4AZBA

Differential inhibition of the tandem gh20 catalytic modules in the pneumococcal exo-beta-d-n-acetylglucosaminidase, strh
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
425
structure length
408
Chain Sequence
NEKLAKKKIVSIDAGRKYFSPEQLKEIIDKAKHYGYTDLHLLVGNDGLRFMLDDMSITANGKTYASDDVKRAIEKGTNDYYNDPNGNHLTESQMTDLINYAKDKGIGLIPTVNSPGHMDAILNAMKELGIQNPNFSYFGKKSARTVDLDNEQAVAFTKALIDKYAAYFAKKTEIFNIGLDEYANDATDAKGWSVLQADKYYPNEGYPVKGYEKFIAYANDLARIVKSHGLKPMAFNDGIYYNSDTSFGSFDKDIIVSMWTGGWGGYDVASSKLLAEKGHQILNTNDAWYYVLGRNADGQGGGNLDQGLNGIKNTPITSVPKTEGADIPIIGGMVAAWADTPSARYSPSRLFKLMRHFANANAEYFAADYESAEQALNEVPKDAIRSLDSNLSRAQQDTIDQAIAKLQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-N-ACETYLHEXOSAMINIDASE
publication title Inhibition of the Family 20 Glycoside Hydrolase Catalytic Modules in the Streptococcus Pneumoniae Exo-Beta-D-N-Acetylglucosaminidase, Strh.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
total genus 154
structure length 408
sequence length 425
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2012-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.90 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 AF1782-like 4azbA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4azbA01
2ZOXA 1V02A 4WKAA 3L2LA 3TONA 2J75A 2VCBA 3APGA 2Z1SA 2VRJA 1H09A 4AZ7A 4UFJA 3S2CA 3WD0A 1UWUA 3VGGA 5HDRA 3WQ5A 5JBEA 3LPGA 2QPSA 3WUFA 4L4PA 3KEHA 1NM9A 1OWQA 3WF1A 3IJ9A 3THDA 4QP0A 2PI6A 2WMHA 1MQPA 3IJ8A 1G5AA 1KB3A 1TG7A 2BVTA 2WHMA 2DH2A 3D5HA 4P8UA 3A47A 3MS8A 4YPJA 3EBVA 2CHOA 1ZBCA 4PMZA 1HL9A 5C8BB 3RM9A 3ZT7A 1ECEA 4MNJA 5JIPA 1M53A 2JF7A 3LPFA 1NH6A 1UKQA 1W2VA 3A6OA 5I5RA 4NRRA 1B31A 1XSIA 1VB9A 3FAXA 2D22A 1ZBVA 1GJUA 3MU7A 5CG0A 3F5LA 1KXQA 1RP8A 3ZIZA 2ZX8A 1QI2A 1MW0A 5ABFB 5M03A 3O2LA 3ALGA 3OA5A 3WNNA 1V0LA 1JF5A 2OWWA 2BVYA 1MFVA 1W9XA 3NSMA 4GO9A 3WNLA 1WZMA 2CCRA 5HPCA 4HMEA 4DWSD 5CZKA 4JCLA 2DDXA 3B8SA 2WNWA 1GCYA 1HN1A 3CUGA 2DSZA 4U2ZA 1BGAA 4NI3A 5ABGA 1JZ3A 3WBAA 1JYWA 2ZX5A 4E8CA 1QNSA 1IZKA 4FLRA 4H2CA 4ACYA 4QFUA 2DSUA 2WMIB 4D6EA 3WH5A 3DHUA 3OBAA 1UQZA 2BY2A 4MJ4A 1JNEA 5A6MA 1J18A 2WLYA 1QVBA 1J0YA 2EBNA 2QV4A 4HOZA 4HP5A 4N0RA 1UR4A 1JI2A 3OGRA 1US2A 1WDSA 3FNDA 3SCSA 5A8MA 1WPCA 4JFVA 4FLQA 2PC8A 4V2XA 2CEQA 2IXUA 3SUSA 2E9LA 2BY1A 2WZIA 5JBDA 4P7QA 5CJ5A 4C7DA 1W9UA 2DIEA 2WBGA 1M04A 1MWOA 5HOSA 3M46A 3WH9A 5A6LA 2VCCA 5A2AA 2WB5A 1D3CA 3CUJA 2YA1A 4JKMA 3RJYA 3AISA 3AQUA 1JFXA 4MTVA 1I1WA 4IPNB 1V3LA 4P8XA 3VGFA 4DUXA 1KCKA 1GORA 2XFFA 3VILA 5HNNA 4URIA 3T0BA 1CIUA 3ARRA 1V0KA 3SUWA 1QNPA 3VPLA 3WUGA 5BWFA 1BYDA 2ZUMA 1V3JA 3AIEA 3GXFA 1WO2A 1UD4A 2DQXA 3U5YA 1XD1A 1QBBA 3DYOA 1C3FA 4NZCA 4M24A 3AHXA 3AICA 4U5IA 2CYGA 4CD7A 1E3XA 1QW9A 4LX4A 5KZ6A 1E73M 1FFRA 3IANA 4AD2A 2JIWA 5GNXA 3ZO9A 5I24A 1TA3A 4UQBA 2CERA 5FKYA 8A3HA 1W3KA 4ATLA 4FZOA 1AQHA 2CBUA 1LG1A 1P6WA 2XYLA 5LA2A 3PZ9A 1TMQA 1HKMA 3ARPA 4F79A 2VX5A 3OB8A 2WVVB 4BF7A 3RM8A 1U30A 3WNPA 2XHYA 6TAAA 3ZM8A 3BC9A 4P8VA 4FK9A 1BVZA 1W9VA 3UG5A 1Y7VA 1C93A 2JNKA 1E0VA 3SCUA 4PUDA 3VTRA 1CECA 3WFZA 1MXDA 3WF2A 1E6ZA 5I78A 2J7BA 1RH9A 3I3DA 2QMKA 1V02E 2XIIA 2VX7A 4W86A 2X05A 4AD5A 3SCVA 2VMFA 4UQEA 1BAGA 1E72M 1XHGA 4F8XA 3NDZA 4UFHA 2WKLA 3CZEA 3WMBA 2B31A 1VEMA 3VGEA 5D8WA 4CN1A 3AYSA 1E55A 2J74A 4PUEA 3AOFA 1UH2A 4UOJA 4J3SA 3GXDA 1WCGA 1OGBA 2CITA 2DSKA 3CIVA 1WZAA 2WZEA 4HOWA 2GK1A 4UFKA 3AJ7A 1W9BM 3VU2A 1XSKA 2QHAA 1UR2A 1J0IA 4AZIA 1H1NA 2JF6A 3PHAA 4KMQA 4Q7NA 1HX0A 3FXYA 3PTKA 3UG3A 3GNRA 2WK2A 3GXMA 4Q22A 3D3AA 3HN3A 1CXFA 1XH2A 1EO5A 3WSUA 4KGLA 1RP9A 2WPGA 4Y7EA 4IUGA 4H8VA 1KGWA 4AD4A 1JG9A 3PN8A 4KRTA 1GVIA 2WC7A 3GH7A 5A6BD 2VC9A 2XFRA 1X6LA 4GZEA 4BQ4A 1WP6A 1GOQA 4BQ3A 3PZUA 3DYMA 1CGVA 3SIMA 3KL0A 2X0HA 4AIOA 1YHTA 4LXFA 2OWCA 3WL0A 5I3DA 4AYSA 1WDPA 2VRQA 1CPUA 2W62A 3WQWA 1ISVA 2VL4A 4AZ5A 2W61A 3IAQA 3RDKA 3L4ZA 2W4XA 3NSNA 4J3VA 2BFGA 3EMQA 3PZTA 2JIEA 1MYRA 1OGGA 4LYRA 4MNLA 4A4AA 3CUIA 3QHMA 3PTMA 5GPRA 3PZQA 2GJXA 3VDHA 3VM7A 1QNQA 4MB3A 1W9DM 1KXTA 4KWUA 1UYQA 2XJ7A 1SYTA 1NWUA 2GUYA 7TAAA 3CZLA 4AC1X 4U2YA 5D9NA 1QHPA 3ZSTA 3BCFA 2GK1B 1MQQA 3THCA 3RPMA 3WQVA 1GQKA 3B9DA 3ZR6A 1UHVA 4PMOA 3VD5A 3TP4A 1Q6GA 3JUGA 4PYSA 3WMCA 5I77A 3II1A 2ZUWA 4JZ5A 1VEOA 2WSPA 3ECQA 1V0MA 4FZPA 1J12A 1HJUA 3FHQA 2GJPA 4D1IA 5C70A 1OIMA 1V3IA 3HMCA 3GNOA 3W53A 1SMAA 2DH3A 2WMFA 1QPKA 1B3WA 4UZSA 2J7DA 1BGGA 5A8QA 1QOXA 1CGYA 4JAWA 4HA4A 2XVGA 3UESA 2CBJA 4UOQA 5I2UA 3CZGA 1WZLA 1G1YA 2D20A 4FLOA 3VDCA 1E4MM 2VO5A 1CGXA 4W93A 1J01A 4AMCA 4WSKA 4HA3A 4GXPA 5BXRA 2ZICA 4GQRA 3VIFA 2OYKA 5FOOA 2XVNA 3CPUA 2QLYA 1E43A 3CMGA 2E3ZA 2E8YA 2Y2WA 4BQ2A 1W1TA 4HZ8A 1V3MA 5EBAA 3T0AA 1B3XA 2FH6A 2G3IA 4RL3A 3T2PA 4EANA 4PBGA 1CXEA 3WUEA 3A3HA 2UY4A 1UKOA 3CHDA 1JDCA 3VIKA 3WEOA 4E2OA 3DYPA 5E6ZA 3W25A 1H4PA 3WDPP 1UA7A 2O9TA 2G8ZA 1BPLB 1BYCA 4CU6A 4CUCA 4J7RA 4CD4A 4TVCA 4UNIA 1JXKA 2WVTA 1HT6A 3RM4A 3W24A 4UQCA 2WC3A 4NF7A 1W2PA 1Q6EA 5TD4A 1OT1A 3WNMA 3UERA 3F5KA 1UG6A 1MW3A 4U33A 3AMGA 4Z2LA 4WKFA 1WDQA 1JZ6A 4D72A 4D71A 3VMNA 1OD0A 1PAMA 3A4XA 1FA2A 3VM5A 1ITXA 3ZR5A 5M17A 3N9KA 1LWJA 1K6AA 2EQDA 3IJ7A 4UTFA 4GO8A 4EK7A 4NSBA 1HIZA 4PEEA 2OWXA 3WUBA 4OUEA 4DUVA 1W3LA 1XD0A 2WBKA 4JL2A 3ZJ7A 4MNMA 5FD0A 2EEXA 1PZ2A 1JZ7A 3AXHA 4TVDA 1MQRA 3MV11 1HJSA 2W92A 3RIKA 2FHFA 4JIEA 1LJYA 1DHKA 1GOOA 1UD5A 3VNYA 1XH1A 5ABFA 1V6UA 3NUKA 5CSYA 2BXYA 3OGVA 3PZMA 2J62A 2EXOA 1W9PA 1BFNA 1ZB5A 3EMZA 3BSHA 1DWHM 1GONA 4B3LA 1Q6DA 1BF2A 1CNVA 3ARWA 1D7FA 1W91A 3L4TA 4M56A 1G01A 1XRVA 1ZJBA 3BMWA 1QI3A 4DWSC 3ZMRA 2AMGA 1ODUA 4PTWA 4W85A 3RILA 2VZUA 1Q6FA 2WXDM 5DF0A 3VINA 3SUTA 1JL8A 2VQTA 4GI9A 4WIWA 1CGTA 4J3UA 4S3JA 1QHOA 2WMIA 3DECA 3AHYA 4B16A 1H11A 5FL1A 1Z32X 1MW2A 4GQQA 4E4PA 2D2OA 2D0HA 2CKSA 5CGMA 1J0KA 1F4HA 3BAYA 2UWFA 4TOQA 1UR8A 3PZOA 4X9YA 2WCSA 1LG2A 1D2KA 1VFOA 2WMKA 4MAZA 1GJWA 4AWEA 3A4WA 5ECUA 2GVYA 4NRSA 4UQDA 5A8OA 5F7UA 2JALA 1US3A 3QHNA 2AAAA 1HJWA 3VNZA 2J7FA 3BAWA 2DSWA 2FGLA 1VFFA 4M82A 4LQ1A 1J0ZA 1UR0A 1C7SA 3EYPA 4K68A 4RE2A 5BXSA 4W7VA 1GQLA 1JD7A 4W5ZA 1Q6CA 1J10A 1TZ7A 1QI4A 2G41A 1B90A 2WLZA 1VBUA 3AXIA 4HOXA 3WH7A 1CLXA 2VTFA 3GM8A 3SCTA 3PZIA 2Z1KA 2WWCA 1GQJA 1XSJA 4CCEA 1CYGA 4Z2KA 1B9ZA 2UY3A 5CPSA 3K4AA 3AS2A 1GHRA 1F4AA 5DMYA 1MW1A 5CQ1A 3LPOA 4W7UA 3KE0A 1FP8A 4DM2A 1PBGA 3IAPA 4AZCA 3U5UA 1H5VA 1VRXA 3WDHA 3W81A 4ZXLA 5D9OA 3WQ4A 1VBRA 1FOBA 4HZ6A 4QLLA 2J7GA 3N11A 3BLPX 3NYDA 1UUQA 3AROA 5CSUA 3DC0A 3W6LA 1ZL1A 4Z2JA 3AS0A 1CXLA 3QR3A 3WIJA 4W8LA 3W27A 1JF6A 4TTGA 1ZBWA 4TVUA 3TTOA 3ZOAA 4PCTA 1BVNP 4OOZA 1E4NA 5M5DA 1QNRA 4AEFA 2WVVA 3MANA 3T09A 3L4YA 3AFBA 2X1IA 2EPLX 1QW8A 1PX4A 1E1FA 3DHPA 1MFUA 5I6SA 1ISXA 5GNZA 1UD2A 3TTSA 3RCNA 1CENA 2J78A 2BV9A 5IHRA 4JCMA 4GKLA 5HBFA 2V3DA 1UKSA 2DT2A 1SMDA 3EDEA 3E1F1 1IT0A 5IFTA 1OCQA 2PBOA 3OLDA 2ZUUA 1R8LA 3WEMA 2A3CA 4PSPA 3WD4A 3QOKA 4AXNA 1UQYA 4U5KA 1J0JA 1DEDA 4AISA 3AHVA 3OIHA 2GDUA 1B1YA 1BTCA 1HVXA 1C92A 2XM2A 4W8AA 4ACZA 1H0GA 4HU8A 3N15A 3AZSA 4TX8A 1C91A 4AIUA 1DWAM 8CGTA 1TFVA 1GOMA 1WZKA 4AZ6A 5A6AA 4JL1A 4AZCB 2YL6A 2CIPA 2GDVA 2C8NA 4GINA 2WKGA 4CU7A 4GIAA 3L2MA 7A3HA 2WMGA 3VGDA 3W26A 2ZXDA 4MDPA 4XZBA 3UR8A 3F4VA 4YN5A 2WMJA 4MJ2A 5CLTA 4CVUA 4PMYA 4PTMA 4WK9A 2YL8A 2J7CA 1HL8A 1KFWA 2DPEA 1A47A 2OZNB 2XGIA 2WCGA 2YBTA 2VUYA 3VMPA 1CDGA 2W91A 1KR1A 1HP5A 3W37A 5IFPA 4D1JA 1R7OA 1KGUA 4DWSA 5JBFA 2IXVA 4GI6A 3MSDA 4ZE4A 2WCAA 1UH3A 1EO7A 1JYNA 1JAKA 2F8QA 2EPOA 1OB0A 3AMDA 4C7FA 1JZ2A 3VD9A 2HISA 2PWGA 3MUIA 3OGSA 2PWHA 4M81A 1OM0A 1UWRA 4H8HA 5CLWA 1JYVA 4W84A 3SCQA 1TE1A 3LMYA 2NW0A 3UCQA 1XH0A 2CESA 3BCDA 1C8QA 1EA9C 1G94A 1XGZA 4PMDA 4F9DA 4CGTA 2ZX9A 2V3EA 5EFDA 3VIJA 3ZT6A 1E5JA 4ACZB 1ISYA 4UFMA 2ZUSA 3AIWA 3AS3A 1E6QM 1EDQA 1W3JA 4MNKA 4LPCA 2VI0A 3SEPA 4PMNA 5AY7A 4XZWA 1V6YA 4DUWA 3F5JA 1JDAA 3VDAA 1XV8A 1OGSA 4M80A 3PZNA 2ESCA 3GBEA 1DWGM 4V27A 1VEPA 1GVYA 3IK2A 1J11A 3AIRA 4EKJA 1KBKA 4DM1A 2VNCA 1XC6A 3BAKA 1E70M 1LWHA 1M01A 3WDRA 1PJ9A 2W63A 4GZJA 1E5NA 3GNPA 3WQ6A 3BAIA 5HPOA 1EOMA 3AIUA 3ARZA 1E0WA 1EQCA 4QDMA 4DWSB 3K46A 1AQMA 1UKTA 2VX4A 1KWGA 4BZYA 3RMEA 5A6SA 4P7LA 1V6XA 4BQ5A 5BXTA 2JFEX 2WZHA 1E6PA 3G6MA 3AIVA 4RE3A 3WF3A 1V08A 4A3HA 5AC4A 2C0HA 3VIMA 5AC5A 1GQIA 4CN6A 3S6TA 3ZQ9A 1NOFA 5DEZA 1K9DA 3K1DA 1O7AA 3CUHA 5E70A 2G4FA 1FFQA 2VCAA 2XSAA 2JEQA 1G0CA 1E6RA 2WC4A 1JDDA 3AMLA 4P7NA 2E9MA 1V6WA 2DGAA 4D6DA 2W5FA 5IXEA 2EPKX 1PIGA 4J27A 2DT1A 4OBRA 3MSGA 3VGBA 4PTXA 1PEZA 1EHAA 2V38A 4UOZA 1NWSA 2J77A 2F61A 4TTUA 1E40A 3WENA 5E9AA 3W4RA 4PMXA 3K8KA 1E71M 5I23A 1ISWA 2BY3A 3I3EA 2NSXA 4ZXOA 1I75A 4AIEA 3VGHA 1GW1A 3VKKA 4CVWA 1J9YA 1GOIA 3MO4A 1HNYA 3CTTA 1UA3A 1E4LA 3TTQA 1W1YA 1YQ2A 2PBGA 2YA2A 1UWSA 3W38A 4AEEA 1I1XA 1KGXA 3PTQA 4BCEA 4TXEA 4UFLA 1NARA 3W28A 2YLLA 2PF0A 4PMUA 1AMYA 4PN2A 3B9EA 5BCAA 1CXKA 1NOWA 3WBEA 1NOUA 4A3YA 1R87A 4CCDA 1UD8A 5DO8A 2YIHA 1EQPA 1XCWA 2VRKA 2VZSA 4RE4A 3T2QA 2XVKA 3FHAA 3BSGA 4D6GA 2PMRA 4KH2A 1E1EA 1QI0A 2PWDA 1LL6A 3T2OA 3AMKA 3A4AA 3W6MA 3MUAA 1CXIA 1KR0A 2VOTA 2D0FA 1MXGA 2ZXAA 5A6BA 2WM0A 1B3YA 4CD5A 4KRUA 3WH6A 1EDGA 1UWIA 1CLVA 3MMDA 4PCSA 1EH9A 2D0GA 2WHJA 3CZJA 2VVSA 3OLGA 4IISA 4HU0A 1VF8A 2XM1A 1E6NA 3WNKA 4Z2GA 3AZTA 4JKKA 1WE5A 1AQ0A 4ATDA 4P7RA 1M03A 4UQAA 1FP9A 3QGVA 3WH8A 3J7HA 3MKKA 5DT7A 1H3GA 3WDQA 4J28A 5E0FA 3OLEA 4CCCA 1BYAA 3MMWA 3CZKA 1V3HA 2XSBA 2IUZA 2F2HA 1BYBA 2CETA 2VZOA 1B30A 4UFIA 3W29A 2XG9A 3L4VA 1B3ZA 3NSXA 1JGIA 1KXVA 1SR0A 4XV0A 5D9PA 3NDYA 3POHA 3WMSA 2XWDA 1C90A 3QOMA 3N13A 1TVPA 1HJQA 2E40A 4UR9A 1OT2A 2J47A 1B3VA 4X0VA 9CGTA 3MUZ1 3WQ8A 1H41A 2YL5A 3MV01 2QPUA 1LL7A 1K9TA 4Z2HA 3VO0A 4WF7A 5EMYA 1B2YA 1PZ3A 2X2YA 2BHUA 4J3WA 1BG9A 3PZGA 3HU7A 1W32A 2WW5A 3M07A 2HVMA 1CGWA 1HF6A 4HMCA 5A6KA 3CHFA 5IDIA 5AYIA 1KXHA 1V03A 4QLKA 2BNJA 1UR1A 1PX3A 4P7OA 2ZUTA 1VIWA 4FF5A 2VQUA 2YA0A 1TCMA 2CKRA 4Z2IA 1J0HA 1XCXA 4U31A 2XUCA 4MAVA 3BAXA 3VD3A 1LF1A 4GZIA 3T0DA 1E56A 2Y24A 1R7AA 2W66A 1K9EA 4JHOA 4CU8A 4EAMA 1OBAA 4JKLA 2JE8A 1QHZA 4R27A 3VOCA 2ZWYA 4W87A 4YHGA 3AIBA 4XX6A 3EDFA 2D3LA 4BA0A 1ZU8A 2G3JA 5FIPA 3L4XA 4QAWA 2J8GA 5D9MA 2J7HA 2WHKA 4CN4A 1EXPA 5LA1A 1C8XA 3W82A 3WDJA 2Y4SA 1AVAA 3GZAA 4FLSA 1LL4A 2YDSA 5ABEA 4YHEA 3L4WA 1JI1A 1UZ4A 1VJSA 2YBUA 4H7VA 5CGTA 2RGMA 3TA9A 4IPLA 2O9OA 4MB4A 1EDTA 1DWFM 3CMJA 1XYFA 1FH7A 4GPNA 2BVDA 4MB5A 3TTYA 2YDQA 1U33A 1JFHA 1UWQA 1HJVA 3WY1A 5LYRA 1UR9A 3TOPA 3CO4A 4P8WA 2UY5A 4PMVA 1TVNA 2ZX7A 1TUXA 5EB8A 3WD2A 2FHBA 3BGAA 4B15A 3FAWA 2WYSA 2X0YA 2CPUA 3B9AA 4H41A 4S3KA 4IM4A 5A94A 1WAWA 3VIGA 4OIFA 1C7TA 4AD0A 4L4OA 4D6HA 4OBSA 4N42A 1BLIA 2ZXBA 4HMDA 3BMVA 1KQZA 1N82A 2Y5EA 1KWKA 1LQ0A 4WKHA 4W88A 4F9JA 1WB0A 4B9YA 3ARQA 1BG4A 2BS9A 2E8ZA 4XUYA 2G3MA 1KQYA 4H8UA 3UR7A 2ZX6A 5A8PA 3ARYA 3VIIA 5HXMA 4HA1A 2X09A 1GHSA 3CZ8A 3SCRA 1OIFA 4UZUA 1JNDA 3WD1A 4W8BA 3RO8A 3ARXA 3SCPA 2VZTA 3VIOA 1WKYA 1M7XA 4AZBA 2NT1A 4AD3A 2XVPA 3CH9A 3VIPA 2VR5A 3GXIA 2D3NA 2QMJA 4C7GA 3LPPA 1XYZA 3VIHA 1ZBKA 4LYPA 2ZIDA 3PZVA 3VMOA 1E15A 1ITCA 5JIWA 3UETA 4MB1A 1V3KA 5FL0A 1W1VA 4CD8A 4ZFMA 3AYRA 2MANA 3AHTA 1ZS2A 1K9FA 1U2YA 2A3EA 1RPKA 3NJ3A 4CD6A 6A3HA 2O92A 2QF8A 5A2BA 2Y8VA 4AD1A 3MMUA 4EE9A 3SCWA 1BHGA 4HPHA 4PRWA 2VJXA 4PSRA 2CNCA 1DP0A 1HKIA 1GOWA 2Q8XA 3WN6A 3ARTA 1R86A 3GTNA 3NIYA 5C71A 1E9LA 2A3HA 4H04A 3RJXA 1RD6A 2CXGA 3BXWA 3I3BA 3GH5A 3GYCA 2OYMA 2FGZA 1GOKA 2UY2A 3T08A 1VFUA 2G3NA 2XWEA 3CUFA 4MDOA 3CHEA 1JZ5A 4X0NA 1VFMA 4V28A 3WNOA 3FY1A 1DWIM 4KGJA 2DT3A 4J3TA 2X8RA 2YL9A 5A3HA 3AI0A 3PBGA 1EHNA 1E6XM 4W5UA 4D6CA 1EIBA 1DTUA 2O9PA 2VX6A 4QCEA 5E6YA 3UG4A 5DT5A 2FDMA 1CZ1A 3O6AA 2WHLA 1UZ1A 2VR4A 1ODZA 1E6SM 5I0DA 4AW7A 1ZJAA 3AHZA 4PMQA 5BRQA 1V6VA 2YLAA 1DWJM 2BHYA 3K8LA 5BYWA 1JIBA 3BAJA 2ZXQA 3WF4A 1UWTA 5FCZA 2D24A 2ZE0A 2E4TA 3WDIA 1UD6A 1GNXA 1H2JA 3VVGA 4ZENA 1E4IA 1HXJA 2WVSA 3L4UA 4HTYA 4AZGA 4M29A 1ISZA 2J4GA 2WVUA 2OSXA 1NP2A 2NT0A 2VT0A 2PB1A 3BLKA 1JD9A 1NP0A 3CBWA 2YOCA 1EGZA 3VUPA 1H0IA 2WWDA 3OZPA 3WFLA 4F66A 4QLJA 5A69A 6CGTA 1CWYA 4M1RA 4XB3A 2PWEA 4CKQA 1JZ8A 2EO7A 1L8NA 3U7BA 2W67A 1QI5A 1X6NA 2OLHA 1TA3B 4QCFA 4WSJA 3N04A 5KEZA 5GNYA 1BSIA 2FH8A 3AZRA 3WL1A 2AOSA 4UCFA 5E0CA 4D6JA 1JAEA 4FMVA 3ZT5A 4D6IA 5A6JA 5CPQA 1IV8A 1PIFA 4UQ9A 2D1ZA 3NCOA 5JUVA 4JFTA 1IZJA 4TUFA 5E09A 2C7FA 5AYBA 4B9ZA 4ATWA 3OZOA 1JZ4A 2V5DA 3AMCA 2CBIA 2ZUNA 1TR1A 1V0NA 1NWRA 3KWXA 2GSJA 3WD3A 4J3XA 4BS0A 2OSYA 3M7SA 5A95A 1HKJA 3ARUA 4JHZA 5BROA 1EOKA 1Q4NX 1CBGA 4WJXA 3CLWA 2XTKA 1UKPA 3CGTA 3ZJ8A 2DIJA 3SCOA 3VDBA 3WEZA 3OG2A 5ABHA 2OSWA 3EDJA 1OINA 1QNOA 4ZEPA 3BH4A 3K8MA 3ZJKA 4GI8A 4AZHA 4U3AA 3OLIA 3GBDA 3EDDA 2J79A 1BQCA 1KCLA 4LGXA 1W1PA 5M3WA 2V3FA 4HPGA 3KZSA 4R5EA 2OYLA 3WELA 1VAHA 3POCA 4JFWA 2GJRA 3U7VA 4D6FA 2RGLA 3AXXA 1JXJA 3WKZA 4W7WA 1VJZA 2EPMX 1JYXA 4OOUA 5A1AA 2V5CA 1VENA 3N1AA 3MUY1 2A3BA 1GPFA 2FHCA 4M8UA 1QBAA 4JFUA 4PMRA 5A2CA 2TAAA 5D4YA 1HVQA 2J25A 3ZSSA 4OKDA 5DFAA 4AY1A 2EJ1A 2XIBA 2J8FA 1UD3A 2CBVA 1E3ZA 3VX1A 1OSEA 1CGUA 3FN9A 1CEOA 2YDRA 3UEQA 7CGTA 2ZUVA 2XGBA 1LLOA 4B3KA 1R85A 1GZJA 2XFYA 3N12A 4OZOA 3ARVA 2VVNA 2GJXB 4E8DA 2ZWZA 4MPKA 5A8NA 3QHOA 3EDKA 5CXPA 1FH9A 2EPNA 1PX8A 1OD8A 2OO2A 1UOKA 1A3HA 3VD4A 4JFSA 4ZE5A 1L0PA 1CTNA 3O9NA 3SUVA 2VURA 4WLCA 1SFSA 1S46A 3AIQA 1WDRA 2BXZA 1HKKA 5IHSA 3GDBA 2WANA 5BXPA 1X1NA 2WAGA 4OJYA 2E9BA 2D23A 3EMCA 2YKKA 1PPIA 3VX0A 3N18A 1HJXA 3SUUA 4W89A 3VD7A 2BHZA 3G6LA 5D8ZA 4MADA 1W3HA 3ALFA 3CHCA 3K4DA 2VZVA 2YJQA 2A3AA 5EFFA 2V3GA 2WSKA 5CPTA 1B0IA 1ESWA 3AS1A 1GUVA 2PWFA 3GH4A 3HJEA 4TX6A 1HP4A 3KL3A 2DEPA 2XPKA 4HZ7A 5LA0A 3WF0A 5BRPA 1FHDA 4ML4A 2O9RA 4U3CA 3SURA 1KBBA 2BY0A 3W0KA 1H49A 3KL5A 2J7EA 2Y8KA 5I79A 2E0PA 1G9HA 3ARSA 3SCNA 1MVYA 3U57A 1E0XA 1NWTA 1FHLA 4PTVA 3N17A 1FH8A 3FW6A 4LYQA 2DT0A 2XVLA 2CHNA 1NQ6A 1CXHA 2JEPA 5GQBA 1WNOA 3M6DA 1O6IA 3ZJ6A 1C8YA 2DSVA 1UH4A 2GFTA
chains in the Genus database with same CATH superfamily
1DJWA 4Z1CA 1XW8A 3UG8A 2VEPA 3CIXA 3ZVIA 2DUXA 3L2LA 3I4KA 2PD9A 1TIWA 3APTA 4IGHA 4AHOA 3NGFA 1LOLA 3A3XA 4PTNA 3VGGA 3ER9B 1WDWA 3ZWSA 5HDRA 3L2IA 1DVJA 3UU0A 4L4PA 3KEHA 1OWQA 2E25A 3IJ9A 3THDA 4QP0A 4HHMA 1IWAA 3IJ8A 3FYYA 3D5HA 1RBOB 3NQBA 4FX8A 4H6HA 3EBVA 3ME3A 5CH9A 3FJNA 5FJRA 3O3MB 5C8BB 4NAFB 3ITXA 3ZT7A 4LUJA 2ZA1A 2OZTA 7XIMA 4MWAE 3SDOA 5JH2A 4CNUA 2B4GA 4O4WA 1Q66A 1UKQA 1W2VA 3WJZA 4NRRA 1DTNA 4NNCA 4YTQA 4EZWA 2F7PA 2V5KA 1S5NA 3FAXA 3V0SA 1ZBVA 4QG8A 3UNDA 3F7JA 2ZX8A 5BMWA 1VBJA 1WOAA 1AW2A 3ALGA 3OA5A 3WNNA 3S2MA 2GWGA 5E9XA 4ZOAA 2QNEA 5DN1A 3OU8A 4RPQA 4HMEA 4DWSD 3S83A 1UC4A 5BOOA 4UTTC 4LBSA 4LAUA 3S1XA 4B5NA 3B8SA 3MA8A 1GCYA 1HN1A 3CUGA 1B57A 2DSZA 4U2ZA 1L6SA 5FAJA 4GXWA 3BJSA 2WYHA 1RUSA 1XFCA 3C7NA 1IWBA 3MY9A 2X3XA 3VXGA 3MBFA 1YTDA 2FZDA 6ALDA 1QNSA 3GG8A 5EYWA 1BKSA 4QFUA 2DSUA 4OBTA 3B8UA 4BJHA 4IFRA 4AFYA 3STFA 3DHUA 3DI1A 4M19A 2QCDB 4O19A 1E1CA 2BY2A 3DFYA 1JNEA 5A6MA 1QVBA 2EBNA 4HOZA 3UPWA 4HP5A 4N0RA 3BG9A 3BOXA 4I8DA 1US2A 1XLLA 3G1FA 3VZXA 1TJPA 2VDIA 1I49A 1R5YA 2E9LA 2QCHA 5CJ5A 4A22A 4AX7A 2VFFA 1M04A 3QNIA 2ZADA 5HOSA 2F84A 3WH9A 5A6LA 2VCCA 1WV2A 3WBYA 3AXMA 3CV7A 5A2AA 3H21A 5EKYA 3AISA 3KTCA 4AB4A 3QR0A 5G4WA 1EF3A 2V8ZA 4IPNB 2ACSA 4KCWA 3STPA 1HGWA 1V3LA 1R34A 2QJHA 1KCKA 2XFFA 5AHNA 2QDGA 4ERIA 1MNZA 4FNQA 4H6EA 1RAKA 1V0KA 2Q01A 2ZA2A 2ZUMA 4UDYX 1UD4A 4JTKA 4A3UA 2HCVA 3U5YA 1XD1A 4J5NA 2REQB 3FA5A 3AICA 5TF0A 1TO3A 1E3XA 3UCDA 3NL6A 1XM3A 1E73M 2E5CA 2JIWA 3DU0A 5I24A 1TA3A 1UPMB 2CERA 5FEWA 2I57A 3C56A 3T40A 4M51A 3B8VA 3TFCA 1FWIC 3PZ9A 1KRAC 2Z0NA 2QVNA 3ARPA 1RK6A 2G4JA 5T91A 4NQ1A 2AGTA 4Y8EA 3BC9A 3OTRA 4U4MA 1BVZA 1W9VA 3OYXA 4XIMA 3QZAA 2JNKA 1E0VA 3SCUA 4AAJA 4BWLC 3CO8A 1CECA 4EZUA 4KS0A 3WF2A 1E6ZA 4MSSA 1YKWA 3G1SA 3N3TA 2QMKA 2J8TA 3F2BA 1LTDA 2VX7A 4AD5A 3SCVA 2BODX 2ZZ4A 3N2XA 4UFHA 3CZEA 3NO5A 3I6TA 3LCWA 3TQKA 2B31A 4G8TA 3GIQA 2CU0A 1E55A 1SR9A 2WJZA 2AQWA 2I14A 1R0MA 1LROA 3TYCA 1WCGA 3TIMA 3CIVA 4L56A 1WZAA 1YDVA 4PH6A 3QXBA 2DW6A 4O50A 2ZA3A 2HQAA 3IVTA 2GK1A 4LCRA 3OVPA 4UFKA 2QHAA 4B5XA 2Z2BA 3WX7A 1O5QA 1T7LA 2R1LA 3NQMA 4GYKA 1BRLB 2JF6A 2RDXA 3KX6A 5I7GA 5J8LA 1W9MA 1SM9A 1PE1A 1YEYA 1HG3A 1RP9A 2X5CA 4IUGA 4H8VA 1KGWA 3FCPA 4JX5A 1JG9A 3PN8A 1TMHA 1C8VA 3TXVA 2ON3A 1JDEA 4PUJA 1WP6A 3LHYA 2OELA 1DIOA 3C4UA 4G1NA 3KL0A 2IPFA 2OWCA 3WLLA 4ILSA 1W3IA 4AX6A 4AVMA 1TX2A 2VRQA 1W6TA 1H62A 4IOTA 2VL4A 4XD5A 4R5IA 1SVDA 1LLWA 3NSNA 3ITVA 3GR7A 4U28A 2JIEA 1BVWA 4EX4A 3QLLA 2C71A 3MYOA 3PZQA 3BGJA 2GJXA 3QEZA 1QNQA 2OO0A 2ZRWA 3IWPA 3C52A 1SYTA 2EG8A 4O15A 4DJEC 3GE7A 4AC1X 4U2YA 1I0BA 3BCFA 3M0KA 3VI2A 4JTJA 4QAIA 2AMXA 3OK8A 3TP4A 1Q6GA 1PTGA 3JU2A 3S6OA 3TKFA 3V5FA 5I77A 1W0MA 1PIIA 4K6AA 1P0KA 2ZUWA 1VEOA 4FZPA 4JOMA 1J12A 3OZMA 3V4BA 3HMCA 2DH3A 2TPSA 2WMFA 3TFXA 2P53A 3O0FA 1ZUAX 1ZP4A 4MLJA 1H50A 2VFEA 1DJGA 1XCFA 2VWTA 2Z27A 2DJXA 2XVGA 1US0A 2QV5A 3VOHA 1WZLA 4FLOA 3KUMA 2DIKA 2VO5A 4R85A 4S1FA 3F4WA 3QGAC 4G6QA 5REQB 5I3JA 4GQRA 3RRAA 2E6YA 1Y2OA 3GX9A 1IXOA 1LUCA 2E3ZA 1EKOA 2Y2WA 2FB2A 3T0AA 1B3XA 1CW2A 3E49A 1LRNA 3O6DA 4E4FA 1P4CA 4RL3A 1IR1A 3T2PA 5DANA 4K3ZA 3WUEA 4UNKA 1UKOA 1DV7A 1JDCA 1UUMA 4JN8A 4QISA 3BVVA 4E2OA 3KLLA 4GIRA 2G8ZA 1R33A 1BPLB 1PUDA 4EZZA 3S1UA 4J7RA 1EIXA 4H3DA 4CNOA 3RF9A 1BEUA 2PGWA 3RM4A 1OX4B 2X30A 5FJPA 4UQCA 4NF7A 4LSBA 4M7SA 3W1AA 2VEMA 3WNMA 1UG6A 3EJRA 4Z2LA 4WKFA 4WXZA 4D8JA 4D72A 3SN4A 1R2TA 1H7WA 5DCBA 1ZZMA 4GH3A 3ZR5A 5M17A 1LWJA 3P6LA 2EQDA 4UTFA 4C5ZA 4NSBA 1CX9A 3FDGA 2FHFA 3RU6A 3KRSA 3AC0A 4A35A 1DHKA 1UD5A 3VNYA 1XH1A 2VKZG 3BO9A 3IGHX 4IL0A 5LSMA 2GGHA 1T5AA 4R53A 3DX2A 4D2JA 1BF2A 1WKDA 4M56A 1FBAA 3BMXA 4UDXX 1DQUA 2Y7FA 1WOBA 1X39A 3TN5A 3CWNA 3BMWA 4A8IA 3S5ZA 1KRBC 4JTTA 3UZZA 4IZGA 5LHFA 3RILA 3E96A 2INZA 4GE8A 1Q6FA 2OZ3A 1FWDC 1SO4A 4K7YA 2VQTA 1RSCA 4WIWA 1CGTA 2A79A 4S3JA 3DX3A 1QHOA 2WMIA 2BXVA 3DECA 1G67A 4HK5A 4GYPC 1K7XA 2QCNA 4E4PA 2D2OA 4DXKA 5CGMA 2HXUA 1J0KA 7ENLA 1F4HA 1EJSC 4EOUA 2UWFA 4IMAA 4EZNA 2GVEA 4HPNA 2EPHA 3L21A 1D2KA 3DZ1A 1GJWA 1F74A 2OT0A 5JU6A 5ECUA 1RQEA 5F7UA 3TCSA 2JALA 1US3A 3SZ8A 1HJWA 1YDOA 4CEXC 3BAWA 3HTWA 2DSWA 4JDYA 2FGLA 1VFFA 3N25A 3N6JA 1RY8A 3GU1A 1J0ZA 4YYFA 1C7SA 3W83A 1LT7A 3EJSA 2PDKA 4FPSA 4RE2A 5BXSA 2G95A 4GISA 2RJHA 3QPZA 1SQ7A 4P61A 4HOXA 2G41A 1B90A 1VBUA 3I39X 2PSNA 2E28A 5CC3A 1TPEA 1JUKA 1FWTA 2VTFA 4JS3A 4NYYA 4F01A 3M7WA 3PZIA 1XSJA 4CCEA 2QIIA 2CXEA 1I4LA 3N9RA 3RN6A 2PDQA 3AS2A 4TO8A 4MUPA 2J27A 3HG4A 4GVHA 1XGDA 2EGZA 3FGCB 1W17A 2Z4GA 5HWMA 3EKZA 4L6HA 4DM2A 5DMLA 3E9AA 4AZCA 3C61A 1S2UA 4R7OA 3DDGA 1VRXA 3WDHA 3B0YA 4ZXLA 5D9OA 3WQ4A 4CCZA 2QUMA 3WLTA 1OCBA 2J7GA 3GUWA 4TMBA 3U8GA 2RHGA 3PBWA 2TSYA 3W6LA 4MWAC 1JF6A 1TUFA 4TVUA 4DEFA 3ZOAA 3IJQA 1F76A 2OB3A 4HKPA 2UBPC 1W5QA 3AWNA 3PJWA 3R7MA 3L4YA 3AFBA 1EP3A 1G69A 3JW7A 5GNZA 4GY0A 1UCWA 3TTSA 1JPHA 4FAMA 1UMYA 1SW0A 1E0TA 5IHRA 2BV9A 4GKLA 5HBFA 2ZTJA 4DZ5A 3Q37A 1JCLA 5XIAA 3MTWA 3VKCA 3GXPA 1IWPA 3GXNA 3OLDA 3GZ3A 3GAYA 3LGDA 2A3CA 1QNVA 1GG0A 1UUOA 5CG7A 3AHVA 5C9UA 2QDDA 1B1YA 3MP3A 1TWZA 2EF9A 4EXBA 1C92A 4W8AA 3N15A 4I7VA 2HE8A 4AIUA 2FQIA 1DWAM 1SUXA 8CGTA 3R1ZA 4NAEB 1KBIA 4EZRA 4AZ6A 4X61A 3PJXA 1OFPA 4GUGA 4EXAA 3U0HA 2GF4A 3THQA 3TYUA 3HGJA 4LBUA 1I8JA 4JWDA 2BWGA 4YCPA 3A12A 4XZBA 2XH0A 3F4VA 2OCZA 3CZSA 5CLTA 3RR4A 4CVUA 4HCDA 3G8RA 1SFJA 3ABXA 3GVRA 5K9XA 3KHJA 5IFPA 3FJ4A 1R7OA 4DWSA 5JBFA 3H2AA 3V75A 1NIUA 3MSDA 5I09A 2WCAA 1ZJIA 1UH3A 1EO7A 2GJNA 1JYNA 2F8QA 2G50A 2WINM 1JZ2A 3MUIA 2GUUA 4H8HA 3W2MA 5BU6A 4QR6A 4J2PA 4H1ZA 5BNKA 3BCDA 3CQKA 2HVOA 1G94A 1XGZA 3HPSA 4F9DA 7PTDA 4WGHA 4DX3A 4QITA 2V3EA 2G37A 3VIJA 4MYAA 1E5JA 1V77A 1P7TA 4ACZB 2Z24A 3AIWA 1DQWA 2OO6A 3K2GA 4MNKA 4RLIA 1KC7A 1ALDA 4GC3A 1V6YA 4DUWA 1M7JA 3RRXA 3C2FA 4MKVA 4PBEA 2NQ5A 4DQWA 3WLQA 3QY7A 3GBEA 4HNLA 4V27A 5K3VA 3KWSA 4IJRA 2ND1A 3T42A 2A7PA 1GVYA 3DUGA 2CLMA 3IK2A 2P50A 4EKJA 3SQLA 4DM1A 1DHPA 2NVDA 1CB2A 1PO9A 4HZMA 3WDRA 2ISWA 3WQ6A 2PTWA 4RPPA 1EOMA 1QR7A 3KOWA 4HR1B 3K46A 2PDBA 1G7VA 4LB3A 3KFTA 1RVKA 3UVAA 1XX1A 4P7LA 3G8EA 1YYAA 3G6MA 5FAGA 4ZMGA 3P62A 1V08A 5H1WA 4DBDA 3R10A 2C0HA 1TR9A 5ECVA 2QR6A 3OOQA 3T48A 3WJWA 4FB7A 3S6TA 3CYVA 4PE8A 1NOFA 3CUHA 3N6QA 4FXSA 1E6RA 1JDDA 2CWNA 3TSDA 3SQSA 2E9MA 4FNRA 4I9TA 3K30A 4JIHA 3EEZA 1Z44A 3GK0A 4J27A 3DHDA 1PEZA 1EHAA 1J93A 4UOZA 2F61A 3BW4A 1K7EA 1OABA 3GTIA 4PMXA 3SGUA 3TR9A 1GEQA 1EWDA 3D51A 4G1KA 2F9RA 2BY3A 1EGVA 3GNDA 3D50A 2CHRA 1XRTA 1G7UA 4QJ1A 3VGHA 3VKKA 4AIEA 3KRZA 4CVWA 1PHQA 1GOIA 3CS2A 3NO3A 1R47A 3EA3A 2Z29A 1Q6RA 3NPUA 4DZHA 2PGEA 4XISA 4R33A 1YQ2A 3WQFA 2A7RA 2NUWA 3NTYA 3NQFA 4F3HA 3RAOA 4AEEA 1SZGA 1I1XA 3BUVA 4N2YA 3I01A 2YLLA 2PF0A 1TSIA 3TMQA 5G4EA 1AMYA 4O12A 1YXYA 4RJEA 1M3UA 1NOWA 3FV9A 3TK7A 2YIHA 1EQPA 1PSCA 2DU2A 3UGRA 1SW3A 1XCWA 1WUFA 2VZSA 1XLAA 3L68A 4E4UA 5K9DA 2PWDA 3DOPA 1A5KC 3A4AA 3W6MA 1CXIA 1KR0A 2VOTA 2ZRXA 4TV6A 2ZXAA 5DY2A 4F2BA 1M9HA 1PKNA 4KRUA 5CZJA 3SR7A 2QUUA 3GD6A 3HBLA 3HIJA 3MMDA 3UZJA 2QGYA 4YTRA 2D0GA 2Z1XA 3CZJA 3N2OA 3OLGA 5AZ1A 1F8IA 3HG2A 1VF8A 3N2TA 5LIYX 3G0UA 4Z2GA 4UNLA 4ZQPA 1WE5A 3UWYA 4F0SA 2ZZ5A 1M03A 4IGNA 4PB5A 2V9DA 4H6QA 1AH4A 2ZC8A 4LRTA 4E0CA 3TEVA 1FWBC 3W7EA 5E0FA 1ZTVA 3CZKA 3CQ0A 4HTBA 3R11A 3VE9A 4GZ7A 2IUZA 2VZOA 3LHVA 3W29A 4HSHA 5F4SA 3DDFA 3VEBA 3DGBA 3MPGA 5BU9A 3UQNA 2ZRYA 3NSXA 3POHA 1W54A 3HAIA 1C90A 3N13A 2Z25A 1IHIA 1B3VA 3WQ8A 2AQOA 4UC5A 4LY4A 5EL1A 3WQDA 3DFQA 2XH7A 1AW1A 1NF0A 2R94A 4NL1A 1PZ3A 3L12A 4AVOA 4DBUA 4J3WA 3NM3A 4R5KA 2VGIA 1KCZA 3KTXA 1DJQA 1U00A 4ZSUA 5HR7A 4ORIA 4JIRA 2OPJA 2IKIA 1DE6A 2QULA 4QLKA 1ADDA 4NJJA 2HNEA 2ZUTA 5KMYA 1FX6A 1OQFA 1TCMA 4J4KA 2EFKA 1X8CA 1GZGA 3W75A 1J0HA 1XCXA 4J1OA 3VZZA 2Y5JA 2X1RA 3ONBA 1ICSA 5K9CA 1RA0A 1E56A 2W66A 4CU8A 1NVMA 4EAMA 1OBAA 1QHZA 2CLHA 4R27A 3S2LA 3VOCA 3BW3A 4ZTXA 2V63A 5I03A 4PGLA 1ZU8A 3WG6A 1A5OC 4XZ9A 2J8GA 2CZDA 1PL9A 5LNRA 1TYGA 2FJKA 4ZL1A 3L3PA 3W7GA 4FLSA 4ZO6A 5EPDA 5PTDA 1LL4A 3UYCA 4NIRA 4AEOA 4RZ5A 3EWCA 3R8GA 4DI8A 1JI1A 4XBJA 3A4JA 1P6CA 2RGMA 5D2TA 4MFEA 5I3KA 4IMDA 2O9OA 1VRDA 4MF4A 1A4MA 1XYFA 4YIWA 1FH7A 3BK0A 4GPNA 5D33A 4NXKA 3QQ1A 1HJVA 3LTSA 5LYRA 4RDZA 3CO4A 5HWNA 4PMVA 1TVNA 5H6HA 5EB8A 2FHBA 2OXNA 3GXTA 3FAWA 4FIQA 2WYSA 3V0TA 2X0YA 1IYXA 3B53X 3EXRA 3M0VA 3UWVA 4KPLA 4EZXA 4OTKA 5FF3A 4CLMA 2Z7KA 4IM4A 3EKGA 2XU2A 1J5TA 4UTIA 2YGYA 2H9AA 4O1FA 3P14A 2NZLA 2CZ5A 3KDOA 3B52X 3OVGA 3CHVA 4HMDA 1KQZA 4YTUA 4JNEA 4WKHA 4F9JA 1ZAJA 4HU4A 1F7BA 3TNBA 1FWJC 1N7KA 1IGSA 5IBXC 5EMMA 3UR7A 2ZX6A 1I6NA 1XYMA 2F6XA 3CK5A 3VIIA 4UZUA 1JNDA 2CLEA 1XC4A 1V5XA 4MJMA 1I9CB 2OBLA 1FWWA 1X8FA 3RO8A 3SCPA 3LTYA 1EBGA 4I7WA 4MPQA 2W27A 3BARA 1QPRA 5H91A 1GPWA 4S2CA 1W31A 3RLVA 2NLYA 4R3UA 3GWQA 2P10A 2BGQA 4WDTA 3U3HA 1XYZA 4JNZA 4IXXA 1Q2SA 2OU4A 5FF4A 1J96A 5C54A 1ITCA 1QMLA 2VC5A 3TNOA 4RV3A 2QKWA 3PBVA 4KIKA 5FL0A 1W1VA 3C3NA 4NG3A 3U9IA 4HHHA 4A3QA 3DI0A 2A3EA 2FPVA 4GJIA 3MI2A 1YW1A 4G6CA 1GN9A 2XSXA 3PUEA 3DKJA 4AKVA 4NJKA 3M0LA 3SCWA 5HQMA 1E9IA 4PSRA 3DPOA 3N4EA 4ZFCA 1HKIA 3I7RA 3QBUA 4C1LA 4C6MA 3ARTA 1YBQA 4ZQNA 2J66A 3DXIA 5EA9A 4H04A 2X0SA 2YYTA 2CXGA 2IKJA 4LV9A 1JULA 2OX1A 3PS7A 1AG1O 2OYMA 3T08A 2VEFA 2XWEA 2PAJA 3PUDA 4GXMA 4V28A 2WKJA 1JCMP 5HJLA 5A3HA 4D6CA 3ZEDA 5C5BA 1QDSA 4XZIA 2OOGA 4HB7A 4QCEA 2FDMA 1CZ1A 1V79A 1D3HA 1VP5A 4XIAA 2VR4A 4NYUA 1ODZA 5MHBA 4YXGA 2Y7DA 3QYSA 3URNA 5BYWA 3T55A 3AU6A 5FCZA 3GVGA 3WDIA 1UD6A 2FVKA 1DKYA 1R46A 3L4UA 4AZGA 4M29A 4ZBCA 1NP2A 3L9CA 2VT0A 1ZLPA 2PB1A 1NP0A 4JPGA 4ZCWA 3CBWA 4JTHA 4M3PA 3A9IA 3AALA 1FWFC 5KTLA 2RJGA 3CTLA 2B7PA 4B91A 1H0IA 1PWLA 3GG7A 2WWDA 3OZPA 3Q65A 3H26A 2Z6JA 4M1RA 3RU8X 2F7OA 1JZ8A 3B9NA 2AKZA 2EO7A 3EWYA 4DPPA 2W67A 4DXXA 3IS4A 1VBGA 2OLHA 4AHQA 3BPWA 4M7TA 3N04A 4C5YA 3H2MA 2DVTA 3ITCA 1EP2A 3AZRA 5TKYA 3D46A 5E0CA 2J88A 1JAEA 2CLOA 3A3WA 2NV1A 2PFHA 3O6YX 4NHVA 2YW3A 3NCOA 1I4NA 4B5WA 3EX4A 3LBCA 1IZJA 3ZYZA 1I0DA 4TUFA 2C7FA 2ABBA 4B9ZA 2V5DA 3AMCA 1ZALA 2CBIA 5TAOA 3PAJA 5E0KA 3ABHA 1NWRA 2PDXA 2X3WA 2WJDA 5A95A 4ADSA 4JHZA 1EOKA 1TE6A 3LEPA 4PULA 1UKPA 4AHPA 2DIJA 3E3HA 3R0DA 2OSWA 3VCNA 1QNOA 3IGUA 1GTHA 1W8GA 3OLIA 2I17A 3GBDA 3K13A 4B5TA 2J79A 1BQCA 1KCLA 1Y8BA 1F8MA 2NQJA 1R9ZA 4ICNA 3H2OA 3H2FA 5HNTA 5M3WA 1SSGA 2C1GA 3KZSA 4R5EA 3A98A 4WRHA 3SI9A 4DAIA 3PJUA 4MGGA 3RCYA 3B51X 4M0MA 1PKMA 2GOUA 2GJRA 2V2DA 3U7VA 2RGLA 5C2CA 1TQTA 1JXJA 3WKZA 4W7WA 1VJZA 3OVRA 1OHLA 3H24A 2PA6A 3RLHA 3D2FA 1XWYA 5HA7A 4BHYA 1IEWA 2TAAA 3EOLA 3SGGA 2W9MA 1T41A 4MWAB 2YZ5A 2XIBA 4UBPC 1XIMA 4IWQA 1RQHA 1OC5A 3G1VA 1YNQA 2CBVA 3JR2A 3W7KA 3S1GA 3KOXA 3P8JA 4KCUA 4HCHA 5IM51 3DDMA 4UWMA 2IKGA 4FA3A 3UJ2A 1E2UA 4J3ZA 3USBA 4G7EB 3M0IA 4DJED 1OFRA 5CBIA 4JTAA 2ZWZA 4LFYA 2F18A 1RQBA 4N9CA 2QW5A 3EDKA 3CV2A 5CXPA 1QWGA 2IQDA 4JFSA 4JL9A 4HY9A 2VURA 4WLCA 4C6NA 5K2ZA 1P48A 4PFMA 1JGMA 3OIXA 4QEHA 2IPGA 2WM1A 1S46A 5F1VA 1W1A1 5IHSA 3LMZA 4JYFA 2QIWA 1TPDA 3W7OA 2X1UA 2D23A 5AECA 4GX8A 1TX0A 1W1ZA 2QEZA 3CV6A 3VX0A 4W89A 4JTQA 3N73A 3CC1A 1W3HA 1PHWA 3FJ6A 3K4DA 5EFFA 3G24A 1SU6A 2EWFA 1ESWA 3WQGA 5B7YA 4ML9A 4I8YA 1TQJA 3PP7A 4NT0A 2DEPA 3KHDA 3IV8A 3S3GA 1FHDA 2O7SA 4ML4A 5BRPA 1KBBA 3SCNA 5JVLA 4DYKA 4PTDA 3U57A 1FHLA 1EFZA 4PTVA 3GVWA 1IEIA 1FH8A 3NXFA 2TMDA 3U2EA 4XD4A 2XVLA 4IM2A 4GBDA 1CXHA 4ADUA 3UZYA 3UWZA 4AVNA 3LBMA 3ZJ6A 4IIGA 2DSVA 2GFTA 4FZIA 3KAWA 4WKAA 1UWAA 4C6QA 3HQNA 2J75A 2VCBA 4PR4A 2O0TA 1A80A 5BOFA 3KBNA 1IEVA 4LYKA 3S2CA 1RV8A 1FDZA 1VLIA 5JBEA 2FZ8A 2PGFA 4H9MA 3CUXA 2QPSA 1DIKA 3H55A 2JGQA 2FMOA 2PI6A 2WMHA 1MQPA 1G5AA 1BSLA 1N2VA 2BVTA 1GKPA 2WHMA 3DG3A 2NV2A 1NDYA 4B3ZA 2Q6ZA 1O66A 3NAVA 3W87A 3EJTA 2CHOA 3O1NA 1ZBCA 3UWUA 3RM9A 4LRSA 4YWSA 1F6PA 1RY0A 3R8RA 5T8GA 1REQA 1M53A 2X1TA 3QYQA 1NH6A 3A6OA 2INEA 3CAVA 1X96A 1B31A 1VB9A 3P84A 4P2VA 3MU7A 5CAHA 1RP8A 2E09A 1I60A 3IRSA 3ZIZA 4DNMA 1OY0A 5CBJA 4F0HA 7REQB 3RV1A 3O2LA 4NILA 3DESA 2J6XA 4ZO8A 4AYGA 1W9XA 3N4AA 3NSMA 1EJXC 1R38A 2J24A 1XL9A 3LYEA 5CZKA 4OE7A 4JCLA 1XIBA 2Q3OA 9XIMA 3CT7A 3S9ZA 3WBAA 5HMDA 5DMMA 1V7YA 4CQAA 4FLRA 4PBFA 3P82A 4H2CA 1NTHA 4K7VA 1YPXA 1YXDA 4D6EA 4CEUC 3WH5A 2VGGA 3R25A 5FF7A 1O7DC 1ITQA 3UD6A 1ECQA 1M7PA 4BFAA 4O17A 4L1GA 1XQKA 2WLYA 1UR4A 4A05A 4HSNA 1OA1A 4E8GA 3FNDA 3SCSA 1W37A 1A3WA 4L9YA 1KM1A 2PDPA 4JFVA 5K7JA 3NQCA 4FLQA 2R6OA 1SZRA 2BY1A 2WZIA 4P7QA 3CEUA 4C7DA 2E6DA 1W9UA 2DIEA 2YCEA 3R79A 1MWOA 2DZWA 2TRSA 1ME7A 3M46A 5KINA 5GJMA 3FSTA 3VC6A 1FQ0A 3TE9A 3VABA 2WB5A 4XSLA 2I56A 5G1YA 3AQUA 4UMBA 2R8WA 3UW6A 1W5PA 1TPC1 4WDWA 3GFXA 4P8XA 3VGFA 3VNDA 3LLFA 1GORA 4CQCA 3PULA 4S3AA 4URIA 1CIUA 4O14A 1QW7A 3ARRA 3VPLA 1QNPA 3H4XA 3SRDA 1M41A 4JYDA 1V3JA 3OHIA 3GXFA 3ABZA 2DQXA 1P0EA 1QBBA 3M1ZA 1BWKA 2XFWA 1SFLA 3PG8A 4O28A 1C3FA 4O0QA 1XINA 3DBNA 5FSDC 3QSRA 1H1ZA 1QRQA 1MNSA 4LX4A 2AKMA 1FFRA 3IANA 4MWAD 4O1EA 2CLIA 1KFJA 5CZ0A 1JRBA 3O6CA 5GNXA 1F61A 3KCOA 4X22A 5D05A 3W9ZA 1E1CB 3P93A 4X63A 1AQHA 5TQLA 1LG1A 1P6WA 4DUOA 3H70A 5LA2A 4K38A 1XKYA 1XBXA 1QPQA 2W79A 2BG5A 2OQHA 2X42A 2WVVB 3CNYA 2G0WA 1UC5A 4P8VA 4YVVA 2OLSA 4PUDA 4IX0A 3VTRA 3WFZA 3NQ2A 2J7BA 3WLRA 4X2RA 3I3DA 1Z3NA 2FPYA 2QF7A 4ZVJA 3VNJA 1KFLA 4XZLX 3KS5A 2Y0FA 2GZXA 1BAGA 1E72M 1XHGA 2ZDSA 3O8AA 4CNNA 3WLOA 1JPDX 3BGGA 1L2UA 5HNRA 1VEMA 3VGEA 1O12A 1HTIA 2ZVRA 3AYSA 1Z41A 3IIPA 2DSKA 2CITA 4PCFA 4YTTA 1A5LC 3EB4A 3BUBA 4Q4QA 4IMCA 3AJ7A 4HNVA 2ISFA 1XSKA 5LNWA 3QFWA 3R13A 3M5ZA 3QR1A 3TJIA 2W6RA 3W73A 3PHAA 1HX0A 3PTKA 1BXNA 3GNRA 3GXMA 3MJYA 1ZY9A 2P3ZA 1XH2A 3H8AA 4KGLA 2WPGA 4PODA 2E67A 3FDKA 1FVPA 4AD4A 2HEJA 4PB3A 2IKHA 5A6BD 2PRLA 2VC9A 1Z9AA 1M65A 4GK8A 4E2VA 3PBMA 4BQ4A 5I06A 2Y61A 3LZ5A 4R9XA 3BVTA 4AYSA 1HXKA 4GY7A 4Q6JA 1VFHA 3MC5A 1UZHA 4L4MA 1O95A 3RDKA 4Z42C 5F2LA 3ENLA 1VYPX 3PPCA 4WJEA 1MYRA 3D4ZA 2AQVA 4MNLA 2X40A 3CUIA 3QHMA 2B7QA 1IE7C 2QCGA 1GJPA 1TPFA 2ZCGA 3VE7A 5DX7A 3VDHA 3VM7A 1W9DM 2RAIA 1KM6A 3GR8A 4KWUA 3PAOA 2WZTA 4ZQCA 3TW6A 2A85A 2GUYA 3V1HA 3B4YA 3QPEA 3ZSTA 2GK1B 2PP1A 3N3MA 1GQKA 1F3WA 2PRMA 3WMCA 3II1A 5CPOA 1AFSA 2ACQA 1PYMA 4Y9PA 4E3VA 3T0TA 4FOKA 4WD0A 1YADA 4D1IA 4H9VA 1QPKA 4H6RA 4ASTA 2VELA 3C5QA 3MHGA 2J7DA 3NG3A 5A8QA 1CT5A 1CGYA 3QZEA 4LY8A 4GVIA 5AVNA 1LQ7A 4ZO7A 2WO5A 3LS9A 8TIMA 2QDHA 5I2UA 5AHFA 1FHUA 2D20A 3VDCA 1E4MM 4C1NA 1T40A 1J01A 2GL5A 4N9EA 3BZJA 3ABOA 3CXOA 5F2IA 4WSKA 5BXRA 2ZICA 2X41A 1TV8A 3A22A 4LNYA 3L5LA 2HS8A 2QLYA 3CMGA 4DF1A 2E8YA 2NQHA 3QW4B 3LDVA 4I9JA 3NZRA 4EANA 4DZAA 1CXEA 1R5EA 1MO0A 4HVXA 3QRHA 2V67A 4CNTA 4A2RA 2Z7GA 3ATZA 3R0KA 5E6ZA 2MUCA 2OW6A 2ATSA 3CL7A 5LXXA 3HURA 2NUXA 2ABAA 2BOEX 2D69A 3JZEA 1I2QA 3HO8A 1DJHA 3L65A 2WC3A 4PUNA 5FJJA 3EOOA 3UERA 4FNSA 4JN6A 4GA8A 4U33A 3P0XA 1GT8A 1WDQA 2A0NA 3AU2A 2OTDA 4LW7A 4UTHA 1MEIA 4XO6A 1I4TA 1PAMA 1ELSA 4KFPA 3CWOX 1VYSX 1FA2A 2A6NA 1SFTA 4C6OA 4GUHA 3GDRA 4NAFA 1X38A 3N9KA 3EWXA 4WPCA 2H6RA 3I04A 3HGSA 4GO8A 1SGJA 3BLFA 2GSEA 1HIZA 3G3MA 2FFCA 3WQEA 4DUVA 1XLMA 2OKOA 4JL2A 3JS3A 3ZJ7A 5AHEA 5FD0A 4FALA 1PZ2A 1JZ7A 4ZODA 3AXHA 4TVDA 1LUCB 3MV11 4JIEA 1LJYA 1FWRA 3QTPA 3LLDA 5HAOA 5J5RA 1V6UA 3LXAA 2TYSA 3NUKA 2UV8G 3PBUA 3P5ZA 1YLVA 2BXYA 3WK1A 2VOMA 3OGVA 1UASA 5LZLA 1ONXA 4WDUA 3BTNA 2EXOA 2H3DA 3P3BA 1ZB5A 3O06A 1LZOA 1D8WA 1DWHM 2VC6A 5FF0A 1Q6DA 4XWUA 3MWCA 1KM0A 4ZOBA 1W91A 1G01A 1FHVA 5GJNA 4PB4A 5IRPA 1JPKA 3O05A 3ZMRA 4TMCA 2ACUA 2EX3B 4H9ZA 4W85A 1MZRA 2Z2AA 2ZRUA 2WJEA 4F00A 2VWSA 3SADA 4G2DA 4H9YA 4O0ZA 1H11A 2CWXA 1NDZA 2PTXA 1V4YA 2PU1A 2D0HA 1X7FA 3PZOA 2F6KA 3EWUA 1XG3A 4LB4A 1LG2A 3IUDA 2WMKA 1EYEA 3QV6A 4UQDA 2OQYA 2PDGA 4JEQA 4XKYA 2AAAA 5CSSA 1OADA 3LHWA 1MEWA 1XPYA 1Z42A 4M82A 4O4VA 1UR0A 3R0UA 4DELA 2Y63A 2ONEA 3QKZA 5AC7A 1UP3A 3ZLFA 1GQLA 3NFUA 4GUFA 1JD7A 4MY9A 5D32A 2WLZA 1QI4A 3AXIA 4H6KA 2DZVA 2SFPA 1A5BA 3IARA 1GQJA 2DZTA 4Q4KA 1B9ZA 1LBLA 4GYFA 2YCKX 5CPSA 3K4AA 4WOQA 4FHAA 2VC7A 4QQUA 4FOJA 3NOEA 3STEA 1MW1A 2REQA 5I02A 1FP8A 3IAPA 5U7SA 3U5UA 4KWVA 4QX4A 4UUIA 3W84A 3E38A 1FOBA 2I5QA 1JJKA 4LAZA 3N11A 3BLPX 1UUQA 3H7VA 3AROA 3GC2A 3T78A 3DC0A 4Z2JA 4DLMA 4O53A 1A5AA 3HZ3A 4MHBA 3TTOA 3EWBX 1BVNP 1E4NA 1QNRA 2OOFA 1LYXA 2EPLX 1EC7A 1PX4A 4HU3A 1N8WA 2DZPA 1W3NA 3RCNA 1CENA 2J78A 1ADSA 2HNHA 1NF7A 1IXPA 1UKSA 2PDNA 2DT2A 3PTDA 1L2QA 2QCMA 4RE0A 1OCQA 5H8MA 1LOQA 2ZUUA 2GQAA 1R8LA 4C6BA 8RUCA 2OGJA 3WD4A 4U5KA 3CPRA 1DEDA 1VCFA 6REQA 3W2KA 3OIHA 2O7QA 1HVXA 3NVDA 1DJZA 1H0GA 4TX8A 2YFOA 3G2GA 3QKEA 1FCQA 4GNKB 3NA8A 2G97A 1DXIA 1FWCC 1GOMA 5A6AA 1O5KA 1PXGA 4JL1A 4AZCB 3IJ6A 4GINA 1EX1A 1G4SA 3XIMA 4GIAA 1QASA 1U1HA 3W1RA 1ONRA 3WBXA 4XTIA 5AYZA 2ZXDA 3UR8A 3M0ZA 5AFDA 3V35A 5C2XA 4PTMA 4WK9A 4S3FA 3W7QA 2WCGA 4MLRA 1TQWA 3ER8C 3UJSA 3EX3A 3I4EA 2PEVA 1KR1A 3W37A 2OBMA 2HZGA 1NFGA 4S38A 1RCOB 5D2XA 3KW3A 4ZE4A 3UY8A 1GVEA 2EPOA 1OYAA 3LENA 4YYCA 1K8ZA 2PWHA 4X2PA 3S2JA 3QMTA 4M81A 1JYVA 4IH3A 3TQVA 4DJFC 4LAMA 4GYPA 2NW0A 2O55A 1E9ZB 2ZX9A 4FR6A 1X04A 3SSZA 3TAOA 4UMCA 1S3HA 3HQPA 4TIMA 1LOSA 2CLFA 2PDMA 3M5XA 1K4GA 1ZPTA 4IP7A 1E6QM 1W3JA 1SW7A 4JIPA 3L7RA 5AY7A 3SYVA 1A49A 3F5JA 3P80A 2YX0A 3VDAA 1XV8A 4M80A 2Z1WA 1A50A 4V33A 1VEPA 1Q8AA 2PLCA 1XGEA 1RJQA 2HVNA 1F07A 3AIRA 1KBKA 2DQWA 3D0CA 3OHMB 1XC6A 3BUPA 1E70M 4L9ZA 1MZHA 1E5NA 5AZ0A 3GNPA 3NURA 4FIRA 3RX3A 5HPOA 3AIUA 3RLGA 2E7FA 1EQCA 4DWSB 1UIPA 2VX4A 1VS1A 3A13A 3CAKA 1RJPA 3GY1A 1XIJA 3PR2A 3BW2A 2F1BA 4ZSTA 4BQ5A 1KM2A 2PDFA 1E6PA 4ICMA 4RE3A 3RR1A 4FM3A 5FJTA 3WF3A 4A3HA 1DKXA 5REQA 4LS2A 2IMRA 1GQIA 3TVAA 4CN6A 5DEZA 1K9DA 3UZ5A 4KKXA 3RV0A 3BUQA 3ITLA 2JEQA 4LVFA 3H7RA 4YNGA 3LK6A 4QJ5B 3NZ1A 3V5CA 4P7NA 3W7HA 3WK3A 1P7TB 3H7UA 3JRKA 3RO6A 4L61A 3S8HA 5LIWX 2OW7A 1PIGA 2V38A 1E40A 3WENA 3VA8A 3KOZA 3HG5A 3WJXA 3W00A 4XD3A 4JTLA 1WX0A 2HDJA 3NQVA 3HG3A 2OEJA 4H9TA 5T9CE 1GW1A 2QT3A 1JUBA 1Y5WA 2CZEA 4QSHA 3BSMA 4LNCA 3FFSA 1XLFA 1VPXA 1ONWA 3FA3A 4WXYA 3URAA 2GUBA 1UWSA 4I3GA 2GYIA 3IJDA 5HATA 1S39A 5EY5A 3PTQA 4BCEA 3OEXA 1RALA 2EJAA 4UFLA 3MBDA 1WXYA 2V69A 3C0LA 4PMUA 1SU7A 4AIBA 4PN2A 4JHMA 1S2VA 1EXBA 1EL3A 1FDJA 3WBEA 1R87A 2NX1A 2J6VA 4I90A 2H3BA 4RE4A 2XVKA 3BSGA 4D6GA 1AJ2A 2PMRA 4KH2A 4HJFA 1QI0A 1LL6A 1AD1A 3AMKA 1K8CA 3MUAA 2D73A 1O60A 2D0FA 3S5NA 3LNMA 5A6BA 4CD5A 5BW6A 1OF6A 2VD9A 1H7PA 1EDGA 1UWIA 4PCSA 3W7JA 5C7HA 1EH9A 3MZ2A 4IISA 3FEQA 3EPMA 3QWEA 2XM1A 1HW6A 3LNPA 4EACA 4XVEA 2JGYA 1EPVA 1TWDA 1UP0A 3AZTA 4JKKA 3MQTA 2NX9A 1A0DA 4UQAA 3WH8A 3MKKA 5DT7A 2L5HA 1H3GA 3O16A 3WDQA 4DZIA 5HINA 4EZTA 1PTDA 2XH2A 4CCCA 1BYAA 1OFQA 3S42A 4ENLA 4JWEA 3QMSA 4MY1A 2BSLA 2XSBA 1FRBA 3DX0A 2VFDA 2OT1A 1XIIA 4UFIA 1QX1A 3L3OM 2LLEA 4O8AA 1LLZA 1B3ZA 4IF2A 1FWAC 1DL3A 4HYBA 3L67A 3RITA 1HJQA 3I65A 5LIXX 2E40A 4UR9A 3URBA 4UTUA 3HA1A 5KETA 1QXLA 2VGBA 3C8FA 1JCXA 2VD8A 4R9OA 3STGA 1SZEA 1PDZA 1SUFA 2X2YA 2QJNA 2H90A 3FLUA 3HOJA 1J79A 3HF3A 1S1RA 1RR2A 1W32A 4V1XA 2J9ZA 3DCPA 5A6KA 2O4MA 3EX1A 3HB9A 2PLJA 5AYIA 1V03A 5AYYA 2BNJA 3RX4A 2GSHA 2PDHA 1PX3A 4P7OA 4QEEA 1VIWA 2OVLA 2YA0A 2G5WA 4I5RA 4QM1A 3KVLA 1P1XA 1R3WA 3BAXA 3VD3A 3T0DA 4L80A 1K9EA 2VEKA 3MZNA 2ZWYA 1YTKA 2D3LA 3B06A 5E93A 2ODOA 2G3JA 3ITYA 5FIPA 1C8XA 3WDJA 2OR2A 3U4FA 1AVAA 1KV5A 4FXFA 4LU0A 1E9VA 3CLMA 1X03A 1PB0A 3UZXA 4DBWA 3AXKA 1VJSA 3T05A 2GAFD 3RG6A 5CGTA 4RZBA 3SY8A 4IQEA 3TA9A 3THUA 4Q4RA 4MB4A 5DRCA 3CMJA 3O07A 2ND0A 1QTWA 1JUEA 1FUYA 2Y6ZA 1KBJA 4FX7A 1YNPA 2BVDA 3TYEA 3TTYA 3LCXA 1JFHA 1UWQA 3GVVA 3TOPA 4AVFA 5HQLA 2HWGA 2UY5A 4UTLA 1VYRA 3NZQA 2ZX7A 3MW7A 3BGAA 5EGRA 4BR1A 2P88A 4W4QA 1TB3A 4E3CA 3UXDA 5A94A 1WAWA 1Q6OA 2YSWA 1C7TA 1JQKA 3BJTA 2HPIA 3B8IA 4D6HA 1SO5A 2PRHA 3M16A 4XTDA 3Q84A 3ITOA 3QN3A 5DY3A 1XLJA 4A8LA 5LNVA 1N82A 2Y5EA 4W88A 4HPJA 5BWAA 4UIOA 3ARQA 4Q32A 2FJUB 3IUHA 4H8UA 2WSYA 1HFBA 5A8PA 3PLTA 5HXMA 2X09A 4GQGA 5I3HA 3TLLA 1GHSA 3CZ8A 3SCRA 4B92A 1EA0A 3WD1A 4QG6A 3TROA 2XINA 1UMLA 2R1PA 1TV7A 4AZBA 3CZNA 5G4HC 4AD3A 2E5BA 2IS7A 2XVPA 3W7LA 3IUIA 4S3CA 4F0RA 3E0IA 3LPPA 3DN5A 1ZBKA 4HJWA 3S2NA 1TPH1 2ZIDA 2GA9D 3VMOA 1E15A 4Z1DA 3UPMA 2WJFA 4G7FA 1V3KA 5CSRA 3AYRA 5CPLA 3AHTA 1ZS2A 4ES4A 1R9XA 6A3HA 3FXGA 2Y8VA 1WBHA 3DFTA 3MMUA 4JTUA 1BHGA 4EE9A 4ZQOA 4PRWA 3EWWA 2CNCA 4HGXA 1DP0A 2FYVA 3WN6A 1ICQA 2IPWA 3TYDA 1J2BA 1R86A 1YTEA 3GTNA 3I6EA 1S5TA 4QBXA 5C71A 4IXHA 3RJXA 1RD6A 3QV9A 3W7DA 4EPKA 4C90A 3A64A 3LQGA 5F4XA 1KFBA 2UY2A 2G3NA 3IIXA 4Q3MA 3CHEA 4X0NA 3N9SA 3V0UA 4DO4A 3CAQA 3WNOA 1YMYA 4NX0A 2V81A 3FY1A 4S3EA 4NNAA 2X8RA 5C9RA 1EIBA 4KETA 1DTUA 4HYVA 4KFOA 1Q63A 5E6YA 4XZHA 5DT5A 3W1QA 4Q33A 3E2VA 1ZJAA 1S2TA 3D2EA 5BRQA 3K8LA 2O0I1 1EX5A 4GIYA 3VNKA 3S5YA 4AWTA 4IIFA 1PV8A 2X3VA 3VVGA 4ZENA 4KIKB 4HTYA 1ISZA 4UTWA 2J4GA 3I68A 1R30A 3S6DA 2DVXA 4PUMA 5KZDA 2KX9A 3T1GA 1UR3M 2OSXA 4DJDD 1URUA 1JD9A 4LH8A 2CW6A 4HN8A 2F38A 1OK6A 2C15A 3VUPA 4UMAA 1LQAA 1VHNA 1YBQB 3LM3A 3S9IA 3WFLA 4RNIA 4QLJA 5A69A 1Q65A 4CKQA 3GFZA 3R43A 3U7BA 1LDCA 2P5NA 1D8CA 1YWMA 4WSJA 3KXQA 2CZVA 4B5SA 3PB2A 4RDYA 4UCFA 3M4HA 5HMSA 1BWVA 4FMVA 2POTA 1YE4A 3SO7A 4D6IA 3GG0A 5CPQA 2C1IA 4HHLA 5C5BB 1PIFA 4UQ9A 2D1ZA 4J40A 1IT8A 4JFTA 1QCWA 3CKDA 4ATWA 3DPPA 4I5UA 3OZOA 1JZ4A 2D1LA 5CAKA 5FACA 2I7GA 2ZUNA 2C6QA 2X16A 1TCDA 1TR1A 1V0NA 5IBXA 4RKAA 1D3GA 2PCEA 3KWXA 2GSJA 3LB0A 3KVKA 3WD3A 1U22A 4XAYA 3M7SA 1LORA 1CBGA 1WDZA 4WJXA 1VD6A 2XTKA 3ZJ8A 3TQPA 3DH7A 3WEZA 1R2RA 4GVGA 2PLKA 4Q4PA 1OINA 3FSUA 4ALDA 5C9WA 1BQGA 3C2EA 3ZJKA 4AZHA 2HS6A 4IFKB 4QIUA 4Z17A 3EDDA 2HTMA 3CM4A 3PG9A 4LGXA 3UWQA 1I2NA 1ZYLA 1EC9A 1RA5A 5D04C 3SQMA 2V3FA 1JCJA 3W23A 4HPGA 1O5RA 4N02A 3TU9A 2OYLA 3WELA 3W1NA 2I9UA 3VFLA 3GLCA 3C6CA 4A8RA 4K8GA 3POCA 4JFWA 3NQEA 1OCNA 4DLFA 1MEHA 3MB9A 5A1AA 4MFDA 2DUZA 3N1AA 2A3BA 4K1GA 4LUTB 2FVLA 5D4YA 1W5OA 2XIMA 3ITGA 3PWAA 2FZBA 1H7OA 4HPXA 3LGGA 5HK4A 1XLCA 2GDQA 5LHEA 1ZRQA 2J8FA 1UD3A 1UBPC 4ZQMA 4DWDA 2HE5A 1OSEA 2DVUA 3FN9A 2PMQA 3M0JA 2XGBA 2WV8A 3EWDA 4LUSA 1VCGA 2QJGA 3N12A 4ZOCA 4XO7A 4M1BA 2FLIA 4OZOA 4IMEA 4E8DA 1R6WA 1WBJA 5A8NA 3FS2A 4BEUA 1JPMA 2PTDA 1PX8A 4L6OA 1UOKA 1A3HA 4JDBA 4ZE5A 5CCZA 1L0PA 3O9NA 4TU1A 2YI8A 4H4IA 3PB0A 2YCIX 4IM0A 3GDBA 1BXBA 3H2CA 5BXPA 2VUNA 2ZVIA 4NI8A 4L9XA 4Q8MA 3GDKA 3BVUA 3QV7A 3WJSA 3IEBA 1HJXA 2V6AA 3VD7A 1Q5MA 3TH6A 5D8ZA 4MADA 3CHCA 1NY1A 1DE5A 2A3AA 2V3GA 4WHBA 5CPTA 1GUVA 4MKNA 4GUJA 4N6FA 2JKAA 3GI7A 2XH4A 5AC8A 3KL3A 4EZSA 4Y9AA 1S5MA 4INFA 3VZYA 5LA0A 2BY0A 4R7JA 1H49A 5I79A 1NU5A 3ARSA 1MVYA 1DOSA 4YJ5A 1NWTA 1MXSA 1OYCA 4LTSA 4OGZA 1FDYA 4KIRA 3BLOA 3FW6A 3GNNA 3WLKX 1NQ6A 4B9QA 2JEPA 3N14A 4H00A 3TJLA 1WNOA 1AZ1A 5GJPA 1O6IA 1TZ9A 1XLGA 4FEZA 4AWSA 4XAGA 3R8HA 1XBYA 3LU2A 2DORA 2ZOXA 1V02A 4E81A 1DKWA 3TONA 3APGA 3OO2A 4WJ8A 2Z1SA 3CB8A 4LVAA 3DX5A 3ZXWA 1H09A 3LI1A 4UFJA 3RNDA 3S5SA 1UWUA 3CV1A 3LN3A 2PPGA 3GR4A 1RZMA 3LLLA 3WUFA 1NM9A 5C2GA 4WX2A 1XDLA 4KT2A 3W01A 2C19A 3JVAA 4PCNA 4P8UA 4JTFA 2ZBTA 4DPQA 4U10A 2GPTA 2XZ7A 3A47A 2E6AA 3BV7A 3MS8A 3FYOA 3CB3A 2Q02A 3OVQA 3T6CA 1ECEA 1GK8A 3AO0A 5JIPA 2PUZA 3LPFA 5I5RA 2Z1VA 3ATYA 3QW3A 1P5BA 4KFNA 4I1QA 1I4DA 5CG0A 3F5LA 3CAZA 1KXQA 2V82A 3W07A 1AZ2A 1QI2A 1MW0A 5ABFB 2AL2B 5M03A 3ANVA 3AWOA 1H60A 5CPNA 5H2ZA 1OFBA 2NVAA 3PC0A 2O56A 4R5LA 4F4RA 4FI4A 3SB0A 1ZCOA 1MDRA 1WZMA 2CCRA 5HPCA 1ICPA 1HZYA 4W9TA 3IIOA 5MF5A 3IK4A 2DDXA 2GQ9A 3TDFA 3PSVA 2QCLA 1LQ2A 2A4AA 3W85A 2IQ0A 3P81A 5FJIA 2ZX5A 4WGXA 1H51A 3ANYA 4YU1A 2AL1A 4E8CA 2A5HA 3NO1A 1IZKA 3UXLA 4I6VA 4XQ6A 4ACYA 2Y5SA 3M9YA 4BKNA 3ZVHA 1BWLA 3UVIA 3E5BA 4WR3A 3W86A 2OG9A 3VDGA 4EIVA 4Q7BA 1UQZA 4MJ4A 3KOYA 1J0YA 3EJPA 1REQB 4IPJA 1WDSA 1RXOB 5XIMA 5DCEA 3UT0A 2PC8A 4V2XA 3E6EA 3VC5A 1LRTA 5JBDA 3KAOA 1GYNA 4G5DA 4REQA 3MCOA 3MVIA 8XIMA 4PL2A 4QJ4B 4PUKA 2YIAA 1D3CA 1GNLA 3CUJA 5JXQA 1YX1A 1K70A 5ENLA 3I2WA 4GJ1A 3TYZA 1K4HA 1I1WA 3IGXA 3LRMA 2OKTA 3ANUA 3BICA 4V1YA 4RW3A 3TW9A 3LY0A 1EZ2A 3BQ6A 3RYSA 3QV8A 5HNNA 3C2VA 1GGOA 2FTPA 2PDLA 3KDRA 3SUWA 5DRIA 3WUGA 3HV9A 3URQA 5HMFA 4PUUA 1TV2A 5FSEC 2ZRVA 5M1TA 2V2CA 4FS9A 3PWIA 4IIDA 3VKDA 2RAKA 1GVSA 4C65A 2CLKA 3A5FA 3EJUA 4JTRA 4CD7A 4Q8UA 4JTGA 4AF0A 2NCZA 1SZFA 4F2TA 3IPWA 5KZ6A 2YI9A 4AD2A 1YPFA 1VLWA 2VEGA 2VDHA 1HGYA 4UQBA 1DYSA 3SRKA 1W3KA 2VHLA 3CIWA 5G2IA 4ATLA 4EZQA 4X3ZA 1XLKA 3PWGA 3LCIA 1TMQA 2W3ZA 1E51A 4F79A 2VX5A 1M7OA 1J5SA 2V0OA 4BF7A 3RCMA 2X7VA 3RM8A 2XHYA 4DO5A 6TAAA 4BI6A 2YPIA 4FK9A 1C93A 3RUBL 1VPYA 2OMAA 3Q0KA 3H53A 4JN4A 1RH9A 3N34A 4PA8A 1V02E 1MUCA 4EPEC 4JTEA 3IVSA 1MJGA 3LCFA 3I7QA 2X05A 2GVLA 1A4LA 1EEPA 2LM0A 4XUGA 4YWIA 3BZGA 4NASA 4Z1YA 1GW9A 3WMBA 4JY8A 4R88A 3BE7A 1XIGA 3GVQA 5D8WA 4CN1A 2ZDRA 1VC4A 1C9DA 4HBKA 4PUEA 3AOFA 1KFKA 1UH2A 4J3SA 3GXDA 1R2SA 4NZ1A 2BBFA 4WSHA 2WZEA 4HOWA 2YCJA 3DFOA 4QE5A 1W9BM 2DZSA 1IIGA 3W3OA 2FYMA 1A0EA 1EUAA 4DNHA 1J0IA 3LHZA 4QSFA 3INPA 3TZFA 3W6YA 1B4EA 3FXYA 1WQ5A 2WK2A 1FCVA 4GG9A 4Q22A 3D3AA 3HN3A 1CXFA 3BVJA 9XIAA 3M43A 3WSUA 1FWGC 3B04A 3GUGA 4Y7EA 1PKYA 3LM7A 4IW0A 4IPIA 3DX1A 1JR1A 3MHUA 2Y89A 1GVIA 3OPSA 1KO0A 1XIFA 4GZEA 5HJXA 1S2AA 1GOQA 4QNEA 1Q85A 4BQ3A 5C7VA 3DYMA 1CGVA 5FEXA 4AIOA 1YHTA 4LXFA 4DJFD 3WL0A 1FKXA 2Z1BA 4ZOEA 5FA5A 3F4CA 3H2EA 3T07A 3P60A 3WQWA 1ISVA 4PEKA 4AZ5A 3IVUA 1O1ZA 4K2SA 2W4XA 2BFGA 3CUZA 3EMQA 1YXCA 3M0MA 4LYRA 3UR2A 1OFDA 3C86A 3PTMA 5GPRA 2CC0A 3KZPA 3UF9A 4F40A 1TQVA 4MB3A 4QE1A 5HUOA 1JDFA 4NJGA 4OVXA 1XDJA 3LX9A 1KXTA 4K36A 1UYQA 1NWUA 3BLDA 7TAAA 2XZ9A 2Z00A 3CZLA 3TSMA 5D9NA 1QHPA 4KESA 5BMXA 3MWAA 1MQQA 4DB7A 3WQVA 4LCSA 3B9DA 3ZR6A 1UHVA 3VD5A 5BOEA 2EKGA 1XBVA 3JUGA 4PYSA 1EEXA 2Y85A 4JZ5A 2WSPA 3ECQA 1V0MA 3FHQA 4QDWA 4JYEA 5C70A 1ZSXA 3GNOA 3BOFA 4K8HA 4PRTA 1OZMA 3V16A 1QOXA 5FESA 1CB7B 3GU2A 2D2JA 3PFRA 5D2WA 3A24A 4UOQA 2DZUA 2XIOA 2YB4A 1OX6A 3KBWA 4JBRA 1CGXA 3MCMA 3W7RA 2DFAA 1OFOA 3UWWA 4B4FA 4DJDA 2BDQA 3LHUA 5H8PA 4GXPA 1QWKA 3VIFA 3G77A 4OV4A 1E9YB 5FOOA 3SGZA 5MKGA 5LNSA 3CPUA 3SRHA 3UBPC 1XRFA 4BQ2A 1ZNNA 4HZ8A 1NJJA 5EBAA 1EJTC 1HO1A 2FH6A 3VKHA 2G3IA 4KEMA 1G4EA 2DZBA 2Z8YA 1KTBA 3OW1A 4NJHA 1XYAA 2R91A 2UY4A 3CHDA 4YCOA 4JTIA 2BGSA 3DYPA 3S46A 1XLEA 3W25A 1H4PA 1UA7A 3O3OB 3W76A 2O9TA 3NXLA 5AKQA 2IPJA 2BZNA 3T8QA 4CU6A 4CUCA 3HGRA 4TVCA 3BOLA 2WNNA 3W70A 1JXKA 1HT6A 3W24A 4AY7A 1POJA 3RMJA 1W2PA 1Q6EA 5TD4A 1OT1A 4MIMA 4MG4A 4WY0A 1MW3A 3LRKA 3AMGA 2QFFA 3B8TA 3LERA 1XR2A 3VMNA 1EP1A 1H7XA 1OD0A 3C0SA 3I10A 3BDKA 1GKQA 4GABA 3CVRA 2YKTA 3EA2A 3M0HA 3TN3A 4KWOA 5CPMA 3OQEA 1KLYA 4Z1BA 2PCQA 1LWIA 4EWND 1FKWA 4LF2A 1RBLA 4PEEA 2OWXA 1UJQA 1W3LA 4Z1AA 2WBKA 3OBEA 3H23A 1MQRA 1U1UA 1Q7ZA 2ZYFA 3RIKA 1GOOA 1TTQA 4F48A 2A6LA 2EFLA 3H54A 4JQAA 3O0KA 3GB6A 2YW4A 1W9PA 4KBXA 3BSHA 3P7YA 1GONA 4B3LA 3B97A 1CNVA 1XRVA 5L6UA 1PVNA 1QI3A 1M5WA 3FX4A 2AMGA 4IIHA 3B0VC 1ODUA 4PTWA 3UYIA 3HPZA 5DF0A 2GGJA 1Q45A 2UZ9A 3VINA 1JL8A 5LXEA 4MM1A 3HM7A 4J3UA 3GHSA 3REQA 2OFJA 4PC8A 2ZE3A 4L7ZA 2ALRA 1LP6A 5AHIA 4JWIA 3AHYA 4B16A 1Z32X 4OQVA 4C6CA 1MW2A 3LOTA 4IL2A 3BAYA 1L6YA 1OX5A 1FWSA 2WCSA 5M2FX 4E5TA 4MAZA 2KZHA 3MO7A 2DZAA 2GVYA 4NRSA 5A8OA 3N6HA 3T44A 2YXOA 2TODA 5AYXA 3BLBA 2WQDA 1IZCA 4K8EA 3VNZA 1UIOA 1VFSA 2J7FA 3EB2A 4UTWC 3SJ3A 1YIXA 3L5AA 2Z6IA 4LQ1A 1OFAA 3C8NA 3EYPA 4K68A 1KKOA 1TQUA 4W7VA 3MDWA 3D52A 1MUMA 4W5ZA 1Q6CA 3NQDA 3VEAA 1CLXA 3GM8A 3TC6A 2Z1KA 1FWNA 1CYGA 3GHUA 4Z2KA 1ZCCA 4C6IA 2R9RA 4X60A 1F4AA 3NQAA 5DMYA 3LPOA 5DXXA 4W7UA 3U4AA 3PPHA 3W81A 3VYLA 4GI4A 2GLKA 3W88A 2C1HA 4DIAA 1XPGA 1Z89A 4GGHA 3NYDA 4TR9A 3NR0A 5KZMA 1XICA 3AS0A 1CXLA 3QE6A 3WIJA 1U5HA 1XYLA 4W8LA 4TTGA 1ZBWA 4CQ9A 3E2RA 2PDUA 2NV9A 2CLPA 2ZRZA 1XS2A 4LVDA 4AEFA 2WVVA 3MANA 3T09A 4XKY