3T46A

Crystal structure of staphylococcal complement inhibitor d (scin-d) at 1.5 angstrom
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
75
structure length
75
Chain Sequence
HQALVDQLHELIANTDLNKLSYLNLDAFQKRDILAAHYIAKSAIRTKNLDQMTKAKQRLESIYNSISNPLHSQNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SCIN-D
publication title Diversity in the C3b Convertase Contact Residues and Tertiary Structures of the Staphylococcal Complement Inhibitor (SCIN) Protein Family.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Immune system
total genus 27
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2011-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3t46A00
4EZWA 2WINM 4HY9A 2QXLA 3C7NA 4EZVA 1DKXA 2QFFA 4R5GA 4B9QA 4F00A 2KHOA 1DKZA 4EZYA 3T46A 4JWIA 4JN4A 4H6IA 4R5LA 3DPQA 4E81A 4JWEA 3OHXM 3T49A 4R5IA 4EZPA 4JNEA 3D2FA 4EZXA 3DPPA 3L3OM 4JWDA 3T4AG 1U00A 4H6HA 4JWCA 4PO2A 3D2EA 4HYBA 4EZUA 4EZSA 4EZTA 3T48A 3T47A 4R5KA 4EZRA 4EZNA 4EZQA 4R5JA 4F01A 3QNJA 5TKYA 1DKYA 4JNFA 5E84A 3DPOA 4EZOA 4EZZA
chains in the Genus database with same CATH superfamily
4AZ6A 3BUBA 2QFFA 3CVRA 2OW7A 4FM3A 3O3OB 2GF4A 2ND1A 3ABHA 4IWPA 3B51X 5C5BB 3KAWA 2Z0VA 3I2WA 4DCNC 4EZTA 2X5CA 4R5KA 2WYHA 5E84A 4F01A 3GI7A 3VEBA 3EJUA 3T46A 2YL5A 1GNLA 2FICA 4AZCA 1I4LA 3I04A 4EZPA 3DYTA 4FZSA 3D50A 4JNFA 1OAOA 3O3NB 4WPCA 1DKXA 2ZXQA 4JWEA 3VEAA 2D4CA 1MJGA 1R34A 3DPPA 3DX4A 4WPEA 4HR1A 1GNTA 2RAIA 3LLLA 4AKVA 4NSWA 2F7OA 1GN9A 2ND0A 1TQTA 2QKWA 4IM0A 1X03A 4E81A 3HAHA 2OBLA 1I4DA 3BLBA 4AZIA 2MI7A 2FYVA 2YIVX 4R5JA 3BUQA 3EJSA 3UITA 2GA9D 4IWOA 2YLLA 4H8SA 1JQKA 3SOGA 2EFLA 4JN4A 3D2FA 1QX1A 4JWCA 3PLTA 3KAVA 3M3WA 2V0OA 2WYIA 3D52A 2PY6A 1X04A 3ERCC 2WINM 2JNKA 4KIKB 4B9QA 1OA1A 5C5BA 1R33A 4JLCA 3QE6A 2OW6A 5FIGA 3B53X 3D4YA 1SU7A 4AZGA 3CZSA 4BNEA 1ZYLA 2LM0A 2X3XA 3DPOA 4EZWA 2YI9A 4D8JA 2NCZA 2Z0OA 2YLAA 2ELBA 1TQVA 2LXYA 4FZOA 4IM2A 3ER8C 4H6HA 4EZUA 1O7DC 5TKYA 3ACOA 3Q0KA 2YIBA 2YL6A 2Z8YA 3BVTA 3KDRA 1OA0A 4EZYA 4IWQA 4M0MA 3D51A 2C08A 2N3KA 2D1LA 3DDFA 3EJRA 1HTYA 1O7DB 4R5IA 3O3MB 3BUIA 1E1DA 4PO2A 4HYBA 3G9GA 3QNJA 3BVUA 3DDGA 4AZHA 2F1AA 3A98A 4UDXX 1PS3A 4R5GA 4JWIA 3EJQA 4AZ7A 3HAIA 2OZNB 3I01A 1QWUA 3OHXM 3T49A 3Q84A 1TQWA 3LVTA 4E3CA 4EZSA 3CV5A 2RAJA 1W9MA 4KIKA 4EZOA 4DYLA 2RAKA 3C7NA 2KHOA 2Z0NA 4H6IA 2EFKA 2F18A 3L3OM 4JWDA 3OWGA 3BUDA 3F7WA 1QWNA 3DX0A 3CKDA 3SYVA 3BUPA 4NQIA 2F7QA 1TQSA 2YI8A 4F00A 3RPMA 4NPHA 3HAJA 4AZ5A 4G6QA 2OO2A 3T4AG 2X3VA 2X3WA 3QWEA 3QA8A 3T48A 1Y2OA 3BVVA 4EZQA 3D2EA 4EZZA 4HY9A 2QXLA 3QNIA 3DX3A 4EZVA 4ATMA 2PMRA 2YL8A 4IM3A 3DPQA 4JL9A 3CZNA 3I39X 4AZCB 3DX2A 3EJTA 2ALWA 1R5EA 1ZWWA 1WDZA 1HXKA 1SU6A 1DKYA 4UDYX 3LMFA 2F7PA 4I1QA 3ZEDA 1LQ7A 3RV0A 4FZPA 3EJPA 2OBMA 2JNSA 3BVXA 2Q13A 4JNEA 1SUFA 3T47A 1YWMA 2O0I1 3OK8A 1I4TA 2YL9A 2GAFD 4HR1B 1HWWA 3ER9B 2Q12A 1DKZA 4AZBA 2YIAA 2YKTA 3RV1A 1SU8A 2F7RA 3VKHA 2EX3B 3DX1A 5FLEX 2F1BA 4EZRA 1URUA 3B52X 1TQUA 4R5LA 3CAZA 1UPXA 2RT6A 4IW0A 1I49A 4EZXA 3D4ZA 1U00A 3L3PA 3FD9A 2EWFA 4EZNA 1E2UA 4AVMA 1E9VA 3BVWA 5KBPA
chains in the Genus database with same CATH topology
4IWOA 4HY9A 2QXLA 4EZVA 2QFFA 1JQKA 4IM3A 4JN4A 3DPQA 4JL9A 4FM3A 3I39X 3O3OB 2ND1A 4R5IA 3O3MB 3D2FA 3B51X 4IWPA 3KAWA 1E1DA 4PO2A 4JWCA 4HYBA 4EZTA 2X5CA 4R5KA 3KAVA 3QNJA 1SU6A 1DKYA 2PY6A 5E84A 4UDYX 3ERCC 4F01A 3LMFA 2WINM 3A98A 4KIKB 4UDXX 3ZEDA 3GI7A 4R5GA 4B9QA 3RV0A 3VEBA 1OA1A 3T46A 4JWIA 1GNLA 2OBMA 3I04A 3I01A 3OHXM 3T49A 2JNSA 4JLCA 4EZPA 4JNEA 1SUFA 5FIGA 3B53X 4E3CA 4EZSA 1SU7A 3T47A 1ZYLA 2LM0A 1W9MA 4KIKA 4JNFA 2GAFD 3DPOA 4HR1B 4EZOA 3ER9B 4EZWA 2YI9A 1OAOA 4D8JA 3C7NA 3O3NB 1DKXA 2NCZA 1DKZA 2KHOA 2YIAA 4H6IA 4JWEA 4EZZA 3VEAA 3RV1A 1SU8A 1MJGA 3VKHA 3DPPA 3L3OM 2EX3B 4IM2A 4JWDA 3OWGA 3ER8C 4H6HA 4EZUA 3F7WA 4HR1A 5FLEX 1GNTA 4EZRA 5TKYA 2YIBA 3B52X 1GN9A 2ND0A 2YI8A 2Z8YA 3KDRA 4F00A 1OA0A 4EZYA 4IM0A 4R5LA 4E81A 4IWQA 4NPHA 1UPXA 2RT6A 4M0MA 4IW0A 4G6QA 2OBLA 4EZXA 3T4AG 1U00A 3QA8A 2N3KA 3FD9A 3T48A 2EWFA 4EZNA 2YIVX 4EZQA 4R5JA 1E2UA 1E9VA 3D2EA 3UITA 2GA9D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EZW A;  2WIN M;  4HY9 A;  2QXL A;  3C7N A;  4EZV A;  1DKX A;  2QFF A;  4R5G A;  4B9Q A;  4F00 A;  2KHO A;  1DKZ A;  4EZY A;  3T46 A;  4JWI A;  4JN4 A;  4H6I A;  4R5L A;  3DPQ A;  4E81 A;  4JWE A;  3OHX M;  3T49 A;  4R5I A;  4EZP A;  4JNE A;  3D2F A;  4EZX A;  3DPP A;  3L3O M;  4JWD A;  3T4A G;  1U00 A;  4H6H A;  4JWC A;  4PO2 A;  3D2E A;  4HYB A;  4EZU A;  4EZS A;  4EZT A;  3T48 A;  3T47 A;  4R5K A;  4EZR A;  4EZN A;  4EZQ A;  4R5J A;  4F01 A;  3QNJ A;  5TKY A;  1DKY A;  4JNF A;  5E84 A;  3DPO A;  4EZO A;  4EZZ A; 
#chains in the Genus database with same CATH topology
 4AZ6 A;  3BUB A;  2QFF A;  3CVR A;  2OW7 A;  4FM3 A;  3O3O B;  2GF4 A;  2ND1 A;  3ABH A;  4IWP A;  3B51 X;  5C5B B;  3KAW A;  2Z0V A;  3I2W A;  4DCN C;  4EZT A;  2X5C A;  4R5K A;  2WYH A;  5E84 A;  4F01 A;  3GI7 A;  3VEB A;  3EJU A;  3T46 A;  2YL5 A;  1GNL A;  2FIC A;  4AZC A;  1I4L A;  3I04 A;  4EZP A;  3DYT A;  4FZS A;  3D50 A;  4JNF A;  1OAO A;  3O3N B;  4WPC A;  1DKX A;  2ZXQ A;  4JWE A;  3VEA A;  2D4C A;  1MJG A;  1R34 A;  3DPP A;  3DX4 A;  4WPE A;  4HR1 A;  1GNT A;  2RAI A;  3LLL A;  4AKV A;  4NSW A;  2F7O A;  1GN9 A;  2ND0 A;  1TQT A;  2QKW A;  4IM0 A;  1X03 A;  4E81 A;  3HAH A;  2OBL A;  1I4D A;  3BLB A;  4AZI A;  2MI7 A;  2FYV A;  2YIV X;  4R5J A;  3BUQ A;  3EJS A;  3UIT A;  2GA9 D;  4IWO A;  2YLL A;  4H8S A;  1JQK A;  3SOG A;  2EFL A;  4JN4 A;  3D2F A;  1QX1 A;  4JWC A;  3PLT A;  3KAV A;  3M3W A;  2V0O A;  2WYI A;  3D52 A;  2PY6 A;  1X04 A;  3ERC C;  2WIN M;  2JNK A;  4KIK B;  4B9Q A;  1OA1 A;  5C5B A;  1R33 A;  4JLC A;  3QE6 A;  2OW6 A;  5FIG A;  3B53 X;  3D4Y A;  1SU7 A;  4AZG A;  3CZS A;  4BNE A;  1ZYL A;  2LM0 A;  2X3X A;  3DPO A;  4EZW A;  2YI9 A;  4D8J A;  2NCZ A;  2Z0O A;  2YLA A;  2ELB A;  1TQV A;  2LXY A;  4FZO A;  4IM2 A;  3ER8 C;  4H6H A;  4EZU A;  1O7D C;  5TKY A;  3ACO A;  3Q0K A;  2YIB A;  2YL6 A;  2Z8Y A;  3BVT A;  3KDR A;  1OA0 A;  4EZY A;  4IWQ A;  4M0M A;  3D51 A;  2C08 A;  2N3K A;  2D1L A;  3DDF A;  3EJR A;  1HTY A;  1O7D B;  4R5I A;  3O3M B;  3BUI A;  1E1D A;  4PO2 A;  4HYB A;  3G9G A;  3QNJ A;  3BVU A;  3DDG A;  4AZH A;  2F1A A;  3A98 A;  4UDX X;  1PS3 A;  4R5G A;  4JWI A;  3EJQ A;  4AZ7 A;  3HAI A;  2OZN B;  3I01 A;  1QWU A;  3OHX M;  3T49 A;  3Q84 A;  1TQW A;  3LVT A;  4E3C A;  4EZS A;  3CV5 A;  2RAJ A;  1W9M A;  4KIK A;  4EZO A;  4DYL A;  2RAK A;  3C7N A;  2KHO A;  2Z0N A;  4H6I A;  2EFK A;  2F18 A;  3L3O M;  4JWD A;  3OWG A;  3BUD A;  3F7W A;  1QWN A;  3DX0 A;  3CKD A;  3SYV A;  3BUP A;  4NQI A;  2F7Q A;  1TQS A;  2YI8 A;  4F00 A;  3RPM A;  4NPH A;  3HAJ A;  4AZ5 A;  4G6Q A;  2OO2 A;  3T4A G;  2X3V A;  2X3W A;  3QWE A;  3QA8 A;  3T48 A;  1Y2O A;  3BVV A;  4EZQ A;  3D2E A;  4EZZ A;  4HY9 A;  2QXL A;  3QNI A;  3DX3 A;  4EZV A;  4ATM A;  2PMR A;  2YL8 A;  4IM3 A;  3DPQ A;  4JL9 A;  3CZN A;  3I39 X;  4AZC B;  3DX2 A;  3EJT A;  2ALW A;  1R5E A;  1ZWW A;  1WDZ A;  1HXK A;  1SU6 A;  1DKY A;  4UDY X;  3LMF A;  2F7P A;  4I1Q A;  3ZED A;  1LQ7 A;  3RV0 A;  4FZP A;  3EJP A;  2OBM A;  2JNS A;  3BVX A;  2Q13 A;  4JNE A;  1SUF A;  3T47 A;  1YWM A;  2O0I 1;  3OK8 A;  1I4T A;  2YL9 A;  2GAF D;  4HR1 B;  1HWW A;  3ER9 B;  2Q12 A;  1DKZ A;  4AZB A;  2YIA A;  2YKT A;  3RV1 A;  1SU8 A;  2F7R A;  3VKH A;  2EX3 B;  3DX1 A;  5FLE X;  2F1B A;  4EZR A;  1URU A;  3B52 X;  1TQU A;  4R5L A;  3CAZ A;  1UPX A;  2RT6 A;  4IW0 A;  1I49 A;  4EZX A;  3D4Z A;  1U00 A;  3L3P A;  3FD9 A;  2EWF A;  4EZN A;  1E2U A;  4AVM A;  1E9V A;  3BVW A;  5KBP A; 
#chains in the Genus database with same CATH homology
 4IWO A;  4HY9 A;  2QXL A;  4EZV A;  2QFF A;  1JQK A;  4IM3 A;  4JN4 A;  3DPQ A;  4JL9 A;  4FM3 A;  3I39 X;  3O3O B;  2ND1 A;  4R5I A;  3O3M B;  3D2F A;  3B51 X;  4IWP A;  3KAW A;  1E1D A;  4PO2 A;  4JWC A;  4HYB A;  4EZT A;  2X5C A;  4R5K A;  3KAV A;  3QNJ A;  1SU6 A;  1DKY A;  2PY6 A;  5E84 A;  4UDY X;  3ERC C;  4F01 A;  3LMF A;  2WIN M;  3A98 A;  4KIK B;  4UDX X;  3ZED A;  3GI7 A;  4R5G A;  4B9Q A;  3RV0 A;  3VEB A;  1OA1 A;  3T46 A;  4JWI A;  1GNL A;  2OBM A;  3I04 A;  3I01 A;  3OHX M;  3T49 A;  2JNS A;  4JLC A;  4EZP A;  4JNE A;  1SUF A;  5FIG A;  3B53 X;  4E3C A;  4EZS A;  1SU7 A;  3T47 A;  1ZYL A;  2LM0 A;  1W9M A;  4KIK A;  4JNF A;  2GAF D;  3DPO A;  4HR1 B;  4EZO A;  3ER9 B;  4EZW A;  2YI9 A;  1OAO A;  4D8J A;  3C7N A;  3O3N B;  1DKX A;  2NCZ A;  1DKZ A;  2KHO A;  2YIA A;  4H6I A;  4JWE A;  4EZZ A;  3VEA A;  3RV1 A;  1SU8 A;  1MJG A;  3VKH A;  3DPP A;  3L3O M;  2EX3 B;  4IM2 A;  4JWD A;  3OWG A;  3ER8 C;  4H6H A;  4EZU A;  3F7W A;  4HR1 A;  5FLE X;  1GNT A;  4EZR A;  5TKY A;  2YIB A;  3B52 X;  1GN9 A;  2ND0 A;  2YI8 A;  2Z8Y A;  3KDR A;  4F00 A;  1OA0 A;  4EZY A;  4IM0 A;  4R5L A;  4E81 A;  4IWQ A;  4NPH A;  1UPX A;  2RT6 A;  4M0M A;  4IW0 A;  4G6Q A;  2OBL A;  4EZX A;  3T4A G;  1U00 A;  3QA8 A;  2N3K A;  3FD9 A;  3T48 A;  2EWF A;  4EZN A;  2YIV X;  4EZQ A;  4R5J A;  1E2U A;  1E9V A;  3D2E A;  3UIT A;  2GA9 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...