4AZBA

Differential inhibition of the tandem gh20 catalytic modules in the pneumococcal exo-beta-d-n-acetylglucosaminidase, strh
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
425
structure length
408
Chain Sequence
NEKLAKKKIVSIDAGRKYFSPEQLKEIIDKAKHYGYTDLHLLVGNDGLRFMLDDMSITANGKTYASDDVKRAIEKGTNDYYNDPNGNHLTESQMTDLINYAKDKGIGLIPTVNSPGHMDAILNAMKELGIQNPNFSYFGKKSARTVDLDNEQAVAFTKALIDKYAAYFAKKTEIFNIGLDEYANDATDAKGWSVLQADKYYPNEGYPVKGYEKFIAYANDLARIVKSHGLKPMAFNDGIYYNSDTSFGSFDKDIIVSMWTGGWGGYDVASSKLLAEKGHQILNTNDAWYYVLGRNADGQGGGNLDQGLNGIKNTPITSVPKTEGADIPIIGGMVAAWADTPSARYSPSRLFKLMRHFANANAEYFAADYESAEQALNEVPKDAIRSLDSNLSRAQQDTIDQAIAKLQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-N-ACETYLHEXOSAMINIDASE
publication title Inhibition of the Family 20 Glycoside Hydrolase Catalytic Modules in the Streptococcus Pneumoniae Exo-Beta-D-N-Acetylglucosaminidase, Strh.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
total genus 154
structure length 408
sequence length 425
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2012-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.90 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 AF1782-like 4azbA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4azbA01
3OGSA 1NOWA 4HA4A 4CGTA 2J4GA 1E6PA 3A4WA 1R7AA 3OB8A 1B3XA 2YL8A 2XVGA 4QCEA 4DUWA 3CUIA 3UESA 4Z2GA 5CGTA 1ODUA 1UOKA 1ZBVA 2WBKA 3U5YA 1G5AA 2PWEA 1FHLA 3PZVA 2JEPA 5CZKA 4WSKA 4WKAA 3SIMA 2X1IA 1W2PA 4H41A 4OBSA 2W62A 4J28A 4UFJA 3AIBA 4AD3A 3AI0A 1MFVA 1K9EA 1WO2A 3WH8A 4PRWA 1CPUA 3DC0A 3N15A 4IM4A 5HXMA 1LL7A 5CLTA 4GQRA 4EE9A 4NF7A 2BXZA 2JF6A 3AS3A 4TX6A 1DWJM 2J7CA 3TTQA 1LL4A 3THDA 5ABFA 3VIKA 5IFTA 2A3AA 1E1FA 1HVQA 3WQWA 1Q6EA 4KH2A 5D9OA 4L4PA 4NZCA 1B30A 2UY4A 4JKKA 1B3VA 1BVNP 2GK1B 5ABGA 4YHGA 3U7BA 1BTCA 1HKMA 4BZYA 5AYBA 4MNMA 5JBDA 1W2VA 5CSUA 1V6VA 3DHPA 2CETA 4PTVA 3T09A 4LXFA 2BV9A 3VNYA 4J3UA 3SUSA 3T2QA 5CPSA 3FNDA 4ZXOA 2WHLA 3MO4A 1J0YA 1JZ3A 4WLCA 5BWFA 4B15A 2YA0A 1QBAA 1WZAA 3GXMA 4JFUA 1QW9A 2PBGA 3VDBA 1QBBA 2D24A 3QGVA 2WVVA 1LLOA 2D20A 1KWGA 1V3LA 2YL6A 2W5FA 1FHDA 5F7UA 3GZAA 2Y5EA 3ZJ6A 4U3AA 1JFHA 4AWEA 1DWAM 1FH9A 3SUUA 1V0MA 1E3ZA 3EMZA 2WWDA 4CD7A 3MANA 1OWQA 3MMWA 2A3BA 3AHYA 1ZU8A 2BY1A 5GNXA 4DWSC 4J3TA 3NSXA 1LF1A 1XSKA 1OGBA 3B9AA 1UR9A 1WE5A 2WMFA 4QP0A 4FZOA 5I77A 2EPNA 3GTNA 3CZGA 5EFDA 2BHUA 2Y4SA 3AMCA 3AJ7A 1H49A 3DHUA 2VRKA 2RGMA 3VTRA 3L4YA 5A8OA 2WVVB 5AY7A 3N18A 2DPEA 4WSJA 5D8ZA 5BXTA 1KXVA 4DM2A 3ALFA 4IISA 3OZOA 3BSHA 3MSGA 3B9EA 3HU7A 2BY0A 3S6TA 4ZEPA 4U2YA 4F66A 2FHFA 4ZE5A 3WDPP 3ALGA 4LGXA 4AEFA 3AIQA 2FGZA 1E6RA 4PEEA 3WH6A 4YPJA 2WWCA 4RE2A 1PAMA 4Q22A 4P8XA 2CCRA 1UZ1A 2D22A 1CECA 1ZJBA 1UZ4A 1H0GA 4OUEA 2ZXQA 3UG5A 4AYSA 1E4LA 4QDMA 1M04A 4ZE4A 1JZ6A 1A47A 2V3EA 4UZSA 3WQ8A 4XX6A 2VC9A 1M01A 5BXPA 3UERA 1VB9A 4CCEA 1TMQA 1TZ7A 3VX1A 2VCCA 3GM8A 3AS0A 2WLZA 1GHSA 1TG7A 7A3HA 3AIWA 4CUCA 2E0PA 4TXEA 3NDYA 2WYSA 3VGEA 2VOTA 1I75A 1H41A 2WSKA 3A4AA 4CU7A 4Z2JA 1PBGA 1GCYA 2WMGA 4HMCA 2YBTA 4AZ6A 1Q6DA 1TE1A 1E4IA 2CXGA 5IXEA 4PMXA 5AC5A 4FLOA 1C7TA 1QVBA 4D6HA 1UD3A 2J7DA 1KFWA 4YN5A 3CUGA 1BSIA 2OWCA 1BVZA 4LYQA 5DEZA 4YHEA 3WF1A 5AC4A 4P8VA 1AVAA 1CENA 3G6MA 3QHOA 3WDIA 3EBVA 1WPCA 2XSAA 3O9NA 3FW6A 3CZEA 3PZGA 3MV01 1J0HA 1V0LA 1IV8A 3BGAA 1UWRA 1OSEA 3K8KA 2XVKA 3WD1A 2PWFA 1TCMA 5CGMA 1QHZA 2OWWA 2JALA 3ARUA 4AZCA 2WKGA 2XSBA 1MXDA 2VQUA 5CXPA 4DUXA 2GUYA 4MDOA 2VX6A 4TOQA 3W6LA 1HJVA 3CO4A 4DUVA 2DT1A 4S3KA 4PMVA 4KWUA 3VIPA 4W85A 1L8NA 4ACZA 3W28A 4HA1A 1HJSA 3PBGA 6A3HA 2VQTA 1MW2A 3EMQA 8A3HA 1V6XA 1PZ3A 1WDSA 2WHJA 3HN3A 1GZJA 8CGTA 3AYSA 2OYLA 2XTKA 2XHYA 3WFZA 3OG2A 4JL2A 4H04A 4AZCB 3TP4A 1FP9A 4JFTA 1NQ6A 4D6CA 3MS8A 3EMCA 3T0DA 1TFVA 4W88A 1UKTA 5GQBA 4MJ4A 1TR1A 4D6GA 4AISA 1UR8A 2XM1A 5E6ZA 1GJWA 1E40A 3AMGA 4ACZB 3LPPA 4PTWA 3VIMA 1A3HA 4E4PA 4EKJA 3CHDA 3A6OA 1E3XA 4D6FA 4B3LA 4F9DA 5A69A 3WUGA 5EFFA 4GZEA 3VVGA 3ZSSA 1EO7A 4CD4A 2VZSA 4OKDA 3AZTA 4W8AA 2ZIDA 3PZQA 3VD9A 1OT1A 4W7VA 2OYKA 1U30A 4M24A 4AD5A 1K6AA 1ZJAA 3GXDA 4WJXA 5HDRA 3W38A 4S3JA 3ARWA 4CVWA 3ZT5A 3APGA 3WNLA 3K4DA 5E09A 1EOKA 3CUJA 1VEPA 1JL8A 3PTKA 2ZUVA 4CN6A 2BVDA 5HNNA 5LYRA 3OLDA 1XD0A 1QNPA 1VF8A 2QPSA 1LG1A 5FL1A 4UFKA 4UOQA 2VT0A 1CXIA 1JI1A 4UZUA 1AQMA 1JFXA 1O6IA 4M81A 3AIEA 4CKQA 1BFNA 1JNDA 3WF0A 2J78A 4XUYA 1JYNA 3ECQA 4CU8A 1NARA 3WD2A 3ARSA 1E4NA 1D3CA 1KB3A 3WNNA 1JF6A 2VTFA 3WL0A 1CXLA 2WVUA 4JL1A 4P7OA 5AYIA 1C8YA 2ZUUA 4D6EA 4UNIA 1BYBA 3QHMA 2WVSA 4AZIA 4UFLA 3EDKA 1B1YA 1QHPA 1HJUA 4UOZA 1W1PA 3BAWA 2ZUNA 5LA2A 3AMDA 4PMQA 2VUYA 3WH7A 1S46A 1MQPA 2J75A 2RGLA 1CGYA 1NWUA 3AHVA 2WXDM 2YLLA 1HKIA 4C7GA 1MYRA 2BY3A 3VIJA 2E8YA 1J0JA 4P7LA 1BAGA 3W53A 1E55A 2J47A 2D0FA 1TVPA 2J25A 1QPKA 2XG9A 2ZXAA 3VPLA 1CXEA 2V5DA 2DGAA 1V6UA 1V3KA 4N42A 5I24A 2VL4A 3WBEA 2WZHA 1CGVA 3WNKA 4J3VA 1DTUA 3SCUA 3NCOA 4Z2HA 2BXYA 3VINA 2YL5A 1HL9A 1KXHA 1CGTA 1QOXA 4WK9A 3N11A 4UQEA 4X9YA 2X0YA 2DH2A 1XC6A 1V08A 5I5RA 4EK7A 4OOUA 4PCSA 4L4OA 2DIEA 3DECA 3CZJA 4PMRA 1E6SM 1UD4A 2ZXBA 4W7UA 3AMKA 4WKFA 3WD3A 3VD4A 4PN2A 2J74A 3VIFA 3CZLA 1XSJA 1C93A 2YL9A 2D0GA 3VGHA 3PZNA 2WC3A 3GH4A 3MUAA 4BS0A 3L2LA 2E9LA 4R5EA 2HVMA 1E9LA 2EJ1A 1UR4A 4JFSA 2XPKA 3PZIA 3NSMA 3IJ9A 2V3GA 3VGDA 3DYOA 3NSNA 3MU7A 3W6MA 3W37A 5BRQA 4KGJA 4D72A 1UH3A 3ZMRA 3BC9A 1H5VA 2YOCA 3RM9A 5FOOA 2VRJA 4M1RA 3WH5A 3BLKA 4HA3A 4JAWA 1VRXA 3PZ9A 4D71A 5A6BD 2DSKA 1MWOA 1ISYA 3RIKA 1UQZA 1MQRA 4QAWA 1SYTA 3CMJA 4AZ5A 1DWGM 1OB0A 2DT0A 3NYDA 1OIFA 3T0BA 1AMYA 1W1TA 5A2CA 2HISA 4ZXLA 2CHNA 3VIOA 2Z1KA 2YJQA 2BVYA 1B9ZA 2WKLA 3L4ZA 3FXYA 5KZ6A 3CPUA 5C71A 1ITXA 5CJ5A 4XZWA 1DP0A 1CXHA 4UOJA 2PWGA 3WNOA 1E4MM 3B9DA 4NRSA 4PMOA 1U2YA 2X09A 3VM7A 2PC8A 4CD6A 1E5JA 4KRUA 3UR7A 3WD0A 4ZFMA 3F5LA 1E6XM 1EQPA 1UA3A 4M29A 4MPKA 4F8XA 1GQIA 3WUFA 3WEMA 3CHCA 2ZICA 3QOKA 4MNLA 5D9PA 4AZHA 3U7VA 3M6DA 2WC7A 4OBRA 3WDRA 1QNOA 2XGIA 4AZBA 2XFYA 2Z1SA 3VDCA 2BNJA 2CHOA 4AW7A 5IHSA 2AOSA 2WMKA 2NT1A 3RO8A 1JZ5A 2ZX7A 5BXRA 1FFQA 1BG4A 1EIBA 1H0IA 2VURA 4UFHA 1E0VA 3O2LA 1WDQA 5ABFB 4RE3A 5LA0A 2XUCA 5A6KA 1M7XA 3AZRA 1UWTA 4XB3A 4H7VA 4U33A 3WEZA 1AQ0A 5DT7A 3FN9A 1G9HA 3WMCA 1AQHA 3FY1A 2XWDA 1X1NA 4B16A 1GPFA 3HJEA 1HP4A 1BYAA 1EHAA 3VGGA 3W81A 2DSVA 3ZIZA 2GFTA 1GQLA 3PZUA 5HOSA 3CHEA 2IXVA 2VCBA 3A47A 2F61A 3L4WA 1YQ2A 2CIPA 4W8LA 1Q4NX 2PB1A 2EQDA 1J18A 5FCZA 4JZ5A 1J11A 2VI0A 2GDUA 1GUVA 5CG0A 4AIEA 3OGRA 1ZL1A 3AROA 3RDKA 3ZOAA 3EDFA 2EPMX 5DT5A 1E43A 2UY3A 2BHYA 1JXKA 3QR3A 2XWEA 1EH9A 3CZ8A 4WIWA 3AXHA 3RPMA 1M53A 3WELA 1OBAA 2D2OA 1W3KA 3WENA 1KXQA 1MW3A 5JIWA 3WDQA 2E8ZA 3WQ4A 4B9ZA 1W3LA 5A2BA 1K9TA 1EHNA 1PZ2A 3POHA 5I23A 1H2JA 5HBFA 1CGXA 1H3GA 3AZSA 2VX4A 1BF2A 3PTQA 3SUVA 4CU6A 3BAIA 2D0HA 2CESA 1B3YA 3AFBA 3EYPA 3JUGA 4XZBA 2GJPA 5M17A 4RE4A 5CPTA 1HJWA 5E0CA 4FLSA 3CZKA 4M82A 1XV8A 4HZ7A 2OYMA 1BQCA 5IFPA 1DWFM 3KEHA 5JBFA 3GNOA 2VR5A 1BHGA 3UG3A 1GW1A 4PYSA 2ZWYA 3FAWA 4UFIA 3BAJA 2V5CA 5EBAA 1JYXA 3MKKA 1G94A 5M03A 1ZBKA 1VJSA 4AD0A 1V03A 1UQYA 1CWYA 3SCVA 3NIYA 3ZT6A 2E9BA 2VRQA 3ZR6A 1KGWA 3SCNA 4D6DA 2PI6A 2GSJA 1WP6A 2O9OA 5A8PA 3BH4A 1LWJA 2C8NA 4AZ7A 2D23A 3AIRA 2BVTA 2Q8XA 1KR0A 4LYPA 3GNRA 1BGAA 3A4XA 4MAZA 1XSIA 3KL3A 1GOWA 2EPKX 1HIZA 4IPLA 4GZJA 3OA5A 2EPLX 1KXTA 4F79A 3ARQA 1X6NA 1G1YA 3IAPA 4V27A 1ISWA 1V02A 2W91A 5LA1A 2PBOA 4PMYA 2QLYA 3TOPA 2D3LA 2VVSA 1PIFA 3SCPA 2IUZA 1KCKA 2A3HA 4AEEA 4A3YA 4Z2KA 3GNPA 3K8MA 4HPHA 3N13A 1QHOA 2JIEA 2QPUA 4BQ2A 3LPOA 3VDHA 1YHTA 3BCDA 4Z2IA 4EANA 3ZR5A 5FKYA 3W0KA 4J3XA 1UWQA 3M46A 1Z32X 2WPGA 2F8QA 1UHVA 5I0DA 2Y8KA 1EXPA 3WKZA 2NW0A 3VMPA 1UA7A 2OSYA 4JCLA 1XH1A 1SFSA 2UY2A 2X8RA 4HMDA 2JE8A 3GH5A 4JHZA 3WL1A 1D2KA 1XH0A 5A3HA 2C7FA 2OSWA 4TVCA 3ARTA 4P7QA 3VX0A 1GJUA 3BSGA 2YDRA 2DIJA 2BHZA 4KGLA 1KWKA 2VX5A 3QOMA 5A6BA 1RD6A 1CGWA 4UCFA 3AIVA 2TAAA 1ISXA 1F4AA 3GH7A 4FLQA 4UQAA 5GNZA 1VAHA 3CBWA 3VOCA 3WF4A 2GDVA 3K1DA 3ZT7A 6TAAA 1HKKA 1RH9A 3RCNA 3ZJKA 3SCWA 2WZIA 2G3IA 3AMLA 1PEZA 3IANA 2VZTA 4UQBA 3AYRA 5DMYA 4PSPA 1W9UA 1US3A 2CBIA 5JBEA 1GOKA 4MNJA 2XVPA 1GOQA 3AISA 4WF7A 4B3KA 1J10A 1OD0A 1W9PA 4HU8A 1CTNA 1NH6A 4WKHA 2ZUTA 2E3ZA 2G3JA 3UG4A 2AAAA 2EBNA 2CBUA 4JIEA 3AXIA 4CVUA 3L4XA 4PMDA 5D8WA 3BXWA 1PX3A 1OT2A 1HJXA 2G41A 4P8WA 1QNQA 4HOZA 4AIOA 1W9VA 5DF0A 2W92A 4PTXA 4MB4A 3SCSA 1J0KA 1GVIA 1W9BM 4FK9A 5A2AA 2VX7A 4PBGA 3QHNA 4W84A 1EA9C 3SEPA 4BQ5A 2CEQA 4N0RA 4AMCA 4BCEA 1WNOA 1W32A 2X05A 4Y7EA 4IUGA 1J0ZA 4OIFA 4AXNA 4UR9A 3TTOA 4D6IA 3FHQA 1UUQA 4MB3A 3CUHA 2ZUSA 1Q6CA 1JXJA 1PIGA 2QHAA 5FL0A 2JIWA 4J3WA 5DFAA 1H4PA 2V38A 1I1XA 3W24A 1XYZA 5A6SA 4MJ2A 3CMGA 1HP5A 5HPCA 2DDXA 3GDBA 4IPNB 3WQ5A 2WB5A 1G01A 3F4VA 2J79A 4HZ6A 1JZ4A 4H2CA 4URIA 5FD0A 2VVNA 4DM1A 3U5UA 1J0IA 2OLHA 3WUEA 2JEQA 3VILA 1QI3A 4BQ4A 2WCGA 2G3MA 3AICA 1CNVA 2B31A 2BY2A 2J7BA 1HT6A 3K8LA 5A94A 1UD8A 2JNKA 1OCQA 3M07A 4V2XA 1NOUA 2YIHA 4H8VA 4GPNA 1UWUA 3RILA 1HNYA 3ARZA 3VGFA 1CLXA 2J8GA 4ACYA 3WMSA 2GJRA 3F5JA 2XJ7A 1HL8A 3UCQA 4HU0A 3CGTA 2CYGA 3PZOA 1PX8A 4J7RA 3VD3A 4ATLA 1RP8A 1JZ2A 2CKRA 1UYQA 1V0KA 3WDJA 1JZ8A 4JKMA 3MMDA 3AHXA 3KWXA 4GI9A 3SCTA 2GJXA 7CGTA 1JI2A 3ARRA 2VZOA 3J7HA 3SURA 4GO9A 1MQQA 1ISZA 1E56A 1DWIM 1EDQA 1V6WA 2G3NA 1LQ0A 3W25A 3ZSTA 3MUIA 4PUDA 3W27A 5KEZA 1SR0A 2CPUA 2XIIA 1H1NA 2F2HA 2VZVA 2J62A 5A8QA 1EOMA 4MAVA 1DWHM 1XYFA 3WN6A 3L4TA 3VIIA 1JD9A 4A3HA 1ODZA 1Q6GA 3NJ3A 4KRTA 1BYCA 1DEDA 1VFMA 3AXXA 2WCSA 3VGBA 1B31A 4OOZA 3PTMA 3WD4A 2XFFA 2EO7A 2GJXB 5BXSA 1UD2A 4D1JA 1W3HA 1KQZA 4V28A 3IK2A 4U5IA 4PSRA 1XRVA 1W1YA 2DEPA 3K4AA 1MXGA 5BCAA 1LG2A 1E72M 3WEOA 3OZPA 2YLAA 2W66A 2J77A 4LX4A 2YA1A 3ARPA 1UKOA 4U5KA 1OINA 2D3NA 3T0AA 5EB8A 4HPGA 4X0NA 3GXIA 3WSUA 3GYCA 5I2UA 2Y24A 2WANA 5GNYA 4C7DA 1KR1A 2ESCA 3LPGA 4W86A 1WB0A 1P6WA 2QMKA 4HTYA 3ZQ9A 1MW1A 4Q7NA 4QLJA 2EXOA 4E8DA 3K46A 1QI0A 1TUXA 5E9AA 1GOOA 2MANA 1B3ZA 2DSUA 1E6NA 2BS9A 3VU2A 3CH9A 4W7WA 3POCA 3VKKA 1GOIA 1QI2A 2WZEA 3BLPX 3IJ8A 4J3SA 1GONA 3BCFA 2GK1A 4GO8A 1E5NA 3SUWA 3D3AA 4ZENA 3PZTA 1R8LA 1C90A 4ATDA 3I3EA 3MSDA 2X2YA 1H11A 4ATWA 1FH7A 4LQ1A 4H8HA 1JAEA 1WZKA 1BPLB 5A8NA 1V3IA 4FF5A 4GIAA 9CGTA 3N1AA 5BYWA 4W5UA 1KBBA 1RP9A 1LWHA 1SMDA 5GPRA 1NWTA 2V3FA 3U57A 4F9JA 3ARXA 4QFUA 1FH8A 3KZSA 4C7FA 1V3HA 1MFUA 1F4HA 3CLWA 5CPQA 1I1WA 3TTSA 5BROA 1QI4A 4A4AA 4BF7A 1W9DM 1WZLA 2UY5A 1NWSA 2XVNA 4JHOA 1TVNA 3BMVA 2YKKA 3CTTA 2OSXA 2A3CA 4TUFA 4W87A 1DHKA 3AHZA 1VBRA 1B90A 2O9RA 3VMOA 3CUFA 3T2PA 2XGBA 2DT2A 3T08A 1CXKA 2VJXA 4B9YA 1G0CA 1W91A 3WIJA 4LPCA 4JKLA 4J27A 3RMEA 3SUTA 1JDCA 2VCAA 1IT0A 2VR4A 5IHRA 2QV4A 3OLIA 2W67A 5JUVA 3MMUA 1QNSA 1V6YA 4PCTA 3II1A 4UQCA 4XV0A 1IZJA 3T2OA 1JGIA 4FZPA 1MVYA 4E8CA 2JFEX 1VFOA 1VFUA 3PZMA 2ZX9A 2WW5A 2FH6A 3D5HA 3NDZA 4H8UA 1JIBA 2WVTA 2AMGA 4CCDA 3G6LA 1OM0A 1HF6A 5A8MA 2WC4A 2YDQA 1V02E 2PMRA 5D4YA 3VD5A 2EEXA 1FOBA 5CLWA 3UEQA 2J7FA 2JF7A 3ZM8A 5A6MA 1WDPA 2WHKA 4P7RA 5M3WA 2XVLA 4W93A 1J12A 2QF8A 1UKPA 4P7NA 1BLIA 3KL0A 1HVXA 3SCRA 1PPIA 3OIHA 2E9MA 4GQQA 3EDDA 4GINA 2J7HA 3ZO9A 2W63A 3B8SA 3WNMA 2YBUA 1GORA 4DWSD 3WDHA 4Z2LA 4NRRA 2FHBA 1QW8A 3LMYA 3IJ7A 2ZWZA 1EGZA 1JF5A 1J01A 2A3EA 2VO5A 2WMHA 1JZ7A 3WFLA 1E15A 1BG9A 2G4FA 2IXUA 3OLGA 1JAKA 1U33A 2PWDA 1X6LA 3PN8A 4UQ9A 1J9YA 1C7SA 4CD8A 3HMCA 1BYDA 1C8QA 1WDRA 3A3HA 4U2ZA 3TTYA 1OD8A 1ITCA 1UR2A 4MDPA 1K9FA 1PX4A 2FGLA 2O92A 4M80A 3WY1A 2OZNB 4PTMA 1US2A 1R86A 3DYMA 1B3WA 3F5KA 4PMNA 3CHFA 1UH2A 1OGGA 1XCWA 2YA2A 5HPOA 3TONA 1R87A 3OLEA 4W89A 3W29A 1VEMA 1UR1A 1ZS2A 2Y8VA 3O6AA 1JDAA 1CLVA 2WNWA 4TTUA 5A6AA 3FHAA 3WNPA 1UWSA 2VMFA 4MB1A 4OZOA 4EAMA 1C3FA 1LJYA 3ZJ8A 3BAKA 2X0HA 2CBVA 4MADA 1UH4A 2ZOXA 4PUEA 3BAXA 2FHCA 1TA3A 3SCOA 4AD2A 1V0NA 1QNRA 4CN4A 1ZBWA 4E2OA 1UKSA 2ZX8A 4NI3A 3AS2A 2CNCA 2ZUWA 3IAQA 5DO8A 1OGSA 3GBDA 2CERA 2PWHA 3GXFA 3TA9A 5I6SA 4AD1A 4BA0A 2ZX6A 1XGZA 3W82A 2FH8A 3N9KA 4X0VA 1EDGA 3LPFA 1NM9A 2NT0A 4W5ZA 4HOWA 1E73M 3WMBA 2DH3A 2C0HA 2O9TA 4AC1X 1FFRA 3SCQA 2ZXDA 4CCCA 1TA3B 1EO5A 3M7SA 5ECUA 1UKQA 3VO0A 4MNKA 1JYWA 4D6JA 3UETA 1N82A 2YDSA 3WQ6A 4JCMA 2WLYA 3RJXA 1UD5A 2XIBA 1CYGA 1KCLA 1E6ZA 1W3JA 2E40A 4U31A 3EDEA 3L4UA 5M5DA 4ML4A 5ABHA 3S2CA 2ZE0A 2CITA 2J7EA 1HN1A 4PMUA 3WUBA 2E4TA 4K68A 1L0PA 4PMZA 5C8BB 1WZMA 5E6YA 2BFGA 3RJYA 2ZUMA 4U3CA 1HKJA 1B2YA 3VUPA 5IDIA 3THCA 1Q6FA 4HZ8A 2NSXA 5D9MA 2XFRA 4M8UA 3PHAA 1NWRA 1Y7VA 1ZB5A 2GVYA 4CN1A 3I3BA 3WH9A 3CIVA 1CIUA 4QLLA 1H09A 1VEOA 4AIUA 4HMEA 1EDTA 3RM8A 1LL6A 4MTVA 1V3JA 2D1ZA 2DQXA 1UWIA 3I3DA 3FAXA 3WF2A 3VM5A 1JYVA 1PJ9A 1FP8A 3BMWA 3WQVA 4QLKA 3AS1A 4NSBA 2WBGA 2WCAA 1R85A 2QMJA 1W9XA 3RM4A 5CSYA 4GZIA 2VNCA 3AQUA 2WAGA 1CDGA 5A1AA 4MB5A 3EDJA 1NOFA 2W4XA 4LYRA 1CEOA 5I78A 3AIUA 4TVDA 4UQDA 5JIPA 1UG6A 2UWFA 1R7OA 3VD7A 4UTFA 4HOXA 1UD6A 2J7GA 1E71M 1MW0A 4R27A 1GOMA 2WK2A 5TD4A 4OJYA 1XH2A 2OWXA 1CGUA 4JFVA 1C8XA 1VBUA 2WMIA 1BGGA 3W4RA 3WBAA 1E0WA 1KGXA 1XCXA 4GKLA 5I3DA 4GI8A 1K9DA 4BQ3A 1NP0A 2XM2A 3VMNA 1B0IA 4JFWA 1M03A 4D1IA 3AOFA 3BAYA 3MV11 1JDDA 1KQYA 4TVUA 1UR0A 4TTGA 1JNEA 3VDAA 4P8UA 1D7FA 3E1F1 5BRPA 2WHMA 3OGVA 1C92A 1GVYA 1ZBCA 2XYLA 1KGUA 2WSPA 3KL5A 2ZX5A 3MUZ1 2WMJA 2WMIB 4M56A 1EQCA 5E70A 3ZJ7A 1GQJA 1HXJA 3L4VA 4HP5A 4AZGA 4RL3A 3AHTA 1C91A 3ARYA 5A6JA 4GI6A 3L2MA 1CXFA 2PF0A 4KMQA 1SMAA 2DT3A 1VFFA 1VENA 4TX8A 4UFMA 3VIGA 2O9PA 1CBGA 3VIHA 1HX0A 4AD4A 2WM0A 5C70A 1GQKA 2FDMA 5I79A 4AY1A 4DWSA 1E6QM 2CKSA 3N17A 1E1EA 1JD7A 1KBKA 1WCGA 4FLRA 1CZ1A 3KE0A 4W8BA 3VNZA 5A6LA 2V3DA 5EMYA 5ABEA 1VIWA 2CBJA 4FMVA 1GHRA 1JG9A 3ARVA 7TAAA 1VJZA 4GXPA 1IZKA 2DSWA 2EPOA 1ISVA 2G8ZA 1GNXA 1QI5A 1WKYA 4QCFA 1O7AA 1WAWA 2DSZA 2J8FA 3MUY1 1E0XA 5D9NA 6CGTA 4DWSB 1XHGA 2VZUA 3N04A 5CQ1A 5A95A 1OIMA 3W26A 1RPKA 1ESWA 2W61A 1NP2A 3WF3A 5FIPA 3N12A 1ECEA 1FA2A 3DYPA 1E70M 5E0FA 2OO2A 3OBAA 3GBEA 2Y2WA 3NUKA 1XD1A 3UR8A 4CD5A 1W1VA 1V3MA 1HJQA
chains in the Genus database with same CATH superfamily
4JYFA 4HA4A 3QGKC 5FSDC 2QF7A 3KP0A 1MO0A 4ORIA 3C2VA 3CUIA 2QJHA 2RAGA 3UESA 2MUCA 2WBKA 1E0UA 1M7JA 1QWUA 2D69A 2ABAA 4LB4A 3C3NA 1KV5A 2PWEA 2E5BA 3GKFA 3PZVA 4MM1A 3GFYA 4V15A 2PTWA 2YSWA 1TQTA 2QR6A 3BOLA 2CU0A 3W74A 2W62A 5G1MA 1DJWA 4D8LA 4AD3A 5D2YA 3VC6A 1N2VA 1F3XA 4YYFA 3CV2A 1QXLA 3BVJA 3DC0A 4NAEB 1ZP3A 3B03A 3R0DA 2QPXA 1ZAHA 1J2BA 4NZ4A 4NF7A 3T8QA 2JF6A 3RG6A 2J7CA 5HMDA 3TTQA 1TPH1 4PUKA 3I6RA 2H9AB 3VIKA 4H9XA 5LXEA 2A3AA 1HVQA 1LBMA 2HJPA 1T41A 5T91A 6XIMA 4DBUA 3EA2A 4L4PA 1ZALA 1B30A 3EX2A 2R94A 3L12A 4F3HA 2O7QA 3TWAA 1B3VA 2GK1B 2QCMA 4H8NA 3HPXA 1YTEA 2CHRA 1V6VA 3DHPA 3LXCA 3BCJA 2RJHA 5AYZA 2OEMA 1FDJA 3VNYA 5CPSA 3CT7A 1P43A 1JCLA 2PWVA 2YA0A 5D2TA 4G1KA 3CWOX 3GXMA 5XIAA 4JFUA 1QW9A 3SSJA 4LF1A 1KM0A 3D2FA 1VFLA 3B51X 4K1GA 1QBBA 2WVVA 3OPSA 1LLOA 4S39A 1V3LA 3L0KA 3LXBA 2YL6A 2QYGA 3BTNA 4KQNA 3ZJ6A 4MYAA 1H7PA 1NFGA 2P8BA 4K2SA 2A3BA 3LV6A 4J3TA 3BLOA 3UZ5A 1BWKA 1SSGA 4QP0A 4FZOA 4LTSA 2OW6A 4Y9AA 3QF0A 1ZP4A 1YTKA 4MY8A 3DHUA 1M5WA 5EMJA 3OVRA 5A8OA 4YTRA 3LA4A 4MWAB 4AY7A 2DPEA 1VFHA 3SFKA 1TQVA 1JUBA 3ALFA 3DBNA 1MDRA 3MSGA 3VFCA 3P6LA 3WQGA 4ZEPA 4ZO9A 5LHEA 5E84A 1R3TA 4F66A 4ZE5A 3E74A 2VGFA 3K13A 1OYBA 2TYSA 3TDFA 3TWBA 2CLEA 4RE2A 3HURA 2IKJA 4P8XA 3IRDA 4G7FA 2I9UA 3W1LA 4H9VA 3EB2A 2Y5JA 4L5ZA 1VCGA 3IGSA 3UG5A 4AYSA 1UUMA 4ZE4A 1DOSA 1A47A 3OBKA 5CG7A 1OABA 1EJ7L 4E2DA 2H8XA 3MTWA 3O3OB 3HQPA 1J93A 1M01A 1OC7A 2QFFA 5F4WA 1SZEA 1VB9A 1KRMA 3DFYA 2E25A 5C9UA 4EX4A 3GYEA 3UPBA 2G97A 3KM8A 4WDTA 4XKYB 2E0PA 4P5UA 1H41A 2DZPA 3V1HA 4RDWA 4JN7A 4CU7A 3TN4A 1EF3A 1PBGA 3NOYA 4IUOA 3G3DA 2F7PA 3BLEA 2B0MA 5CC5A 3EXSA 1Q6DA 1TE1A 4S3FA 3UF9A 4R5LA 1C7TA 1KFWA 2WZTA 4Q7BA 3CUGA 2PTZA 3NZGA 1DXEA 3KOZA 1BVZA 3UWQA 3CM4A 2WJZA 4MJMA 5AC4A 1J6PA 1R3SA 1CENA 3G6MA 3GAYA 3QHOA 3EBVA 5C9RA 1PVNA 3OJGA 1EX1A 5DELA 4H9ZA 4HN8A 3BV4A 4TR9A 4TQTA 3G0SA 3WCZA 1NDVA 3DX4A 3DX5A 3EOOA 3MJYA 3WD1A 2OQYA 1QHZA 1U22A 2V5JA 4LOCA 3KZPA 5E5CA 4AZCA 2WKGA 2XSBA 1V79A 5JXQA 4IXXA 4TOQA 1JULA 3GXTA 3HM7A 5FAGA 4O1FA 2DT1A 4S3KA 3WMLA 4PMVA 3QZAA 5D05A 5HULA 1WOBA 1AH3A 2P3ZA 4HA1A 4G6CA 3CAWA 4C6MA 4C6CA 3T81A 4HHLA 8A3HA 2WYIA 1GZJA 3EB3A 2OYLA 1QR7A 1GG0A 3OG3A 3BLDA 3OG2A 4JL2A 4CNUA 1S2CA 4H04A 1YDOA 4ZGYA 1FWCC 4D6CA 3MS8A 3S8HA 3EX6A 2W9MA 4MJ4A 5LIYX 3LCXA 4D6GA 3M0JA 3NURA 1TPB1 1A5CA 1UPMB 3H55A 1UR8A 1KCXA 3CU2A 1LQ2A 2XM1A 5E6ZA 1RALA 3LPPA 4R5GA 2HWGA 4EKJA 3CHDA 4NPHA 1XFBA 4B5WA 1Z41A 4S3EA 3IIPA 1E3XA 3ZLGA 4B3LA 5EFFA 3VVGA 1EO7A 3GHUA 3I65A 2QCFA 1XIIA 3EJQA 3PZQA 3KRSA 1AL7A 5C9WA 1ITUA 4W7VA 1TMLA 4WJXA 3GU9A 4S3JA 4GD0A 4I8DA 1VP5A 3K4DA 2PWUA 1YDYA 1EOKA 1EB3A 3CUJA 2KX9A 3OBEA 4UTJA 3EX1A 2ZRXA 3OLDA 1XD0A 8XIAA 1QNPA 1EZ2A 5AHFA 5CZTA 4F2UA 4B4FA 1LG1A 5FL1A 4UFKA 4Y90A 2VT0A 1JI1A 5JMUA 1R47A 1O6IA 4M81A 5F1VA 3WYZA 3TMQA 1QDSA 3AIEA 4GGBA 3WF0A 4TX9A 1NARA 3MQTA 4B5TA 5CC3A 3W7QA 3LHWA 3ARSA 4AVOA 3KW3A 3HGOA 1JF6A 1JRCA 2VDIA 4KEVA 5AYIA 2PLCA 2PDGA 3QC3A 4Z1YA 3T8LA 1OF6A 4D6EA 3G5EA 2FZ9A 3QHMA 4IPPA 2HE5A 2WVSA 4X61A 1O68A 4UFLA 2QVHA 1B1YA 1QHPA 1HJUA 3Q65A 3H24A 4UOZA 3MCMA 4HNOA 2ZUNA 1GEQA 5LA2A 3AMDA 4PMQA 3RITA 1S46A 3PS7A 4GNKB 1MQPA 1T96A 2J75A 1CGYA 1W3IA 1Q6RA 4P7LA 3LY0A 5FF7A 2J47A 3ISIX 3WQCA 1R5EA 1I0BA 2J66A 3ME3A 2ZXAA 1AW1A 2Q6ZA 1CXEA 4GK8A 3NYZA 2VD9A 2V5DA 3N9RA 1V3KA 1NVMA 4N42A 1WYIA 4UMAA 2DJLA 5DLCA 1CGVA 4DBWA 3W1AA 3WNKA 4J3VA 3SM0A 3UPMA 3SCUA 1J6OA 3GHSA 4A8LA 2QVNA 2HDJA 3RRXA 1XLBA 3T0TA 3R94A 3KBSA 3KOXA 5I5RA 2VEMA 2I14A 4H01A 4PUJA 3SY1A 1BXBA 1E6SM 2ZXBA 3FGCA 4JTFA 4PN2A 4H6QA 4KT2A 3R7MA 1P5BA 1Z3NA 3VIFA 4GYFA 3I04A 3QZEA 4B5UA 1C93A 3W1XA 3PZNA 2WC3A 3GH4A 3MUAA 5EMKA 2PC4A 3L2LA 2Z0VA 2ZBTA 2EJ1A 4FNPA 1IXNA 3DYOA 3QKEA 3B0YA 3DERA 3NSNA 3LERA 3MU7A 3W37A 5M1TA 3BC9A 1VS1A 3WH5A 1I4LA 5KITA 4JAWA 4D71A 1VRXA 1GVSA 2DSKA 3DFSA 3KVMA 1W17A 3QZ6A 3RIKA 1KFBA 3CMJA 1TELA 4S3CA 1GTHA 2PSNA 3T0BA 1AMYA 3B8VA 4A3QA 1N8IA 2HISA 3MVTA 3VIOA 1VZWA 2GUBA 5CAHA 2YJQA 3LDVA 1B9ZA 1FWIC 1KO0A 3FXYA 3ZVHA 5HQEA 1ITXA 1QPQA 4OUIA 5CJ5A 1DP0A 1IXOA 2CLLA 2PWGA 1NJJA 1AJZA 3IV3A 3Q58A 2C1IA 2PC8A 1TPWA 2DUAA 4DO6A 3UR7A 5I3HA 1JDFA 1F05A 1OX5A 4MPKA 4H6EA 3IJQA 3QOKA 3B97A 4UDYX 4AZHA 3M6DA 2WC7A 2YCIX 2OBLA 1QNOA 2FB2A 2XGIA 4AZBA 3PC0A 3W7OA 5AHEA 4LY4A 5BW6A 3BL3A 1H50A 3SECA 3OVQA 3FVMA 3MWAA 2ZX7A 1FFQA 5DQPA 1X96A 3T44A 2L5HA 2YB1A 4GOAA 3EXTA 2BGSA 1XXXA 4PCFA 2VURA 2Z27A 4UFHA 1XCFA 4RE3A 2ALWA 1M7XA 1UBSA 4NI8A 4BWLA 5DT7A 3CV5A 3FY1A 3H7VA 2XWDA 1X1NA 3ITLA 3HJEA 3VCCA 1XQLA 3FIGA 1OFQA 3H7RA 3VGGA 2DSVA 4E2VA 4BKNA 2GFTA 1XBYA 2Z1BA 2IXVA 2VCBA 3CHEA 4YL2A 3DXIA 4RW3A 4QM1A 1TQSA 4ZB5A 4W8LA 2PRLA 2EQDA 3O15A 1OCBA 3P2VA 4AIEA 4POCA 4B2DA 2PPGA 3AROA 3RDKA 4L56A 3VOIA 5DT5A 1W5OA 2UY3A 4UTKA 1JXKA 1TIWA 3QR3A 1KA9F 4C5ZA 1IGWA 4XAYA 1ZSXA 3IPWA 3WK3A 1M53A 5TBOA 4H9MA 4KETA 1KXQA 3WQFA 1SJDA 1VPXA 3EEGA 3WDQA 3WQ4A 1EKOA 1PZ2A 3POHA 1H3GA 3AZSA 3UGVA 4FPSA 3ACOA 4PO2A 5KBPA 3PR2A 3PTQA 4S3GA 2V0TA 1K8XA 4IOTA 3TOYA 5LIKX 3BAIA 2CESA 3MMTA 5CGQA 2PDQA 4HYBA 1G4SA 1VFSA 3H2CA 4WPCA 5GVJA 3G3MA 3CZKA 4KIKA 2IKHA 2R91A 2OYMA 4HZ7A 3GNOA 3A9BA 4PYSA 3E2RA 3PF3A 3KLLA 4UFIA 1LUCA 1BXNA 2YW3A 1VJSA 3TAKA 1V03A 5CBIA 1F6KA 1CWYA 4HCDA 3SCVA 4IP7A 4XZMX 3HGSA 4I5UA 2OU4A 1KGWA 2PI6A 4GNVA 4HY9A 3BVVA 1WP6A 5A8PA 3BH4A 2A7RA 4KPLA 1PKLA 5C2CA 3GNRA 1QOQA 3KL3A 2EPKX 2PAJA 1UOZA 3FVDA 4AHOA 1HIZA 1SW3A 1TWDA 3FKKA 5BU6A 3H22A 5D04C 1G1YA 4V27A 1ISWA 2FJKA 2GGEA 5LA1A 3P5YA 1Y0EA 3R79A 4N7QA 4PMYA 2VVSA 3KVKA 4S2CA 3LZ3A 4LAZA 1KCKA 1W3TA 4Z2KA 3WLIA 3LLDA 3K8MA 4N9EA 4HPHA 2GVLA 3R8GA 4CCZA 4IWWA 3U6WA 3KRZA 3VDHA 3WLTA 4K37A 1YHTA 1VCFA 1HQTA 2G96A 4GWEA 2ISFA 2VWSA 3BARA 3STEA 3QV6A 4O53A 1UWQA 2D4CA 1QNVA 3PNZA 4FF7A 1Z32X 4EIVA 3GTIA 1D3GA 1TV4A 4HR1B 2Y8KA 1SFTA 2NW0A 4KCWA 1TV8A 4LNCA 1DVJA 2JE8A 3GH5A 9XIAA 4JHZA 3WLMA 1KTNA 2V8ZA 1XH0A 5A3HA 4TVCA 2EAWA 3IIVA 3UJ2A 2YDRA 5AKQA 3K4WA 3G8EA 3DDGA 3QOMA 3C2EA 1GVFA 4MKSA 5A6BA 1IF2A 1IIHA 2Q13A 1ISXA 1Z42A 4NYYA 4E3TA 3C2YA 3CBWA 3ZT7A 4MGGA 1EJWC 2G4JA 1K7FA 4N4QA 3IANA 4YXGA 2VZTA 3C7NA 4TO8A 4N9CA 5A8GA 1W9UA 1US3A 3MHFA 1UWAA 2CWNA 4XISA 2RAJA 1LT7A 1GKQA 4LVBA 4HU8A 3MWCA 1R38A 3C0SA 3ONBA 4C6KA 2F6XA 4JIEA 3AXIA 4H3DA 1TWIA 4LS1A 1TTQA 3CVRA 4AF0A 3GX9A 4IIBA 4QE1A 3RR1A 4HOZA 1C8VA 4GIYA 1KFCA 2X41A 1FY6A 5LSMA 4PTXA 3GIPA 2PDUA 4P2VA 3LM3A 5A2AA 4BK9A 2X16A 3QHNA 3MI2A 1W1A1 3C3UA 1A5KC 2CEQA 4BCEA 4KW2A 1W32A 2GGJA 3L3PA 2HXTA 4JIIX 4CNTA 3TTOA 2ASHA 4B91A 1PTDA 4LW7A 3CUHA 1PIGA 4JN6A 2JIWA 1GZ1A 2V38A 1I1XA 3LHYA 1GJPA 5IBXA 4MJ2A 3CMGA 5HPCA 2DDXA 3WQ5A 1FDYA 3UVIA 5FD0A 4DM1A 3DX1A 3CO8A 5FF3A 4O11A 2JEQA 4ADUA 5CKSA 3P84A 3A9IA 4Z0JA 3IVUA 3CS2A 3DYTA 3AICA 4HK7A 4UC5A 3DFNA 1NDYA 4OE7A 2PFHA 5EYWA 3RRAA 4GUHA 4H8VA 4GPNA 1I2RA 1HNYA 3PUDA 1CLXA 4KRZA 2Q01A 4LUJA 4EAYA 2XJ7A 4LCQA 2CYGA 3PZOA 4M3PA 4J7RA 1RP8A 4LALA 3MP3A 5I06A 2PP3A 2BGQA 4IL2A 4EZQA 5MKGA 1JZ8A 5HQMA 4JKMA 4KF1A 4XZLX 3KWXA 2GQ3A 3F4WA 3M0ZA 4CNPA 1WQ5A 3LD5A 3QGAC 3SURA 4GJ1A 4QX4A 3ZSTA 1ISZA 4JD4A 1E56A 1V6WA 3PWGA 3F1QA 4BJHA 1IT7A 3BLFA 3VCRA 3NQEA 2AL1A 3W7MA 1P0BA 1H1NA 1O95A 4IPIA 2GJLA 4QBXA 2J62A 4NJGA 1AL8A 4MAVA 1XYFA 3WN6A 1YX1A 4H9UA 4A3HA 1ODZA 4GUJA 4KRTA 1BYCA 4L64A 1TZZA 3M47A 2WCSA 3DBPA 4FXFA 4GG9A 3WD4A 3AU2A 2GJXB 1W3HA 1KQZA 2YI8A 1OX4B 3PG8A 1POJA 4I9MA 2NQJA 1W1YA 3O06A 1MXGA 3QLDA 2XINA 2ISWA 5XINA 1IHIA 3GC5A 5HNRA 4ICMA 3N6JA 3GTHA 2W66A 1O5XA 4HYWA 1DJHA 4U5KA 4JNMA 1OINA 1ONRA 3WLLA 4FNTA 2VWTA 4X0NA 4BF9A 5FEZA 5A6TC 3WSUA 4JX5A 4NY2A 1KR1A 4W86A 3G1FA 5E0KA 2NVDA 4DI8A 1M3UA 3ZQ9A 1MW1A 3KS5A 4L9ZA 3WZ0E 5IM51 2J6XA 3NQFA 1P6BA 4A8RA 2UZ9A 3LTPA 5E9AA 3E0FA 3N2XA 5G4HC 3TXVA 4NJIA 2BS9A 4A3RA 3NZPA 2B7NA 2EX3B 4N6FA 3OO2A 3RFAA 2V2CA 3BLPX 1YNYA 2XN2A 1EA0A 1JRBA 1TWWA 3ERPA 2HPIA 3SUWA 3CT2A 1FQ0A 5I3JA 4ZENA 3B04A 1CI1A 3BGGA 4HQVA 2YXOA 1R8LA 4XAFA 4DB7A 4HA0A 4L7ZA 1A0DA 1IXQA 3P82A 1XP3A 3V75A 2H3DA 4H8HA 3AALA 5A8NA 3HPSA 1MRAA 4MYXA 3ES7A 5C0QA 3N1AA 5BYWA 2QJNA 3CYVA 5GPRA 2GOKA 1U83A 4HTBA 1EPVA 3ARXA 4G56A 4C7FA 3CQ0A 3EKGA 1PCWA 5I00A 3M5YA 1ZCOA 2JBMA 2ATSA 4DBEA 5BROA 1AH4A 3T42A 3V35A 3LHUA 4BF7A 1W9DM 1WZLA 2FB3A 2XVNA 1TVNA 4O1CA 2OSXA 1A53A 3LN3A 2W79A 3QPZA 4CLMA 4FNRA 3NL3A 1MUWA 4M1BA 3VMOA 4QJ1A 2AKZA 3B8TA 1S2WA 2DT2A 3BLLA 5D02A 4KESA 2HSAA 4AWTA 4J27A 2QCEA 3RMEA 1VQTA 2VCAA 3WQOA 2X1TA 5IHRA 1GEHA 1O5RA 2BSLA 2FPYA 1IZJA 5DANA 2C1HA 4ATMA 3CV1A 3MHUA 3DPQA 3W72A 3NDZA 3KP1A 5I3IA 2WVTA 5AZ1A 1C29A 3LCLA 1V02E 5D4YA 2EEXA 1UC5A 3UEQA 2EFLA 2JF7A 1DJXA 2PP0A 1WDPA 2WHKA 4TU1A 5M3WA 3P0XA 1YMYA 3H21A 1UKPA 3TQ0A 1S1PA 4ZFCA 3KL0A 3TE9A 4P61A 4DY1A 1MNSA 3U0HA 1XYAA 3PBUA 4UUIA 5BU9A 3QQ1A 1UJPA 4C6IA 4PR4A 2O7SA 1UPPA 1WAUA 2FZDA 2FHBA 3NVTA 3LMYA 2FTPA 2ZWZA 1JF5A 1J01A 2VO5A 2WMHA 5HWNA 1UPXA 3CAZA 1BG9A 2VELA 3EWUA 2X1UA 2PWDA 5K9CA 3PN8A 1J9YA 4J4KA 1DJIA 4CD8A 3QKZA 3AO0A 4U2ZA 1OD8A 2BOEX 3KRUA 2GUUA 2FYVA 4R7WA 4MDPA 2ATMA 4M80A 5HMSA 4PTMA 2YCLB 4QITA 4JQAA 4Q6XA 3F5KA 2ZRUA 4IW0A 4WY0F 1RJRA 3NQ2A 2EKCA 1XCWA 3KXQA 2YA2A 1L2QA 4B5XA 3OLEA 4W89A 1VEMA 1UR1A 3TMLA 4R9XA 3BJFA 2ADAA 1CLVA 1DJYA 2WNWA 3WNPA 1FUYA 1C3FA 3QN3A 5LGZA 3ABHA 4MADA 2X0HA 2ZOXA 3R58A 3BAXA 3BOFA 3CYJA 3SCOA 3WQEA 4CN4A 2ZTJA 3AC0A 4L9XA 4GH1A 3S1UA 3LBMA 3CH0A 4PRRA 4B90A 1ONWA 1DL3A 3IAQA 5DO8A 1OGSA 3GQYA 2BMBA 1BVWA 1QRQA 2PWHA 3AUOA 1XGZA 2Y61A 3W82A 1EDGA 4W5ZA 3WX7A 3UZWA 2GF4A 4PUWA 3WO8A 2C3ZA 1DQUA 3R43A 3I4EA 1QO2A 3PFRA 4CCCA 1F8IA 1YBQB 1XRTA 1QOPA 2PS2A 4V1XA 3CEPA 2Q8ZA 3RJXA 1T8QA 2XIBA 1RAKA 2XISA 3IV8A 2C79A 1GN9A 3UR2A 3L4UA 1KFJA 4DNHA 5ABHA 4AUBA 2ZE0A 2JNSA 5F4XA 1VD6A 2J7EA 1HN1A 4HKPA 2OT0A 1IR1A 1SR9A 5C8BB 3MCOA 2ZUMA 3TW9A 2BLEA 3FSUA 3R4IA 1FDZA 3RNDA 5B80A 3VUPA 2BP1A 4NP7A 3EGJA 4R7OA 3MO7A 3OIXA 2YW4A 4PUUA 5T8GA 3T78A 1E9ZB 3OZYA 2V9DA 3PHAA 4H7CA 2GVYA 4DJEC 3I3BA 3EPMA 3OP2A 3CIVA 1CIUA 4DNMA 4QJ4B 2E67A 3A5VA 4HNTA 4IXHA 1Q85A 1EDTA 4MTVA 4U10A 4Q4SA 3FAXA 3W7KA 2ONEA 1JYVA 9XIMA 2Y1HA 3U2OA 1PJ9A 3HV8A 3WQVA 3P74A 3M64A 1EZWA 3C5QA 1R85A 2WPBA 4IFKA 1ICQA 4HIBA 2REQA 5TIMA 4NJJA 3USBA 4UTMA 4AF0B 1S5WA 3EJRA 1CDGA 2HXUA 1VFTA 2R6OA 1A0EA 3AIUA 3HTWA 3UNTA 4GY0A 1NFBA 3MSYA 1UG6A 1X7FA 4X9SA 3NGFA 2VGIA 2UWFA 1R7OA 2PP1A 2P53A 1BEUA 4HOXA 3B0VC 5C7VA 4JICA 2P1FA 2C6QA 5TD4A 3GB6A 4WGHA 1ENUA 1XLIA 1CGUA 4IP5A 4AU0A 4JDBA 4FHAA 3GY1A 3W4RA 1RA5A 4LANA 4YWIA 1K9DA 1KBJA 1CLKA 1NP0A 2VFIA 2IPGA 4GYPA 1UR3M 4QXIA 5CJMA 1S2TA 1D7KA 4PL1A 4ICCX 1UR0A 4JWDA 2GJNA 4P8UA 5BRPA 2WHMA 3OGVA 3GVQA 2XYLA 3UY8A 3TC6A 2WMJA 3HA1A 3O3NB 3TW6A 4BY3A 4FR1A 1HXJA 1SU8A 4PGLA 1PTGA 1Q63A 1VR6A 3EPNA 4HP5A 1EJVC 3BZGA 1C91A 1FCQA 2ISSA 4L6HA 2E1DA 1SU6A 2QXWA 3VIGA 2O9PA 4A6GA 2WM0A 2CXEA 3TZFA 5AN7A 4DAIA 4ZOAA 4RPPA 4UWMA 4AY1A 3W1QA 1EGMA 1SJBA 4H6RA 4R9OA 2CKSA 3N17A 3ER9B 1KBKA 5DY3A 3EA1A 1H5YA 4JLCA 3L65A 3VNZA 4RDVA 4ZBCA 5EMYA 1SM9A 1VIWA 5I7GA 1GHRA 1JG9A 5FJOA 1WDDA 3GHRA 1IZKA 2EPOA 1DPMA 4K38A 1BRLB 4PODA 1F76A 1QI5A 1EP1A 3UR5A 4QCFA 4B92A 1QATA 1R3QA 2I5IA 2W0UA 3PPGA 4IWOA 4IIEA 3UWZA 4JTIA 1DKXA 2J8FA 3MUY1 4F0SA 1EP2A 1DJZA 4FNUA 4EXBA 5A95A 2OO6A 5CQ1A 4HGXA 3LGDA 1TV2A 3HIJA 1XFCA 4RUBA 3W26A 4IWQA 3LCGA 3I7QA 5FIPA 1KD0A 1QK0A 2J13A 1E70M 4GGHA 3KDOA 3OBAA 3EWZA 3GBEA 2Y2WA 4GC3A 2NZLA 1M9HA 3UR8A 1MUCA 2Y5SA 4QROA 1R2SA 3TEVA 2DZSA 4AB4A 1E9VA 4ZMGA 2QJGA 1G69A 1RBLA 1NOWA 4CGTA 2J4GA 4L65A 3WJYA 1HO4A 2X2GA 3FXGA 3LEPA 3PJWA 3OB8A 3XIMA 1B3XA 3U2EA 2XVGA 4DUWA 4LH8A 2ZRYA 4ZTXA 1UOKA 1ZBVA 4QNEA 1DORA 1EUAA 1YPIA 1IWAA 3P14A 2QAFA 3BUQA 1BWLA 5L9FA 1G5AA 1MZHA 4DO5A 4WKAA 2Y63A 3O6DA 4Z08A 3TK7A 4DLMA 3QVQA 4J28A 4NQIA 1XISA 3AIBA 1K9EA 1WO2A 3IRSA 4PRWA 3WH8A 3RGTA 1Q45A 1LL7A 1U00A 1QFEA 3NO3A 3T55A 5CLTA 4EE9A 3UXLA 3R5EA 2BXZA 3AS3A 4D8ZA 7TIMA 1U1JA 5ABFA 1ML1A 4REQA 3I7SA 1PSCA 3CHVA 5IFTA 2HNEA 5AVNA 2QNEA 4I9TA 5K4ZA 3W1PA 2P50A 3CPGA 3F7WA 1Q3NA 2CW6A 4H19A 2LXYA 1I4TA 4LB3A 1XM3A 1BVNP 5FF2A 3U7BA 1BTCA 3FLUA 2F7OA 5AYBA 2X3WA 4GX9A 5JBDA 1O1HA 3W85A 4EZVA 4JR5A 2QCGA 4C91A 3V7PA 2WHLA 3MO4A 4M5PA 2PU0A 1JZ3A 2PDCA 1QBAA 4N9BA 3VOFA 3KAOA 1ZNNA 3V4BA 4G7EA 2ZZ2A 2D24A 3QGVA 2PDIA 3VA8A 1KWGA 4G5DA 1I4DA 3TFXA 2EKGA 5F7UA 4HSHA 4U3AA 3KBWA 1JFHA 5H2ZA 3HZ3A 1FH9A 5CZ0A 1V0MA 1E3ZA 4CD7A 3MMWA 1LOSA 5GNXA 4GCAA 1X8FA 2HK0A 4NVTA 1UR9A 1WE5A 3SO7A 4RZ4A 4RK8A 3PSWA 5J04A 4PTNA 1KBIA 2FYMA 3TYUA 1Q4WA 1H49A 4JTKA 5G2IA 1OYAA 3L4YA 3DESA 3EEZA 3N18A 3LI0A 4WSJA 5D8ZA 4MJZA 3XINA 4NJKA 3GVWA 4L6OA 3B9EA 3HU7A 2BY0A 2YKTA 2C19A 3CL7A 5LIXX 3ENLA 4U2YA 2ZCGA 3REQA 3WDPP 1SO4A 3B40A 1XDMA 3BZJA 1L6WA 1E6RA 1PAMA 4Q22A 1F8MA 1FBAA 2D22A 1CECA 4V33A 4IMAA 1E9IA 2PEVA 3W01A 4I7VA 1XIJA 1H0GA 1L9WA 1E4LA 1TPDA 4QDMA 1M04A 1JZ6A 4Q8UA 1FWEC 1U5VA 2Z0NA 2V3EA 3G1YA 4XX6A 3LCWA 5HWJA 2XN1A 3MYOA 2VC9A 2IKGA 2O56A 5BXPA 4A8IA 4CQ9A 1OZMA 1W5MA 3LGEA 3RYSA 3BUPA 3GM8A 2G0WA 3O05A 5EMMA 2WLZA 2R24A 7A3HA 2F84A 4TXEA 2VOTA 1YPFA 1AUSL 2VR2A 2WSKA 4IG2B 1RXOB 3A4AA 1T6MA 1GCYA 2WMGA 4Y96A 3TFCA 2Y7DA 1E4IA 4UB9A 1QPRA 3TR9A 2PCQA 3CB8A 4FS9A 1OEPA 1W9MA 4FLOA 3PSVA 3C2FA 1QVBA 1IWPA 1N55A 1S1RA 2QCDB 1BSIA 2OWCA 1YTDA 4C90A 1H7NA 3QLLA 3I7RA 4NZ5A 1AVAA 4P8VA 4AHQA 1WX0A 3MY9A 1VC4A 2XSAA 4EF8A 1J0HA 4O0KA 1V0LA 2Z1XA 3OYZA 2RKXA 3BGAA 5AVHA 3VNMA 2HROA 4B4HA 4MLJA 5KINA 1E9YB 3K8KA 4GIRA 2XVKA 1F6YA 3NQDA 1LTDA 1TCMA 2NQ9A 5CGMA 3TTEA 4Y9OA 1H62A 1EXBA 3DC8A 1MXDA 5HMFA 2E5CA 5GJPA 2BOGX 1REQB 2VQUA 4Q6JA 4MDOA 1X6UA 2VGBA 1I6NA 2EHHA 3CO4A 3R6IA 1I2NA 4MUPA 4KWUA 2OOGA 3FJNA 2XH2A 1SZGA 3AWOA 4W85A 4ACZA 4JYEA 1FHVA 3PBGA 3ORWA 4LFYA 4H2HA 6A3HA 1B9BA 4NL1A 2VQTA 2PDPA 1Q6QA 3G1VA 5DCEA 2WHJA 1WDSA 3DPPA 3HN3A 8CGTA 3AYSA 1S5NA 3ZLHA 1FP9A 4YJ5A 6XIAA 3FEQA 3BVXA 3DFPA 2Z7KA 4F0RA 4H6KA 4LVGA 5BOFA 4M6UA 2E6DA 1GJWA 3TZNA 3CC1A 1A5UA 1ZGDA 5HK4A 1CW2A 4IQJA 4D6FA 4NYUA 4MLRA 2V2HA 3ZSSA 4CD4A 5HR6A 3GDTA 1IEVA 3SI9A 4PTDA 3S2MA 1XF0A 4K8HA 3GR7A 4JDYA 3T4AG 1O66A 3R0KA 3GXDA 2Z2AA 4PE8A 3ZT5A 3WNLA 1K8CA 1F5ZA 1UASA 2HS8A 1JL8A 2AGTA 4R33A 4NZJA 5HNNA 3SBFA 2QPSA 5HR7A 2FZNA 1C9DA 3MBFA 1MUMA 4UOQA 1CXIA 3W7IA 2NVAA 1TJ2A 1AQMA 4K1WA 2BXVA 4GNJA 1JFXA 2XZ7A 1V7AA 2PUZA 1KM6A 3C0QA 3T9PA 3D46A 1BFNA 1JNDA 2UBPC 1EJUC 3ECQA 4CU8A 1A5OC 3KHDA 3VDGA 3GVVA 1ONEA 1D3CA 2Z8YA 1TWSA 3TLQA 3NM1A 1MJGA 2VTFA 2Z6IA 1CXLA 4JL1A 3WL0A 4P7OA 1Q6OA 3UWUA 1Q7ZA 1C8YA 4DWDA 4F0KA 4XAGA 1JUKA 3FA4A 2CLOA 3M4HA 3L2IA 5LNWA 4ALDA 2GL5A 4RR4A 2HRWA 4R3UA 1HL2A 1ZQ5A 3SYVA 3G77A 3WH7A 3DENA 2RGLA 5FAJA 5FJRA 3S0CA 2Y7GA 3P8JA 2YLLA 1HKIA 4C7GA 4QQ3A 3NEVA 1DJGA 2C0AA 1SO5A 2BY3A 4NZ3A 3VIJA 4Q8VA 4I9AA 2E8YA 3EOLA 1TSIA 1XL9A 2F38A 4IL0A 4IIDA 2J25A 1QPKA 1H7WA 4GIEA 3TNBA 4AXKA 3A4JA 1VPQA 5I24A 5HWMA 4HNNA 1TJ0A 1QWGA 2FFIA 1HWWA 4Z2HA 2BXYA 1KXHA 3WQDA 3N11A 3GHTA 4DZAA 1XC6A 4DJDD 1XLLA 4OOUA 4PCSA 3EJUA 2PTXA 3DECA 4CQ8A 3BPWA 4PMRA 2ISVA 3L67A 1PXGA 3W75A 1UD4A 4W7UA 3AMKA 2Z29A 2J74A 3EOEA 3ERCC 3HFYA 1B4KA 1G4PA 7XIMA 4JQ2A 3PY2A 2FGBA 2E9LA 3BG5A 4R5EA 4K39A 1E9LA 1UR4A 1XIEA 3PZIA 1Q65A 2DU2A 3W6MA 4C1LA 4D72A 3HV9A 3SY5A 4HD5A 1NY1A 3ZMRA 3QV8A 5C7HA 2D1LA 4JHMA 4FZIA 3QYSA 4M1RA 4HA3A 3PZ9A 3RX2A 5IRPA 2RJGA 1WKEA 3SOGA 4IM3A 1ISYA 2NXGA 1SYTA 1IEQA 2QZRA 4XSLA 4J2MA 1UJQA 1RLCL 5DBUA 1P0KA 1KTCA 3NDOA 4ASTA 3UP8A 4NAFA 2FMNA 1BD0A 5KZ6A 2ZADA 5C71A 4MY1A 1DQWA 3RK8A 1E4MM 4FX6M 2VFFA 4KBXA 3PPHA 3RLUA 4FOUA 4J1OA 2X09A 2KAUC 2FJUB 5B7ZA 2V0OA 3S46A 2FTWA 1EQPA 1UA3A 5DY2A 3CAKA 4JTTA 4M29A 5KTLA 3CNYA 4GY1A 3WUFA 3WEMA 1DHPA 4OBRA 1T5AA 3WDRA 2ZRZA 3LRKA 2NV2A 4L6DA 2NSOA 1KKRA 2SFPA 3P67A 1DXIA 2Z1SA 3VDCA 1X03A 1JPDX 2FLIA 3URBA 5LHFA 2BNJA 4AW7A 5G2WA 2AOSA 2HCVA 3QFEA 3MUXA 2ZZ7A 4A35A 3I01A 1EIBA 1RJPA 4ZB2A 2G37A 4LCSA 3R13A 4DXVA 3EWDA 5ABFB 4IQLA 1D3HA 3S9ZA 5LA0A 4ML9A 4XB3A 4U33A 1AQ0A 3FN9A 1G9HA 3LYEA 2YI9A 4MKVA 2Y8UA 2ICSA 3ANYA 4DCNC 3SADA 3NQVA 3T0CA 3HFTA 4B16A 3P8IA 1HP4A 2PZNA 4M6VA 5REQA 4LVAA 3W81A 3ZIZA 1GQLA 3PZUA 4QSHA 2CIPA 3DKJA 4US6A 1VCVA 1Q4NX 3BLIA 3CKDA 2P88A 1J18A 2FFCA 3E5PA 4L4LA 5CG0A 1WUFA 2YR1A 3PB2A 5AC8A 1M7OA 3GW0A 4DO7A 4JX4A 4EPEC 5F2GA 1PB0A 2EPMX 3HQOA 1E43A 3UYIA 4ERGA 4E5TA 4MFDA 4DELA 1EH9A 3CZ8A 4WIWA 3DG3A 3RPMA 1Q66A 4HYRA 2R9RA 3WENA 4BI5A 1HZYA 3KRBA 5A2BA 2H8ZA 4XUGA 3GI7A 4S1FA 1EWDA 1H2JA 5HBFA 2WZMA 4MHBA 2VX4A 3D2EA 4C6OA 1BF2A 1ADSA 1CB2A 5D2WA 3K30A 1B3YA 3EYPA 3JUGA 4XZBA 3W7PA 5KZDA 5M17A 1QPOA 4RE4A 1B4EA 3ANVA 1HJWA 2YDAA 3LTSA 1YDVA 5K2ZA 4M82A 2OJPA 4Q7IA 4JWEA 1BQCA 4NU7A 5IFPA 3M5XA 4PCNA 1K77A 2WNZA 1GW1A 3REQB 1AK5A 5EBAA 1G94A 1VLWA 5I09A 4AD0A 4N4PA 4C1NB 1T40A 2NX3A 3NIYA 3NL2A 3BSMA 3M44A 1TR9A 5AHLA 2VRQA 4ZQCA 1I49A 2GSJA 2V5BA 5C2GA 4JNZA 5DMNA 1VHNA 2XU2A 3WQPA 2C8NA 2XIMA 3O6CA 2WQDA 4MIMA 2QGHA 3DZ1A 3UCCA 1BGAA 3A4XA 3A22A 2DQWA 3TJ4A 3AYTA 2CZVA 1ALDA 4A3UA 1XQKA 3ARQA 3IAPA 4H4IA 2Y85A 2W91A 4OU1A 1IR2A 5C6MA 2GLKA 1I2OA 5H1WA 4INFA 4DYEA 2IUZA 4Z0SA 4AEEA 2A0NA 5T9BG 3KAVA 1YADA 4R5JA 2GZXA 1A5BA 2JIEA 2VC7A 3SGGA 4BQ2A 3LPOA 1TIMA 1AA1B 3BCDA 1UB3A 3S2JA 3ZR5A 4BWLC 3CEUA 3VEAA 1ME7A 4J3XA 3MA8A 3N29A 4GFSA 1WXZA 4GVFA 2WPGA 4Y9NA 2F8QA 1UHVA 1I9CB 1VYPX 4Q8TA 2BVWA 1EJXC 3I6EA 1SFSA 2YIBA 1FWRA 2UY2A 4WR3A 3WL1A 1D2KA 3D4YA 3WLRA 3UZXA 1GJUA 2J6VA 4KGLA 1KWKA 4E81A 1JR1A 1CT5A 1RD6A 4M51A 4UCFA 2TAAA 4BI6A 2X3VA 1F4AA 4RDZA 3GR8A 1HKKA 5CBBA 3KBMA 2RAKA 4PB5A 2WZIA 5IOBA 2G3IA 4YMZA 2QUMA 3PVFA 5HNUA 1W5QA 3U2CA 4IGHA 1E1DA 5DMYA 4PSPA 2Q71A 4BR1A 2OX4A 2CBIA 3MZ2A 2IKIA 4EZTA 3IJDA 3NNTA 4B3KA 4HYVA 1GG1A 3ZWTA 3GDMA 1NH6A 4XZ9A 2ZUTA 3IACA 3SFWA 3UG4A 3DI1A 2AAAA 1PUDA 3FKRA 3TYZA 3L4XA 5HQLA 3HG4A 2Z6JA 3V16A 1XJBA 1AFSA 1HJXA 2G41A 3V36A 4P8WA 1QNQA 4X63A 3U2ZA 4HNCA 1W9VA 5DF0A 5U7SA 4LUSB 3HGRA 3U48A 4YTTA 4F40A 4BF5A 4NT0A 3CWHA 1GVIA 1KFKA 4FK9A 2VX7A 2YIAA 1V6TA 4W84A 3W1RA 1EA9C 4L9YA 4NNBA 4BQ5A 3WLNA 1XIMA 1AQFA 4N0RA 3OHXM 4QS5A 2ACQA 3U9IA 5FJUA 1J0ZA 4OIFA 3N2TA 4JIPA 4AXNA 3LGGA 1HW6A 2J9XA 2R1NA 4MB3A 1UCWA 2FIQA 3RMJA 1JXJA 1KTBA 4F00A 3W24A 3KTXA 1HP5A 3KTSA 3RR4A 3M0XA 4DJED 4IPNB 2B7QA 2DZXA 1BKSA 5LNVA 1G01A 1TTPA 5LNRA 3F4VA 1KC7A 4GX8A 1UP0A 4HZ6A 1JZ4A 2NQLA 5HNTA 1R33A 2VVNA 5C9XA 3KVLA 3R10A 1QI3A 4BQ4A 1E1CB 1K03A 1PZ1A 4QAIA 3EAUA 1R2TA 3QY6A 1Q2RA 2R1LA 2B31A 2BY2A 2J7BA 1NU5A 2JGYA 3ICJA 5A94A 1UD8A 1OCQA 3OTRA 4RX0A 3UZYA 1UWUA 4DLFA 3RILA 3SN0A 3TH6A 2J8GA 3VXGA 3F5JA 3R25A 1X98A 4Q8NA 1PX8A 3VD3A 2WNNA 4ATLA 1ZFJA 1JZ2A 5FSEC 1R2RA 2CKRA 1UYQA 3W88A 4UCGA 3WDJA 5AZ0A 2XH0A 4DF0A 2PCEA 3MMDA 1VKFA 3AHXA 3SCTA 3TW7A 1JI2A 1OFAA 3ARRA 1VGAA 2VZOA 3RX3A 4GO9A 1MQQA 1EDQA 1LQ0A 1FXPA 3THQA 2WV8A 1XLGA 3W27A 1UIOA 5KEZA 4FXJA 3E2VA 3HG2A 1W5PA 2A2IA 1WKFA 3O07A 4UTTA 2VZVA 4JNYA 1EEPA 3O8AA 3W22A 3QV7A 1DWHM 4I1QA 4Y8EA 3VE9A 1JD9A 4GYKA 2OMAA 1LT8A 3NJ3A 1B3OA 3AXXA 1M6JA 3SR7A 4H9YA 3S1XA 2QJJA 4OOZA 3PTMA 2B81A 2EO7A 1UD2A 2QUTA 1M68A 2GSHA 4MPQA 3E2QA 5TKYA 4FIQA 4RZBA 2R14A 2YZRA 3K4AA 2OKTA 1JPHA 2X1SA 1LG2A 3WEOA 1EPXA 2C18A 3OZPA 2YLAA 5FJJA 1URUA 4NZFA 2ZQ0A 2Z2UA 2PGEA 1GNLA 1H7OA 2YXXA 3GYCA 3SY8A 4AC7C 5AFDA 4O18A 1TV3A 2Y24A 1WV2A 2WANA 3E02A 3LPGA 4JNFA 2QMKA 1DE5A 2FVMA 2VFHA 5CH9A 1O5KA 3IGHX 1FVPA 3R8RA 3TQVA 4E8DA 3K46A 4WQ6A 1TUXA 1GVOA 2OODA 2BG5A 2YCKX 1NIUA 4HSNA 3VUSA 3W1UA 3RLVA 4WY0A 5L6UA 2WZEA 5CBJA 1ME9A 1SU7A 3BCFA 3LUTA 4DJFD 3GKAA 3IIOA 1E5NA 4O1DA 3MUCA 3PZTA 1BWVA 5IBXC 3GUWA 1P7TB 1C90A 3W2MA 3GDLA 2X2YA 4RZ6A 4R5KA 4ATWA 2OQLA 1XICA 3LENA 5C5BA 3D52A 3WBWA 1NQKA 4GIAA 4X2RA 3HG5A 2DUZA 1LWHA 4ECLA 1SMDA 3NPVA 2QDDA 4OVXA 4GUGA 4ZTYA 3M43A 3S5SA 2GVJA 4F9JA 2HEJA 3NG3A 3WLHA 2PDYA 1MFUA 1F4HA 4DX3A 3W83A 2IQTA 1QI4A 4JNEA 1OCNA 4Y2WA 4C60A 2UY5A 4X3ZA 1F3EA 2YKKA 1JPIA 4DIAA 3BG3A 3JR2A 4TUFA 1FCVA 1X38A 1EJRC 2OZ0A 2O9RA 3T2PA 2XGBA 3NZ1A 1XIDA 4IQEA 3AYVA 1XLHA 2PA6A 4FAMA 2VJXA 1FTXA 1Z8AA 4JKLA 3SUTA 2X1RA 1JDCA 1OCJA 2FZ8A 1KRBC 1YNQA 5DCDA 4PC8A 2W67A 3M7WA 3MMUA 4NASA 4UQCA 1XI3A 4M0XA 1JGIA 1EFZA 1MVYA 3PAOA 1IYXA 2ALDA 2QCCA 2GYIA 3WFAA 3PZMA 2ZX9A 4HZMA 2FH6A 2IQDA 2O0TA 4IMGA 1OA1A 3G1RA 1OM0A 3S3GA 2A7PA 2PMRA 4O15A 4LUYA 1LOQA 2J7FA 1I60A 3ZM8A 3QYQA 3WG6A 2QS8A 3G24A 5LIUX 4FXRA 3MHGA 3FJ6A 3H4WA 2Z0IA 1PPIA 1TPUA 3OIHA 4GBUA 1P0EA 4GINA 2X30A 2J7HA 3QPYA 2W63A 4IWPA 3WNMA 4FM3A 2AQWA 3JS3A 4HJFA 4KWOA 3WDHA 4JTDA 2D2GA 1NF7A 2CLIA 2IS7A 4WDXA 1A5NC 2A3EA 3NQ7A 4CQDA 3WFLA 4HHMA 1HO1A 6TIMA 3UBPC 3UPWA 4KCVA 2R82A 3KDRA 4EOUA 2V63A 1C8QA 3UG8A 3W1MA 1WDRA 4HPNA 3PULA 1VYSX 1IIGA 2ZE3A 1TCDA 1H60A 1UR2A 2O92A 3WY1A 1AMKA 2OZNB 3TYBA 3S4TA 1US2A 3MKVA 2P8CA 1QT1A 1B3WA 4PMNA 3UXIA 4IH3A 3BVWA 2OLSA 2ZRVA 5HPOA 4O57A 1NSJA 3STFA 2IW0A 1H63A 3NR0A 4PA8A 4DJDA 3M9YA 4GKTA 1GT8A 2RDUA 4JGDA 1G4EA 3RLHA 2VOMA 2GVEA 2VMFA 1XYBA 1UH4A 2Q02A 3QC0A 1A80A 3NO5A 1I2PA 4XD3A 1TA3A 4NXKA 1T7LA 1ZBWA 3L21A 1WXYA 3O3MB 1UKSA 1TVLA 2QUVA 2FMOA 1JCXA 1T8XA 2CNCA 2C16A 3GBDA 3Q67A 3TA9A 2CLMA 3IUHA 3N2MA 1SO6A 4BA0A 1SW7A 3D6NA 1FWSA 4EZWA 2FH8A 3N9KA 1HTYA 1J79A 1TQJA 3QR1A 4KEZA 1PZ0A 4QE4A 1I2QA 3WMBA 1JCYA 3LK6A 5GJMA 3R89A 3ITXA 2C0HA 4WOZA 2NLYA 4AC1X 4PL2A 3SCQA 3MCNA 1JCTA 1JGMA 3QQ0A 3M7SA 3VO0A 4AFYA 4WXZA 2AL2B 1JYWA 4KIRA 1WA3A 3UETA 3UZZA 3WBYA 4IFRA 5AHMA 2YDSA 3P3BA 4IMFA 2WLYA 4K8EA 3PWAA 6REQB 2E40A 1W3JA 3G0UA 4C6DA 4U31A 3EDEA 3HPZA 3VNDA 4ZO8A 1QO5A 3LLXA 1TV5A 4PMUA 2F6KA 2DW7A 4IIGA 4U3CA 2QDEA 4XD5A 1PKMA 4YS1A 2YCEA 5IDIA 4XO6A 3LMFA 3OVPA 3C2OA 4HZ8A 3BVUA 2W3ZA 1Y7VA 3NQGA 3QTGA 3WH9A 1S3HA 3UJSA 3M41A 4E4FA 4AIUA 4DHGA 4ICNA 3RM8A 2NXIA 3HOJA 1OC5A 2D1ZA 3WF2A 1XLEA 3B06A 2O4QA 3ABSA 1TQWA 3C52A 4JY8A 1KV8A 1UZHA 3BMWA 4OBTA 4ZOEA 5CPNA 4NSBA 2WCAA 1VHCA 2NWSA 2FPTA 4GZIA 4EZUA 3U8GA 5D32A 1S5TA 3LNMA 1SZFA 4LUTA 4JTSA 4EWND 4LYRA 2H90A 3O1NA 3XISA 4UTIA 3V0TA 3PG9A 3TCSA 3QM3A 3A13A 3F4DA 3PTDA 3PPFA 1MW0A 1L6YA 3E5BA 2WK2A 4A22A 1V5XA 1XH2A 2OWXA 4Q8PA 1W1B1 3LMZA 2VM8A 2WMIA 4KERA 5EPDA 4GKLA 2ZTKA 2Y70A 4GI8A 1DV7A 1PE1A 2EF9A 1QCWA 4ZODA 4XTDA 3NL6A 5FLEX 4RNHA 1JDDA 1KQYA 4TVUA 4OWGA 1DIOA 2GGHA 4O8AA 2BB0A 3QR0A 1FWTA 1XLMA 1O1ZA 2BTMA 5AOUA 1GVYA 1KGUA 3KL5A 2ZX5A 3TLLA 1Q8AA 4M56A 1EQCA 1RVKA 2INEA 4AZGA 2WO5A 1Y8BA 2NUXA 5A6JA 4GI6A 2VUNA 3CB3A 3DHDA 3L2MA 1CXFA 4KMQA 1SMAA 5LZLA 1HTIA 2F2KA 1VFFA 3EKLA 2GWGA 1EBHA 3D50A 3T48A 4UFMA 1OK6A 3VIHA 1HX0A 4FX7A 4GYJA 1NELA 4AD4A 4L80A 5C70A 3LHTA 5I79A 4DWSA 3WLQA 3SN4A 1E6QM 3UA3A 3P5ZA 1IWBA 1WCGA 5HJXA 1CZ1A 4W8BA 4PUNA 1W3NA 1WDZA 1XIFA 3LSBA 5EY5A 3W84A 1WOAA 3DOPA 1KRAC 7REQA 1XKJA 2G8ZA 4O28A 1LM1A 3PUEA 4LNYA 3DKLA 1WAWA 1LBFA 2DSZA 3W7NA 1E0XA 1YIXA 4DXKA 3CQKA 5BMXA 1JVNA 2VZUA 4F0MA 1AD1A 1OIMA 2D73A 1US0A 1TZ9A 2O55A 3CQIA 1RPKA 1ESWA 3WF3A 1K6WA 4NNCA 3CJPA 5E0FA 1QTWA 2X5CA 4CNNA 2NVCA 1HKVA 1ADOA 1XD1A 1W1VA 1ZAIA 1A3XA 1SSDA 2E1WA 2F9RA 5U4NA 3A4WA 1S2UA 2X3XA 1R7AA 1LQ7A 4QDPA 1ONXA 5MF5A 3JU2A 3PFMA 2E6FA 5CGTA 5EGRA 3W7GA 2EG8A 2H9AA 2I16A 5CZSA 5JVLA 4HK6A 3BICA 3U5YA 2R1MA 3W2LA 2JEPA 4HNVA 5CZKA 3SIMA 1QWKA 1I4NA 3MI3A 4UFJA 3ANUA 3S5YA 4W4QA 1CPUA 1NF0A 2OO0A 3OHIA 2PURA 4OGZA 5HXMA 3IWPA 3LBCA 2QKFA 4YTSA 1VJIA 2HNHA 3SSZA 1FWNA 3LB0A 4TX6A 1DWJM 3THDA 3HPFA 3PWIA 4EWJA 1KLYA 4WY0B 2X40A 1Q6EA 4KH2A 4H00A 3LRLA 4OV4A 3N3MA 4GYPC 2UY4A 5ABGA 4YHGA 3WLOA 4BZYA 3PUGA 1OFEA 3M6YA 3BG9A 4I5RA 4XWUA 5CSUA 3LM7A 4PTVA 1Z6KA 4LXFA 3QNJA 1Z7AA 4BEQA 3SUSA 3T2QA 4G8TA 3H4GA 2CC0A 2I5GA 5BWFA 3VKBA 3FK4A 1AZ1A 2C13A 1WZAA 3TIMA 2B7PA 2PBGA 3VDBA 3F2BA 4ADSA 3P61A 4Q4QA 4MWAA 5D2XA 2Z24A 2F1BA 2W5FA 9RUBA 3GZAA 2Y5EA 3AAMA 1ZCCA 3SUUA 3A24A 3MANA 1OWQA 2R1PA 1Z44A 3S5ZA 1ZU8A 4HB7A 3ER8C 1XSKA 3B9AA 2LLEA 1LQAA 4NUWA 2EPNA 3GTNA 2X7VA 4DPPA 3AMCA 2I17A 3JVAA 1W1IE 2NX9A 4MZ8A 1ZTVA 2RGMA 2WVVB 5AY7A 3L68A 4WEVX 1FKWA 1EYEA 1XIBA 2PF8A 1KXVA 3GU1A 4HPXA 4DM2A 4IISA 4Q8WA 3T40A 1F3WA 3T6CA 3FJ4A 2VEGA 4C6EA 3BJTA 4IPJA 2FHFA 5RUBA 1VBGA 4QIUA 4ZSUA 3ALGA 1UROA 1SFLA 3AIQA 1MRQA 4QQUA 4YPJA 2WWCA 5T9CE 4XKYA 3I4KA 3MZNA 2V69A 1UZ4A 1Q7MA 1OY0A 1DIDA 4OUEA 2Y7EA 1H7XA 4M6QA 2VENA 5XIMA 3LI1A 3ITVA 3JZEA 1W37A 3NXLA 8XIMA 3WQ8A 3UERA 1TMQA 2W6RA 1TZ7A 3WLSA 4AWUA 1PHWA 1TG7A 3W7EA 4QJ3B 4CUCA 3VGEA 3BW4A 5HINA 4WX2A 1I75A 2OZ8A 2YFNA 4Z2JA 4Y8FA 4UTHA 4HMCA 3CAQA 4GH3A 4AZ6A 3RCYA 4LF2A 2CXGA 1F3TA 3BLBA 1EGVA 1XYCA 4D6HA 4NILA 1UD3A 4FX8A 3ATZA 4YHEA 4LEQA 3TQKA 1O7DC 1YEYA 3L0GA 2PLJA 3O9NA 4IHCA 3CZEA 3PZGA 3C8NA 1K8YA 3MV01 2GWNA 2XDFA 5FA5A 1UWRA 4DYJA 1OG6A 4RNFA 3YPIA 1OSEA 1SGJA 4EZOA 3GSMA 1GNTA 1M41A 3ZFHA 3NWRA 1HGWA 3BV7A 5CPLA 1LLZA 2NLIA 1V7YA 3P7YA 5C54A 2ODOA 4DUXA 2GUYA 2VX6A 1HJVA 3B53X 4IMDA 4US5A 2QQ6A 3V3WA 3EWBX 1PWMA 1UP2A 3VIPA 1XR2A 1VYRA 3E0WA 1MW2A 2J9YA 1V6XA 1PZ3A 4LAOA 4N6EA 2YIVX 2Q3OA 2ZZ5A 3MVIA 2OEKA 2XTKA 3STCA 5D2VA 2OOFA 3WFZA 2E77A 1VRDA 3IJ6A 1HGYA 3VNJA 4AZCB 1NQ6A 1R9ZA 4DBDA 2CLPA 4FIRA 4W88A 3W7JA 3AUJA 3Q37A 2A6LA 3GRIA 3DFOA 5ENLA 4AISA 4DJFA 5I3GA 3RU6A 3AMGA 4PTWA 4E4PA 1FCUA 4Z1CA 1I8JA 4K36A 2DORA 5E1QA 3C0LA 3PBMA 4Y6GA 1XIHA 4I5XA 5TQLA 5A69A 4E6MA 3FV9A 3WUGA 4XBJA 3AZTA 4R7JA 4W8AA 2ZIDA 2V6AA 4NJHA 1YE4A 3R8HA 7ODCA 3VD9A 2EG7A 1OT1A 3H53A 4JY9A 1U30A 4B2DD 1ZJAA 3AWNA 4GXMA 5HDRA 1XLKA 3ARWA 4WOQA 4CVWA 4YCPA 1P4CA 1ME8A 5F2LA 3L5LA 3APGA 2HV5A 1XYLA 5E09A 1VEPA 3NA8A 1A5AA 4H1ZA 4OECA 5LYRA 3Q4DA 4D9PA 4JEQA 4TV5A 4XTIA 5CJNA 4S3BA 3NOEA 4JTCA 4CKQA 2PE4A 3M0MA 3ATYA 5FJTA 3TSBA 1X04A 1ZY9A 2ZVIA 3MP5A 1XYMA 1E4NA 2DFAA 3U3HA 1JCJA 4LU0A 2WVUA 1TJRA 4DXXA 2R1KA 1PYFA 3H2FA 4RV3A 1D9EA 3H2AA 2ZUUA 3QMSA 4UNIA 1BYBA 4LEFA 3I6TA 4Q32A 1K1DA 3EDKA 4JQ4A 4Z1DA 1A4LA 4IJCA 3GLCA 4C6LA 1PHQA 4HMNA 2RDTA 2VUYA 5AHIA 2QUNA 3HG3A 1MYRA 1UIPA 2QV5A 1TPC1 1J0JA 3G0XA 3KDNA 2XH4A 3GC4A 4ZL1A 1BAGA 2D0FA 3MT1A 2W27A 2XG9A 3VPLA 5EU9A 3COTA 1TWZA 3DDMA 1TPVA 4NG3A 3G1XA 4TIMA 3VINA 4Z1AA 2FQIA 1OFPA 1QOXA 3N3TA 4WK9A 5DMMA 3B0UX 2ZC8A 4JTGA 2X0YA 3N14A 5T26A 4G9PA 1TRIA 4K6AA 4EK7A 3NQ6A 4L4OA 2DIEA 1UP3A 3M0LA 4DYKA 3A5FA 3C86A 3SRFA 1RK5A 3UU0A 1SPQA 5JQ9A 1F07A 4WKFA 1BSLA 3RCMA 1XRSA 3T47A 4PH6A 4CQBA 3H70A 2YL9A 2D0GA 3VGHA 4UIOA 2QCLA 1HFBA 4BS0A 1AG1O 1FWGC 2HVMA 3DH7A 2WSYA 3NSMA 2V3GA 3HQ1A 1CCWB 3H12A 3IK4A 3GIYA 4OT7A 5BRQA 1UH3A 3JW7A 1L6GA 3RM9A 1QW7A 4S23A 4IFOA 5AYXA 2VRJA 3R12A 3FGCB 1H1ZA 3BLKA 2QDHA 5A6BD 4LS2A 5K7JA 3CLMA 4AZ5A 1DWGM 1OB0A 1DTNA 3OVGA 2XH7A 2C71A 1TJPA 5A2CA 1P0DA 1CB7B 2Z1KA 1TX0A 3TX9A 3ZYZA 4MKNA 2WKLA 4WUIA 3WK1A 3PB0A 3CPUA 3SQSA 3DFHA 3PBVA 3UA4A 3V0UA 3DFQA 5CPMA 4UOJA 3WNOA 3B9DA 1NAL1 3DU0A 1HUVA 2G5WA 3S5NA 3O6YX 1QUMA 1U2YA 4CD6A 4I7UA 3WD0A 2RAIA 4PB4A 1XC4A 1GQIA 2ZYFA 4RDYA 3UXKA 3CHCA 1A4MA 1LROA 3SGUA 4IX2A 3C0JA 1WBJA 2ZZ4A 5IHSA 4M19A 3ZVHB 4WHBA 2WMKA 3RO8A 1YDNA 4J9JA 5BXRA 5LNUA 4S3AA 5BZAA 3MBDA 3PBYA 3QQWA 1K7EA 3FA5A 3W86A 2DP3A 3O2LA 1WDQA 3LS9A 3AZRA 5EMUA 3UFYA 3WEZA 3WMCA 3THAA 4A21A 1AW5A 1AZ2A 1XLDA 3EX3A 5K9XA 3N73A 3URAA 1V93A 5DCBA 1GPFA 4AHPA 4KWSA 1BYAA 2HBVA 2HE8A 1EHAA 5CSRA 1MNZA 5HOSA 1XLCA 3A47A 3L4WA 3SAZA 1YQ2A 5HAOA 5FJIA 2PB1A 1S3TC 3B4YA 1LRQA 3VZYA 1ZZMA 3PLTA 2VI0A 2GDUA 4JBRA 4C6NA 1R6WA 4F48A 4HVXA 3MYPA 3ZOAA 4QDWA 3DFTA 2D2HA 4H9TA 3LG3A 1V4YA 2PDHA 3ITGA 7PTDA 3CQJA 3GTXA 1OJXA 3AXHA 4GISA 3E96A 3AXMA 5F1UA 3VZXA 3ZZ1A 3WELA 3PAJA 4U4MA 3ES8A 1SZRA 1JJKA 3N4AA 2QKWA 4B9ZA 1LRTA 2ND1A 1K9TA 3R0UA 5I23A 4ORMA 4GQGA 1GYMA 5F2MA 3M0VA 1L6FA 5KETA 4WJEA 4A8NA 3O0FA 3DCPA 4HSOA 3GNDA 3SUVA 3FSTA 4UTWA 3AFBA 2E68