF4 A;  1O7D C;  3EJQ A;  2QFF A;  2NCZ A;  3DX2 A;  2OBL A;  3T49 A;  2EFK A;  3SOG A;  1WDZ A;  3DX3 A;  4G6Q A;  4IWP A;  1LQ7 A;  3RV0 A;  2GA9 D;  3PLT A;  3Q84 A;  3Q0K A;  3DPP A;  4AZG A;  1TQU A;  4E3C A;  2QXL A;  4IM2 A;  1TQW A;  2LXY A;  3I39 X;  4HYB A;  4WPE A;  2ALW A;  2QKW A;  2X3W A;  4JNE A;  4JWD A;  4EZV A;  1HTY A;  2YIB A;  1PS3 A;  3KDR A;  3BUP A;  2JNK A;  2Z0O A;  4UDY X;  4AZ6 A;  1SU7 A;  4AZC B;  4R5K A;  2RAI A;  2WYH A;  1OA1 A;  3I2W A;  3D2F A;  1O7D B;  1I4L A;  2ZXQ A;  4KIK A;  2ND1 A;  3B52 X;  3BUD A;  3VEB A;  2ELB A;  2F7Q A;  3T46 A;  5TKY A;  3CAZ A;  2FYV A;  2JNS A;  4FZP A;  2FIC A;  3O3M B;  2RT6 A;  3DPO A;  3KAV A;  3D51 A;  4AKV A;  3CV5 A;  2OZN B;  5FLE X;  2RAJ A;  3VEA A;  1SU6 A;  4EZR A;  1GN9 A;  1DKZ A;  4FM3 A;  3BVW A;  1QWU A;  4R5J A;  3QNJ A;  3D4Y A;  1QX1 A;  4DCN C;  1ZYL A;  4NSW A;  3L3P A;  3LLL A;  3OK8 A;  1R5E A;  3T47 A;  4H6I A;  3OWG A;  4FZS A;  3QNI A;  3T4A G;  3DX4 A;  4EZS A;  1E1D A;  1MJG A;  3DYT A;  1SU8 A;  3I01 A;  3BUI A;  1GNT A;  4JL9 A;  2F7O A;  4NPH A;  4IW0 A;  3HAJ A;  2F18 A;  2PMR A;  2YLA A;  4EZU A;  1TQS A;  5FIG A;  4B9Q A;  2C08 A;  2LM0 A;  4F01 A;  1R33 A;  1GNL A;  3ACO A;  1URU A;  3BUQ A;  4EZY A;  3EJP A;  1SUF A;  5C5B B;  3F7W A;  4FZO A;  4ATM A;  4D8J A;  3BUB A;  1TQV A;  3QWE A;  1I49 A;  3ZED A;  2PY6 A;  4H8S A;  4IWQ A;  2ND0 A;  3QA8 A;  2KHO A;  3BVT A;  3CKD A;  1I4T A;  2F7R A;  2X3V A;  3FD9 A;  2OO2 A;  2YIA A;  4EZW A;  3BVU A;  4WPC A;  3ERC C;  1QWN A;  3DPQ A;  3M3W A;  4EZQ A;  3L3O M;  4M0M A;  4JN4 A;  3ABH A;  4AVM A;  4JWC A;  3EJR A;  2X3X A;  4NQI A;  4AZ7 A;  3VKH A;  4IWO A;  4R5I A;  1OAO A;  2RAK A;  2YI8 A;  2EX3 B;  2YL9 A;  3CZN A;  4UDX X;  2MI7 A;  5KBP A;  3HAI A;  2O0I 1;  2OW7 A;  3ER8 C;  3A98 A;  4IM3 A;  2WIN M;  3QE6 A;  1OA0 A;  4PO2 A;  2OBM A;  1ZWW A;  4AZH A;  2YL5 A;  4BNE A;  3DX0 A;  5C5B A;  4HR1 B;  1E2U A;  3EJU A;  2D1L A;  4DYL A;  4AZ5 A;  4EZT A;  2GAF D;  2F1B A;  3GI7 A;  1HWW A;  2Z0V A;  4AZC A;  1I4D A;  1Y2O A;  4AZB A;  1HXK A;  1DKY A;  4F00 A;  2V0O A;  3BVX A;  3DDF A;  1YWM A;  3DX1 A;  3RPM A;  2OW6 A;  2X5C A;  4AZI A;  3ER9 B;  2Q13 A;  4JWI A;  1X03 A;  4H6H A;  3CZS A;  4EZN A;  3O3N B;  4EZZ A;  3BVV A;  1X04 A;  4R5L A;  4EZX A;  2Q12 A;  2F7P A;  3I04 A;  2YL8 A;  3C7N A;  2YI9 A;  2Z0N A;  2N3K A;  3O3O B;  4JNF A;  1U00 A;  4HY9 A;  3B51 X;  2YIV X;  3RV1 A;  3D52 A;  3LVT A;  3CVR A;  2WYI A;  3D4Z A;  3KAW A;  1TQT A;  1W9M A;  1R34 A;  3DDG A; 
#chains in the Genus database with same CATH homology
 4JL9 A;  4NPH A;  4IW0 A;  3KDR A;  4EZU A;  4JWE A;  4UDY X;  2OBM A;  5FIG A;  4B9Q A;  4HR1 A;  1SU7 A;  4R5K A;  2LM0 A;  1E9V A;  4EZP A;  4HR1 B;  4F01 A;  1OA1 A;  1E2U A;  3D2F A;  3OHX M;  1GNL A;  4EZY A;  3D2E A;  1SUF A;  4KIK A;  2ND1 A;  3F7W A;  4E81 A;  3B52 X;  4EZT A;  1DKX A;  2GAF D;  3VEB A;  4D8J A;  4KIK B;  4R5G A;  3GI7 A;  3T46 A;  4EZO A;  2Z8Y A;  5E84 A;  5TKY A;  1DKY A;  2EWF A;  4F00 A;  3T48 A;  3ZED A;  2PY6 A;  4IWQ A;  2ND0 A;  2JNS A;  3QA8 A;  2KHO A;  3B53 X;  3O3M B;  2RT6 A;  3DPO A;  3LMF A;  3KAV A;  3UIT A;  1UPX A;  3FD9 A;  2X5C A;  4PO2 A;  3ER9 B;  4JLC A;  4IM0 A;  4JWI A;  2YIA A;  1JQK A;  4EZW A;  4H6H A;  3ERC C;  5FLE X;  2QFF A;  2NCZ A;  2OBL A;  4EZN A;  3DPQ A;  3VEA A;  3O3N B;  1W9M A;  4EZQ A;  4EZZ A;  3T49 A;  1SU6 A;  4EZR A;  1GN9 A;  1DKZ A;  4FM3 A;  3L3O M;  4R5L A;  4M0M A;  4JN4 A;  4R5J A;  4EZX A;  3QNJ A;  3I04 A;  3C7N A;  4G6Q A;  4JWC A;  2YI9 A;  4IWP A;  3RV0 A;  2GA9 D;  1ZYL A;  2N3K A;  3O3O B;  4JNF A;  1U00 A;  4HY9 A;  3VKH A;  4IWO A;  3DPP A;  4R5I A;  3T47 A;  1OAO A;  4H6I A;  3B51 X;  2YIV X;  4E3C A;  3OWG A;  3RV1 A;  2YI8 A;  2EX3 B;  2QXL A;  4UDX X;  3T4A G;  4IM2 A;  4EZS A;  3I39 X;  4HYB A;  1E1D A;  1MJG A;  3ER8 C;  3A98 A;  3KAW A;  4JNE A;  4JWD A;  4EZV A;  1SU8 A;  4IM3 A;  2WIN M;  3I01 A;  2YIB A;  1OA0 A;  1GNT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...