4AZBA

Differential inhibition of the tandem gh20 catalytic modules in the pneumococcal exo-beta-d-n-acetylglucosaminidase, strh
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
425
structure length
408
Chain Sequence
NEKLAKKKIVSIDAGRKYFSPEQLKEIIDKAKHYGYTDLHLLVGNDGLRFMLDDMSITANGKTYASDDVKRAIEKGTNDYYNDPNGNHLTESQMTDLINYAKDKGIGLIPTVNSPGHMDAILNAMKELGIQNPNFSYFGKKSARTVDLDNEQAVAFTKALIDKYAAYFAKKTEIFNIGLDEYANDATDAKGWSVLQADKYYPNEGYPVKGYEKFIAYANDLARIVKSHGLKPMAFNDGIYYNSDTSFGSFDKDIIVSMWTGGWGGYDVASSKLLAEKGHQILNTNDAWYYVLGRNADGQGGGNLDQGLNGIKNTPITSVPKTEGADIPIIGGMVAAWADTPSARYSPSRLFKLMRHFANANAEYFAADYESAEQALNEVPKDAIRSLDSNLSRAQQDTIDQAIAKLQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-N-ACETYLHEXOSAMINIDASE
publication title Inhibition of the Family 20 Glycoside Hydrolase Catalytic Modules in the Streptococcus Pneumoniae Exo-Beta-D-N-Acetylglucosaminidase, Strh.
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 154
structure length 408
sequence length 425
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2012-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.90 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 AF1782-like 4azbA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4azbA01
1B30A 2CYGA 4N42A 5I2UA 5M03A 3WH6A 4LXFA 3B9AA 4M29A 4GZEA 4MNLA 5JBFA 1EGZA 1JYNA 3HMCA 3CZ8A 1GHSA 1DWGM 7CGTA 3NJ3A 4WKAA 1ZBVA 1DWIM 2BVYA 2VR5A 5CGMA 2WMJA 4GZJA 4JHZA 2ZWYA 3BLKA 3AROA 3GXDA 4X0VA 4WF7A 3K8MA 4J3WA 4A4AA 2WM0A 5GQBA 1KGUA 3AS3A 1UR1A 3L4UA 1VF8A 5I5RA 2JEPA 1J0JA 2VMFA 1E4MM 2XIBA 4MAZA 3RPMA 1E6NA 2XYLA 3ZJ6A 1GORA 2OYMA 3T0AA 4YN5A 3TTOA 4C7GA 3BXWA 5HNNA 1TCMA 1JNEA 4V28A 1CLXA 3KWXA 4ACZA 1V3KA 3EDDA 4ZE5A 2WHMA 1BSIA 1KQYA 1VENA 3AHVA 2ZUSA 1C8YA 3DC0A 3GXIA 2DSKA 5A8NA 2WBGA 3G6LA 3ARPA 1WCGA 4J27A 3WQ6A 2QF8A 5AYBA 3MV11 3PZVA 1PIFA 4S3JA 1FA2A 1CGXA 4WJXA 4UCFA 3W29A 1D2KA 4DUWA 4EE9A 2V3GA 3AHXA 4AC1X 2DH2A 4AZ6A 1G5AA 3L4ZA 5CPQA 4H8UA 1J0YA 4FLOA 3VIJA 4D6JA 1IT0A 1JYWA 3MKKA 5FL1A 1EA9C 1W9PA 1QI5A 3AMGA 2GJXA 5CSUA 4JFTA 5DF0A 1FH9A 3CZGA 3QOKA 3TOPA 1M01A 1XH1A 3NSXA 1PEZA 1E73M 4CCCA 3RM8A 1JD9A 4W5UA 2WC3A 1JL8A 3T0BA 1JYVA 2X2YA 4ATWA 3WQVA 2G3MA 2OSWA 2X0YA 3ECQA 5F7UA 4LYPA 4MJ4A 3WF3A 4U31A 1F4AA 1W9VA 4KRUA 1NWUA 4AIOA 1KGWA 3VX1A 3ZT7A 1CTNA 2UWFA 2VZOA 1EHAA 1JZ8A 1EXPA 1V6XA 2XVLA 2OWXA 2FGLA 4GI9A 1E71M 3BMWA 2QPSA 3VDBA 1Z32X 2J62A 3VILA 3FAWA 2QHAA 4PMNA 3T2PA 3OIHA 2WVVA 1XH0A 5BRQA 1JZ3A 2JIWA 3VUPA 5E6YA 3VGDA 3W24A 4BZYA 8A3HA 4TX6A 4PTXA 1GOMA 1OD8A 2WVTA 1Q6FA 3CHCA 3WNNA 4XX6A 3WF1A 4DWSB 1TFVA 3U57A 3WF0A 3WNMA 4UQCA 5D9NA 4CKQA 3KEHA 1M53A 4AYSA 2PBOA 1PZ2A 3A3HA 3B9EA 3T0DA 2WVSA 1UD5A 3N15A 3CUFA 2CKSA 2VX7A 1GJWA 2BHZA 5A6AA 2WWCA 1ZS2A 4OBRA 4CD7A 1KR1A 1XSIA 4GO9A 1PX4A 4ZE4A 2EPOA 1J01A 3GTNA 1CGVA 4D72A 3F5JA 1LWJA 3DYOA 4B15A 5C71A 1GQIA 2PWHA 4Z2JA 1CXEA 3GXFA 3T09A 4QP0A 1FHDA 3PHAA 1H2JA 1OT1A 2VX6A 3GXMA 3KZSA 4BQ3A 1J0ZA 2WMKA 4TXEA 2J7CA 4FLQA 4PMRA 1ZB5A 1XH2A 4BQ2A 2XJ7A 4QCFA 5I78A 1V6WA 2C0HA 1FOBA 1GZJA 3FHQA 5IFPA 2RGMA 1AQHA 4JCMA 2YDSA 1UR0A 2E40A 2JF7A 1MW0A 1WO2A 2XG9A 2ZX7A 4Q22A 2G3IA 2Y24A 5E6ZA 3VIFA 2X8RA 1N82A 1NP2A 4WKHA 2W63A 2V5CA 3CMJA 4U2YA 1WDPA 2O9RA 3ARSA 2WC7A 3DHUA 3SCRA 3VGFA 1R86A 3CIVA 3PZQA 1UUQA 2VUYA 4JL1A 3CTTA 2EBNA 1WDSA 3WELA 4PRWA 6A3HA 1KGXA 3F4VA 2ZIDA 1HP4A 2CESA 4KH2A 1ODUA 3WH7A 1JZ5A 3A4WA 1LL6A 2BNJA 1UOKA 2WHKA 1XC6A 4Z2IA 4CN1A 2IXVA 3MS8A 2YLLA 2XVPA 1PIGA 2XTKA 1FHLA 5A2AA 4HMDA 3PN8A 1UH4A 1A47A 3NCOA 2EJ1A 1WZKA 4P8UA 2UY4A 1QBBA 3O9NA 1LLOA 4PBGA 3T2OA 5JUVA 2Y8KA 2W92A 2EPMX 4IPLA 3KL5A 5KZ6A 2YA1A 2BY0A 3IK2A 4JFUA 4MB1A 3VIPA 1W9BM 1XGZA 1W1YA 1HIZA 2OWWA 1HL9A 2YIHA 1S46A 3WH5A 1W1TA 2J7HA 1UWTA 3L2MA 4ATDA 4EKJA 1NWTA 1JDCA 4E2OA 1G1YA 1OINA 2CHOA 1SMAA 3GH4A 2XPKA 2YKKA 3AIUA 2EPNA 5BXTA 4FF5A 1OGGA 2JFEX 2DSZA 2J7EA 1CXLA 5AC5A 5FKYA 2OSYA 3RJXA 3MUY1 3TTQA 1NOWA 1V3LA 3PZOA 3GZAA 1H49A 4ATLA 2NSXA 4AZCB 4U2ZA 1LJYA 1TR1A 3UG4A 3RCNA 4AZ7A 1MFVA 3BAWA 2DIJA 3GBDA 5M5DA 1RP9A 4LQ1A 1E0VA 1V0MA 4PTVA 3DHPA 4AMCA 4UFLA 4MDPA 2ZX5A 2G3JA 2O9PA 1V02E 1PAMA 2GK1B 4X9YA 4H2CA 2X05A 4FZPA 2J47A 4UFMA 2YL5A 3I3DA 3JUGA 3WUBA 1TE1A 4ZXOA 3TP4A 3RM4A 1W91A 1W2PA 1HN1A 4P7RA 1HXJA 1LG2A 1HVQA 1ECEA 1MQPA 4U5KA 5BWFA 1H5VA 3BAXA 3QR3A 2GFTA 1CGUA 4BQ5A 1WDQA 4RE4A 3K8LA 3J7HA 4PMYA 4HPGA 1PJ9A 3AS1A 2CXGA 4W8AA 2OYLA 2D3NA 2QLYA 1WZMA 1DEDA 5GNXA 1AMYA 2XM1A 3WBEA 5C70A 1BQCA 1ITXA 1U2YA 3PZIA 4LPCA 1B3ZA 2GVYA 1GNXA 5A1AA 1QI2A 1GOQA 2CBJA 1HJWA 1MYRA 4P8WA 3AIVA 3LPGA 3ZJ8A 1GOWA 3ZSSA 1JAKA 4ZXLA 5FOOA 3VDCA 3TONA 1KB3A 4W5ZA 2PF0A 1TA3B 1OWQA 1HJQA 5A3HA 1CBGA 3EMQA 4OOUA 5ABHA 2PBGA 2V38A 1V0KA 4J3VA 1C93A 3OLDA 4HPHA 2W91A 2VRKA 2A3AA 5FCZA 2ZXBA 1KXQA 4IISA 5FL0A 2CETA 2XGIA 5HPOA 3VD4A 4W7VA 4HTYA 2OZNB 1U30A 5BXPA 3QOMA 1YHTA 4LX4A 1EQCA 3VOCA 1KR0A 2DEPA 3AFBA 4DWSA 3GNRA 4ML4A 3VIMA 4J3SA 3VGBA 3AICA 1WAWA 1RD6A 3ARYA 1QHOA 1WDRA 2W62A 3IAPA 3WDHA 3VKKA 1CYGA 1ZU8A 1HNYA 2ZXQA 2BV9A 1MVYA 1WZAA 2DPEA 3UERA 3MANA 1JXKA 2VI0A 2HISA 2WCAA 1PX3A 1QPKA 3ZIZA 3AMCA 1R7AA 1E0XA 1XD0A 4UQBA 3WMBA 4UQEA 2XUCA 3GNOA 2Z1SA 4OOZA 5JIWA 4TVUA 1P6WA 5D9PA 2W4XA 1NWSA 4EK7A 1HJVA 1C92A 1V03A 3L4TA 3PTKA 5ABEA 5A8PA 5CLWA 3K8KA 3AYSA 4HZ6A 4NF7A 2VNCA 4L4PA 2WYSA 2VC9A 2C7FA 2E8ZA 4J28A 2YL6A 2EPLX 2CCRA 3O6AA 1FP9A 3WEZA 1QVBA 3IJ9A 3OGSA 3ARWA 2CBVA 1HL8A 1MWOA 4W87A 3ZOAA 5CPSA 2Y5EA 3WL0A 2O9TA 1B2YA 4K68A 1C91A 4CCDA 2XSAA 1NM9A 3RM9A 2YOCA 1E70M 3AS2A 3SUWA 4NRSA 2DQXA 3ARUA 2EQDA 1KXTA 3WDRA 1B3XA 4P7NA 4UOJA 1VFFA 3IANA 1GVYA 1BLIA 4AD1A 1QW9A 2WSPA 3CO4A 4GQRA 3KL0A 3SUUA 4M82A 4MDOA 2WHJA 4CD6A 4D6CA 1CXKA 3EDFA 1QOXA 1DP0A 1JDDA 1LWHA 3BCFA 3IJ7A 2J78A 2XIIA 4Z2LA 3AXIA 4MNKA 1GW1A 4CVWA 2ZXAA 4UQDA 1E6QM 3FY1A 3RO8A 2VL4A 3WFZA 3F5LA 1B1YA 3THDA 4TTGA 1HKJA 1KXVA 2Q8XA 4B3KA 3VINA 4CU6A 2CKRA 1QNOA 4JCLA 3WNLA 2CHNA 2DH3A 2V3DA 2E3ZA 3VDHA 1RP8A 2FHFA 2VRQA 3WSUA 4CU8A 4WKFA 1J0KA 5A95A 1E6ZA 1W32A 1H41A 3UR7A 5EBAA 5AY7A 3UETA 5D9OA 4CD4A 3SUSA 5ABGA 1JZ6A 3L4VA 2EO7A 5JBDA 1C8XA 2XWDA 1Q4NX 1US3A 2WAGA 1CDGA 4HU0A 3ARTA 1VB9A 1UKOA 3AHTA 2YDQA 4HP5A 4CN4A 3ARRA 1BAGA 5BYWA 1JD7A 3SUVA 2VO5A 2WZEA 3L4WA 3WH8A 2JALA 3M7SA 4W85A 5I77A 5DT5A 1XCXA 1CECA 4XZBA 3WQ5A 4HOWA 2ZUVA 4H41A 3WD3A 2VX5A 1VBRA 3VMOA 1ZJAA 4M1RA 2VQUA 4WIWA 5D9MA 3WMSA 4XZWA 2WMFA 1FH8A 4AZCA 2O9OA 1IZKA 3UR8A 1JXJA 3W6LA 1X6NA 4QLJA 3AMKA 3GNPA 4AW7A 2JIEA 3I3EA 1AVAA 2E9BA 1PX8A 2GK1A 1C7SA 1UWRA 1KCKA 4YHEA 4MADA 1GCYA 1B31A 3FXYA 2PWDA 5BROA 4F9DA 1E5JA 4PMXA 2WSKA 5I79A 5A94A 1B3WA 4P8VA 3MMUA 4MJ2A 4Z2KA 1BG9A 4PMVA 1UKTA 1HX0A 4KGJA 2A3CA 5I0DA 4UFIA 1KWKA 4V27A 1NOFA 3U5YA 1UA3A 1B3VA 3U7VA 3A4AA 4GO8A 4U3AA 4HZ7A 1OM0A 2YA0A 3F5KA 3WNPA 2WMGA 3WN6A 3LPPA 1BYAA 5D8ZA 1ZBCA 5AYIA 3CZKA 1OBAA 5BXSA 4PMDA 1SR0A 2VQTA 1E15A 4BA0A 3MO4A 1EO7A 1O6IA 2FDMA 2RGLA 4W84A 3WH9A 1YQ2A 1J18A 2O92A 4JL2A 3WNOA 1Y7VA 1G94A 1TA3A 1C3FA 3TTSA 5A8QA 2J8FA 2F2HA 2J7FA 4UFJA 1V6VA 3EDKA 3W37A 3AISA 3PBGA 3RMEA 1DHKA 3PZMA 3AZSA 1Q6CA 2WCGA 3SEPA 3WD0A 3ZR5A 1L0PA 1OSEA 3SURA 2GDUA 4W89A 3N17A 2X0HA 1SYTA 4LYRA 3W82A 2BY3A 5A6SA 1CZ1A 3QGVA 1E6PA 3KE0A 3ALGA 4NZCA 1W1VA 2NT0A 1E1FA 1H4PA 4AEFA 4KWUA 4MAVA 4P7QA 1JI1A 1XYZA 1E6SM 4M81A 5ECUA 3SCOA 2GDVA 1AQ0A 5LYRA 4QLLA 4TVDA 1GVIA 1F4HA 2YDRA 3SUTA 1V3MA 3NSMA 3NYDA 3ARZA 3CZJA 2A3EA 2JF6A 4JZ5A 1A3HA 2D23A 4CUCA 1EDQA 1W2VA 3WBAA 1R85A 2ZUWA 2ZUNA 3N18A 4PUDA 1GUVA 2V3EA 4AIEA 2WLYA 3WF4A 2WLZA 3GDBA 3CMGA 4TOQA 3WIJA 2AOSA 2EPKX 4Z2GA 2OYKA 1ZL1A 3CZEA 1I1XA 1B9ZA 2J79A 4LYQA 1M7XA 1QHZA 5IDIA 5IHSA 2PWGA 4S3KA 4C7DA 1BGAA 3ZR6A 2CNCA 3SIMA 4AY1A 5BRPA 4QFUA 1M04A 2WVUA 2WC4A 2C8NA 3A6OA 1MFUA 4OZOA 4GI6A 1H11A 4UR9A 1E55A 3U7BA 3GH7A 1UWUA 1H0GA 2YJQA 5A2CA 3VIIA 2DT1A 1JNDA 3M46A 2EEXA 4PMZA 3ZT6A 3CHFA 1PPIA 4YPJA 3SCSA 4BF7A 4PMUA 3POCA 4ACZB 3SCQA 2BHUA 2WPGA 4Q7NA 1ZJBA 2OWCA 1MW2A 3OZPA 4Y7EA 3LPFA 4GZIA 1V6YA 3ZJ7A 5TD4A 4U5IA 1E3XA 2DT0A 3MUAA 3LMYA 2X09A 3W26A 2MANA 1LL7A 4GI8A 1UKQA 2V5DA 4IUGA 2BXYA 4B3LA 4PCSA 1H3GA 5DT7A 5BCAA 4AIUA 2AMGA 3PTQA 2PMRA 3AIBA 2ZXDA 4JFVA 3BAYA 1XSKA 3WUGA 2E8YA 1CGTA 2D2OA 1HKMA 4W86A 4WSKA 4E8CA 1UZ4A 2WXDM 1NWRA 3UCQA 1ISVA 3VTRA 2YBUA 3LPOA 5A8MA 5E09A 3PTMA 4J7RA 3VM7A 3OB8A 3AMDA 3CHEA 3CUIA 3FHAA 1J9YA 1PZ3A 2QV4A 2BS9A 5HDRA 3VMNA 2A3HA 4HA4A 2WWDA 3K46A 2XVKA 2CERA 4AD0A 1ITCA 2WBKA 2VVNA 3AZRA 3BCDA 4MB3A 2GSJA 1B0IA 2WB5A 4A3HA 2XGBA 3FN9A 1ISWA 1GHRA 5CJ5A 4D6FA 3N1AA 1X1NA 1KBBA 3AI0A 1WZLA 4JKKA 4OIFA 3CHDA 3CUHA 4RE3A 2VT0A 5C8BB 3S2CA 5HOSA 3L2LA 2AAAA 3MUIA 1WP6A 4RL3A 1I75A 3VIOA 3W4RA 2PI6A 4B9ZA 3VNZA 3B9DA 1LL4A 2ZUUA 4QCEA 4W93A 2WMHA 3MU7A 2VZVA 4NRRA 4CVUA 5JIPA 3N9KA 1GJUA 4J3TA 3PZ9A 3ARVA 3UEQA 5LA0A 1K9DA 1FFQA 5IFTA 3RIKA 3VPLA 4FMVA 3ALFA 2X1IA 6CGTA 1GOIA 4DUVA 2DT2A 1TVNA 1VEPA 1V6UA 3VU2A 4CD8A 1BVNP 2J4GA 2PB1A 3AIQA 3ZT5A 4AXNA 3W25A 1XV8A 2BXZA 3B8SA 3OZOA 1HP5A 1Q6EA 7A3HA 3QHNA 5M3WA 1UQYA 4CGTA 4DM1A 3MSDA 1CGYA 4HA3A 3RILA 5A6BA 2ZX9A 6TAAA 3K4DA 5E70A 3VD5A 4YHGA 3U5UA 5EFFA 1WKYA 1W9DM 4PMQA 4PTWA 2J7BA 3WUEA 1E3ZA 2F8QA 3WL1A 1VEOA 2QMKA 4RE2A 4F66A 4UOQA 2ZUTA 3RDKA 1E40A 4M8UA 1CLVA 1SFSA 2DSUA 4ACYA 1CXHA 2J25A 2XM2A 1PBGA 1E0WA 1MW3A 4JAWA 4JKLA 3WD2A 4UOZA 1HF6A 4ZFMA 2DSWA 2GJRA 3VGEA 2D24A 2BVDA 1E6XM 4UZUA 1DWJM 3AJ7A 2VCAA 3SCTA 2D20A 2WK2A 1WPCA 4H7VA 1D7FA 5IXEA 1QNQA 3ZMRA 2ZUMA 1GOOA 1QI4A 1UR4A 4B9YA 3IJ8A 1CGWA 3VD9A 4KGLA 1NQ6A 3IAQA 4PUEA 3MSGA 4M56A 1H1NA 1BVZA 2XFFA 1BPLB 4F9JA 2VURA 5LA2A 3VD3A 1UD4A 5A6MA 4CCEA 1JFXA 4D6GA 4BS0A 2W5FA 4C7FA 5E9AA 5D8WA 3MV01 5A6JA 4MB4A 3THCA 1UH2A 2VCBA 4BCEA 4D1IA 3M07A 1OGSA 1UYQA 2G8ZA 4PSRA 1ZBKA 2Z1KA 1EDTA 3OGVA 1B90A 4AD3A 4AEEA 3WNKA 1VRXA 1GONA 2VZUA 2GJPA 3UG3A 1E72M 4HMEA 1O7AA 3N11A 1KXHA 1J0IA 4WSJA 1OCQA 4TX8A 3CH9A 2PWEA 1XHGA 3BAKA 3E1F1 5EB8A 4MTVA 2XSBA 3L4YA 3EYPA 3VIKA 2OLHA 4AWEA 3KL3A 2HVMA 1OT2A 4A3YA 3SCWA 5CPTA 1KBKA 2XWEA 4UFHA 2WHLA 4M24A 2ZICA 4V2XA 4EANA 3K4AA 1GPFA 3W38A 2CBIA 4J3UA 1MQRA 4QLKA 2XHYA 3GYCA 3AYRA 2QPUA 4IPNB 5CXPA 5M17A 2BHYA 3DYPA 5DFAA 1MXGA 2YL9A 3BAJA 3VM5A 1ODZA 1U33A 3NUKA 1E6RA 4TVCA 1NARA 4DWSD 5DMYA 1VJZA 5E0FA 3APGA 1KFWA 3AZTA 1XSJA 5A6BD 3BH4A 4OUEA 2EXOA 1JGIA 4N0RA 4W8LA 1UKSA 5EMYA 5FD0A 2VZSA 3WEOA 1ZBWA 1OIMA 5EFDA 1OGBA 1JIBA 5CSYA 1W9XA 3W6MA 3BSHA 3AIEA 1WE5A 2WMIB 3CGTA 1UR2A 3A4XA 5BXRA 5ABFB 1US2A 2CITA 1NH6A 2CPUA 1MQQA 1IV8A 3WKZA 5A6KA 2TAAA 3AIWA 3BGAA 3WMCA 2VCCA 2E9MA 1DTUA 2VRJA 2FH6A 3VD7A 1W3KA 2W61A 1JAEA 4DM2A 1V02A 4D71A 4NI3A 4GINA 2VTFA 1G0CA 1QNRA 1CEOA 4D1JA 1EO5A 1R8LA 4L4OA 5DEZA 3AQUA 3GM8A 1G01A 3ARQA 3POHA 3RJYA 4D6HA 2W66A 3QHOA 4XV0A 4JHOA 4QDMA 4ZENA 3EMCA 4HA1A 3W53A 3FAXA 3SCPA 1BGGA 3D3AA 3SCNA 1GQLA 2BFGA 2ESCA 3AIRA 1HVXA 4UTFA 4MPKA 4HU8A 2ZX6A 3N13A 3ZM8A 4AD5A 1H0IA 1VFUA 1BYBA 1M03A 3N12A 3VDAA 3WENA 2UY3A 1GQKA 1LF1A 3EBVA 2Y8VA 3PZNA 2G3NA 4AZIA 1CENA 5CG0A 2WANA 2FHBA 1JDAA 1CXIA 3VGHA 3BC9A 2F61A 4AZBA 1LG1A 1TZ7A 1BYCA 9CGTA 4IM4A 2YLAA 4OBSA 4P8XA 4URIA 3OBAA 1Q6GA 2UY5A 1EOKA 1TG7A 1J11A 1CWYA 1V0NA 1EOMA 2VOTA 1V3JA 3BSGA 1X6LA 3OLGA 1UD2A 2CIPA 4PMOA 1V08A 1HJXA 1E4IA 2VVSA 4UZSA 1B3YA 4R27A 2YBTA 4D6IA 2VX4A 1VFMA 1QI3A 1HJSA 3WF2A 2DGAA 4HMCA 5I6SA 1GOKA 5HPCA 2G4FA 4JKMA 4HOZA 1W1PA 1JF5A 2XVGA 1AQMA 3MMDA 3VGGA 3NSNA 4FK9A 1ESWA 3GBEA 3ZQ9A 4H04A 2PWFA 3AOFA 3WUFA 1SMDA 3CPUA 1H09A 2D0GA 5GNYA 3EMZA 2J8GA 4TTUA 2WKGA 4D6EA 4ZEPA 3AS0A 2E9LA 1UKPA 1XCWA 5LA1A 4PSPA 1HKKA 1VAHA 1JZ2A 3T2QA 4PCTA 1E5NA 4JIEA 4B16A 4E8DA 4CN6A 2ZE0A 1QNSA 2CEQA 4HZ8A 3II1A 1HKIA 3PZTA 3AXHA 1TVPA 3NDZA 1EHNA 3G6MA 2D3LA 3VMPA 2ZX8A 1KWGA 4H8HA 4DWSC 1LQ0A 1FP8A 4OKDA 3T08A 3W0KA 4Z2HA 1UD3A 2VZTA 2GUYA 2D22A 2ZOXA 3OLEA 4XUYA 3CUGA 1R87A 4LGXA 2WZHA 1HJUA 2D1ZA 1W3JA 3AHZA 3DECA 3MMWA 4PEEA 3WQ8A 4CD5A 5D4YA 2DIEA 1CNVA 4AZHA 4FZOA 1JZ7A 1GQJA 1L8NA 1EH9A 1E1EA 1BYDA 5IHRA 1V0LA 4OJYA 2JE8A 2A3BA 2YA2A 4KMQA 2V3FA 3VIHA 1OB0A 1UZ1A 1EQPA 4UQAA 2OO2A 1K9TA 3I3BA 2D0HA 1CXFA 1D3CA 2QMJA 1UWIA 1FFRA 1JF6A 1DWFM 2E4TA 5DO8A 4UQ9A 1ISYA 1XD1A 1E43A 3WDJA 4PN2A 3HU7A 2ZWZA 3SCVA 4AD2A 3BAIA 4P7OA 1JYXA 3UG5A 1J12A 1V3IA 3MUZ1 2Y4SA 4E4PA 4U3CA 5A8OA 1CPUA 4UFKA 2DDXA 8CGTA 3W27A 3CUJA 3ARXA 2IUZA 1C8QA 2GJXB 3FNDA 1TMQA 2VR4A 4F79A 3TA9A 2B31A 4WLCA 3QHMA 1I1WA 1MW1A 4D6DA 5I24A 4KRTA 2W67A 5CLTA 1NOUA 3O2LA 5GNZA 3CBWA 4HOXA 5GPRA 2IXUA 1W9UA 2WW5A 4PTMA 3WD4A 1QBAA 1WNOA 2J7DA 2DT3A 1UR9A 3UESA 1Q6DA 1UD6A 2WMIA 4W7UA 3ZSTA 1C7TA 5ABFA 1V3HA 4UNIA 1ISXA 3DYMA 4MB5A 2J74A 1W3HA 5E0CA 2WVVB 3AHYA 3M6DA 2J7GA 1E4NA 1E4LA 4QAWA 1UWQA 1RH9A 1EDGA 4WK9A 1UHVA 2E0PA 1BFNA 3N04A 2DSVA 2BY1A 1DWAM 1BG4A 2NT1A 3W28A 4EAMA 1UG6A 1JG9A 3EDJA 1KCLA 4NSBA 2D0FA 1TUXA 4U33A 4AD4A 2YL8A 2OSXA 3NIYA 1UD8A 3A47A 4AZGA 1UH3A 3VIGA 2J77A 5CZKA 4M80A 4GIAA 5JBEA 4W7WA 1K9EA 2XFYA 4AISA 2JNKA 3WFLA 1OIFA 4FLRA 4H8VA 1CIUA 1MXDA 3TTYA 1OD0A 3VO0A 1UR8A 3BMVA 1UQZA 4R5EA 3L4XA 4CU7A 3OG2A 5HBFA 2J75A 3WEMA 2FHCA 2WCSA 2FGZA 3AMLA 4X0NA 3FW6A 4JFSA 3BLPX 4PYSA 2CBUA 2WNWA 3SCUA 2NW0A 1BTCA 5KEZA 2UY2A 3NDYA 5A6LA 4MNJA 3WDIA 1VJSA 5CQ1A 3AXXA 2Y2WA 4DUXA 4XB3A 3OLIA 2BVTA 3WDQA 1VBUA 1VIWA 1XRVA 1QHPA 1XYFA 5A69A 3WY1A 2WZIA 4GPNA 4MNMA 4JFWA 4AZ5A 3WD1A 4J3XA 1UWSA 2XVNA 2PC8A 3CZLA 1UA7A 4P7LA 1K6AA 1E9LA 3VX0A 4F8XA 5HXMA 1HT6A 4TUFA 1J10A 1G9HA 2XFRA 3OA5A 1QNPA 1VEMA 2JEQA 1WB0A 3WDPP 1RPKA 3WQ4A 1R7OA 4W88A 3S6TA 4GXPA 3GH5A 1W3LA 5I3DA 1ISZA 3PZGA 3HN3A 5AC4A 1QW8A 3VNYA 1C90A 2G41A 3K1DA 2WKLA 3W81A 4FLSA 3HJEA 7TAAA 1JZ4A 5A2BA 3CLWA 5CGTA 1BHGA 1QI0A 1KQZA 2FH8A 1DWHM 1JFHA 1JI2A 1VFOA 1K9FA 1E56A 3OGRA 1EIBA 1IZJA 1NP0A 5I23A 1FH7A 3ZJKA 3VVGA 2BY2A 4GQQA 3WQWA 2VJXA 3ZO9A 3EDEA 4W8BA 1J0HA 1BF2A 3D5HA 3PZUA 5FIPA 4GKLA 4BQ4A
chains in the Genus database with same CATH superfamily
1B30A 3E02A 1SJBA 1S5MA 3O3OB 4N42A 4PODA 3B8WA 5M03A 2DZSA 3B9AA 2X42A 2GPTA 4BKNA 4A8NA 2VEMA 3MCNA 5LHFA 5JBFA 1EGZA 3P5ZA 4WKAA 3CT2A 1OC5A 2BVYA 3OJGA 2WJFA 5CGMA 4GZJA 5EL1A 1X97A 5CC3A 3S9YA 3BLKA 2ZZ4A 1DJIA 3PBUA 1IWAA 2WM0A 5H8PA 1UR1A 1OF6A 2X1UA 3IARA 4G7EA 1VF8A 4YTSA 1XIIA 2Z0OA 2VMFA 1E4MM 3ER8C 2XIBA 3T7VA 2ZQ0A 3WLQA 5EMUA 4UR7A 3WLOA 2Y1HA 4GCAA 4HU3A 1N2VA 3INPA 4C7GA 4Q8UA 2FICA 1CLXA 4ZE5A 2H3DA 3H12A 1VENA 3AHVA 1RV8A 4IQEA 4C5YA 1F05A 4I8DA 4S3EA 2GQAA 1W5QA 1WCGA 2CLPA 2VFFA 2QF8A 3TCSA 1GVQA 2XN1A 1FA2A 2PU0A 5D33A 3GC4A 4JTTA 1TTQA 4ORIA 2V3GA 3AHXA 4B5SA 1EC8A 1YKWA 1G5AA 1ITQA 3FA5A 4GXWA 3I4EA 3L4ZA 5FA5A 4H8UA 4H7ZA 1J0YA 3UZJA 3CQJA 5A8GA 1EA9C 4MLJA 3LX9A 2R6OA 3WQEA 4LH8A 5CPLA 5BZAA 4IICA 1FH9A 3CZGA 2GA9D 1M01A 1XH1A 1NF0A 1EYWA 2YXXA 3UR5A 5J5DA 1JD9A 2P0OA 2ZVIA 2KZHA 4ATWA 3BL3A 4FALA 1QR7A 4U31A 2EAWA 4HHMA 2REQB 5C54A 1R2TA 1EYEA 3AXKA 1FCQA 4XBJA 1J5TA 2VZOA 1V6XA 5AECA 3KOWA 1TO3A 1LP6A 2FGLA 1E71M 4X2PA 3BMWA 2QPSA 3VDBA 4HSNA 4DZIA 2IKJA 3SIZA 5HJXA 3PJTA 2I1OA 2PU1A 1ONEA 4JYEA 3M0YA 2OO6A 2JIWA 5E6YA 3W24A 4MUPA 3H26A 8A3HA 1OD8A 4GJIA 3N4EA 4XX6A 4QX4A 3WNMA 4CKQA 1E9IA 3VDGA 4OE7A 2NX9A 1AW1A 1B3OA 1M53A 2PBOA 3OO2A 1ZUAX 3N15A 4NZ5A 1T96A 1YNYA 2XH0A 3P8JA 3WYZA 4DAIA 5A6AA 4OBRA 3IVSA 5FJPA 1POJA 3PB2A 3BO9A 4JIIX 4LY4A 1J01A 1XGEA 3U2OA 1LWJA 3ABHA 3I4KA 3D6NA 2F6XA 4GABA 1XQLA 3W3OA 4DRSA 1G7VA 1YIXA 1H7NA 3N4FA 1FHDA 2VX6A 1ZWWA 4BQ3A 1VCFA 1J0ZA 2WMKA 4CQ9A 2GZXA 4PMRA 4BQ2A 2RDUA 1MRQA 4QCFA 4XZLX 5D03A 3LK6A 4M6UA 2GSHA 3FHQA 3VOGA 5IFPA 2L5HA 2JF7A 3VKDA 1K4GA 4Q22A 2LXYA 4Z1AA 3CMJA 5AB3A 4U2YA 1EP2A 2FVLA 2PA6A 3W00A 4OHQA 3DX4A 4LBRA 3VNMA 3P0WA 2DZBA 3DU0A 1VFHA 1KGXA 4ZO6A 2ZIDA 3PJWA 3CEPA 5EMLA 1PS3A 3BICA 2OEJA 4OU1A 3FVMA 1KRCC 1DJNA 4DXKA 3A4WA 4NPHA 2WHKA 5EPDA 5L9FA 3KRZA 6ENLA 2XVPA 3PK7A 2Y61A 4A8RA 1G4TA 1DJGA 4O52A 5IM51 4HMDA 3UWZA 3SI9A 2ELBA 4NIRA 1X38A 2O7QA 3OWGA 3DKLA 4WEVX 4FOUA 5G4EA 2EPMX 1XP3A 3WQGA 4JFUA 4MB1A 2INZA 5DXYA 3P80A 1XGZA 1W1YA 3W7MA 1HIZA 3EOSA 1VYPX 3ZVHA 4ZOBA 1S46A 3THAA 3WH5A 1W1TA 3TR2A 2PDFA 1JDCA 2WNNA 3NPUA 3USBA 3VNKA 4E2OA 2V82A 2INEA 3UYIA 1T8XA 2EPNA 2KAUC 4LNCA 5BXTA 4FF5A 3LGEA 1OCBA 3LV6A 3EOUA 1CXLA 2OB3A 1Q7ZA 3CZSA 1NOWA 1V3LA 3WLJA 4KBXA 4E2BA 2NSXA 4AZCB 1GVEA 3C61A 3MP3A 4FXSA 3DBPA 3GBDA 3HOJA 2VD9A 4H9ZA 1V0MA 1F6PA 4PTVA 2FVMA 3FV9A 3HMJG 3S5OA 3MTWA 4AVOA 2ON3A 1Q5MA 1PAMA 3LXBA 4FI4A 1NIUA 4H4IA 5DRIA 1LBMA 1LRNA 3RX2A 3URQA 1XLBA 4UFMA 4J9JA 2YL5A 3JUGA 1XYMA 3NQ8A 4ZXOA 3TP4A 3RM4A 1EZWA 5H8MA 3N25A 1HXJA 2QCCA 2ACRA 1SU6A 1ECEA 4U5KA 3LTSA 3BAXA 3QW3A 1TPDA 3QSTA 4QJ1A 2ISDA 3QGAC 3K8LA 3EX6A 2CZDA 3KLLA 3TIMA 2Z8YA 3W7RA 2OYLA 4GUFA 4DN1A 2EF9A 1UCWA 3HPXA 3NL3A 3DERA 1JUBA 1UP0A 4F2BA 2P8CA 4PTDA 1AH4A 1F3WA 2GVYA 5A1AA 3UXIA 1Q65A 1SW3A 3WLSA 1HJWA 1WAUA 4XK2A 1GJPA 1MYRA 3AIVA 3LPGA 4J2MA 4US5D 4O13A 1J93A 3TV8A 3TONA 4W5ZA 4FR6A 1OWQA 2YCJA 3FXGA 2OELA 3CAQA 1MNZA 4NU7A 3W1PA 3FEMA 5ABHA 2A1YA 3CQKA 4QG8A 2PDKA 4J3VA 1C93A 2VRKA 2ZXBA 5K7JA 2XGIA 4W7VA 4HTYA 1KM1A 4NSWA 2CLIA 1XLMA 1YHTA 1ADOA 4K38A 3AFBA 1QDSA 4ML4A 4H6KA 4JTEA 1RQHA 3M1ZA 3AICA 1K4HA 3ARYA 3ORWA 4F4RA 1K8CA 1HNYA 3U2EA 2ZXQA 2BV9A 4XO7A 2NCZA 3RFAA 3BZJA 1JXKA 4WD0A 1P0EA 1QPKA 3DENA 4S3BA 2V63A 3AMCA 1NFPA 3MJYA 2J9ZA 4UQBA 3RRAA 3NPVA 2BDQA 3M5VA 1MXSA 4WDUA 2Z1SA 3D2FA 2BZNA 3P14A 4HNVA 5JIWA 4DNHA 4I5XA 2PFHA 1HJVA 1V03A 1VFSA 2OQLA 3Q58A 2FJUB 5AHNA 1V7AA 4PE8A 4DJDD 2C7FA 2E8ZA 2I16A 2YL6A 2NUYA 1EKOA 4N2YA 1ME7A 2YZ5A 1LTDA 1FP9A 1GOXA 1QVBA 1RCXB 1Y0EA 1HL8A 2POTA 5CJMA 1I2PA 2C91A 5LNRA 1MWOA 5EU9A 5CPSA 3WL0A 3FJNA 1B2YA 1C29A 4K68A 4CCDA 2XSAA 3NAVA 5CKSA 3RM9A 1R9XA 3AS2A 4UR8A 4LBSA 3GDTA 1RR2A 5M1TA 3GHRA 3GHSA 4QNEA 3V75A 4NAEA 4AD1A 1BLIA 3W2LA 2R8WA 3CO4A 1O5QA 4OTKA 2QXWA 4FXRA 2ZA1A 4QG9A 2WHJA 1CXKA 3EDFA 1QOXA 1U5JA 1DP0A 1RBOB 1GYLA 3IJ7A 2X0SA 5F1VA 4H01A 4UQDA 4UCGA 4NNAA 3PAOA 4DYLA 4GVFA 3WFZA 3F5LA 2NLIA 2QS8A 3THDA 4TTGA 1KXVA 3VINA 1QNOA 3O6YX 2CHNA 3MP4A 3RUBL 2DH3A 4LCSA 2X40A 1YPIA 2EGZA 1RP8A 2VRQA 1H7WA 2NXHA 3RG6A 1TPFA 5A95A 3G8EA 1OADA 2RAKA 2EHHA 3T78A 2ACSA 5EBAA 1JDEA 5AY7A 1CW2A 3SUSA 1F7BA 2J6XA 4O1CA 4H00A 2EO7A 5JBDA 1C8XA 1US3A 2WAGA 1CDGA 4HU0A 1ZYLA 4ZQPA 5GJPA 5DCBA 2Z26A 3ARRA 3LDVA 3DFYA 3SUVA 2WZEA 3OHMB 2RJGA 3HJZA 4L9YA 3V36A 1KV8A 1OJXA 1CECA 3V0UA 2J66A 1S2TA 3WQ5A 1XYLA 2ZUVA 3NQ2A 5LZLA 3VMOA 1TJRA 2VQUA 4HJWA 3WMSA 4XZWA 1FH8A 3GXNA 2QVHA 1R33A 4BK9A 3UR8A 4QLJA 3AWOA 3W1MA 1OCNA 1TV2A 1SJAA 1AVAA 1GKQA 1QFEA 1UWRA 3CV5A 3TDFA 3MUCA 1S5TA 3EJQA 2OKTA 3VOFA 7TIMA 1GCYA 5HQEA 2PWDA 3I7RA 3WQCA 4PMXA 3GUGA 1REQA 5HULA 1P6CA 1R5YA 1UKTA 2ZRXA 3W07A 1UPMB 5K4ZA 2QAFA 3F4WA 3TQPA 3APTA 1VKFA 4WHBA 3B52X 1YDVA 1QTWA 4GO8A 4U3AA 5H2ZA 1IF2A 2RT6A 1FKWA 5F2GA 2WMGA 3NQEA 3FJ6A 1BYAA 3SFWA 3QE6A 5AYIA 1ICSA 3CYVA 4PMDA 1XW8A 1TV3A 4DJFD 2VQTA 2VFEA 2Y7FA 1E15A 1O12A 4N7QA 2FDMA 2RGLA 3AC0A 3LHVA 3WFAA 4R3UA 1YQ2A 1J18A 4P61A 4JL2A 1EEPA 1BXNA 1FWBC 2X1SA 5DY2A 5XINA 3TTSA 5A8QA 1W3IA 2J7FA 4UFJA 4PUWA 1H60A 4Q33A 1WOAA 3EX1A 3NZPA 1DHKA 2WCGA 1GW9A 3ZR5A 4GGHA 1OSEA 4G6CA 1WXJA 1JRBA 3BW2A 3DI1A 4FA3A 3N17A 5FEWA 3IVUA 4WDXA 5CEWA 2E6FA 3QGVA 1E6PA 1AFSA 2NT0A 4QBXA 4P7QA 1JI1A 3PWGA 4GYPA 5CG7A 1AQ0A 3OVGA 1GVIA 2GAFD 1F4HA 1PVNA 3FDKA 5GVJA 1V3MA 2Z24A 3NSMA 2DVXA 4MJZA 3M0KA 4OGZA 2D23A 3BUDA 4JNYA 4EZSA 2WLYA 4A3UA 4C6PA 2O4QA 3CMGA 4Z2GA 1THFD 4KW2A 2OYKA 3CZEA 4QTGA 4LYQA 3OYZA 3W72A 5IHSA 2BB0A 1OFPA 3LLXA 1BGAA 1YPFA 4A29A 3T40A 1X6UA 1NF7A 5BRPA 4M6PA 4QFUA 2XDFA 5JH2A 2QCFA 2C8NA 3A6OA 2TYSA 2YXGA 2DU2A 4GI6A 4G7EB 3T0CA 5HWJA 5AZ0A 3EX2A 1DJXA 1KTNA 5REQA 1A5SA 1GG1A 4N4PA 3KAVA 2DT1A 4MKNA 1JNDA 3M46A 3LBCA 4FR1A 5I02A 1M7PA 3W7JA 3DDMA 2G4JA 3SCSA 6XIAA 2Z00A 1Z41A 3GAKA 4PMUA 3POCA 2BHUA 2ZRWA 2AGKA 3UXLA 5U4NA 2OWCA 1ZZMA 1Z8AA 1LYXA 4GZIA 3R13A 4Q4MA 1V6YA 4GCXA 1URUA 3DG6A 5TD4A 2ATMA 2CLMA 3D52A 2DT0A 3MUAA 2ZRVA 2X09A 5I3KA 3AWNA 4GI8A 3LMFA 1SU8A 4GUGA 3UJSA 1FHVA 4PCSA 1H3GA 5C9XA 5BCAA 2C71A 9XIAA 3OW1A 1EUNA 4MYXA 5TBOA 2D2HA 3BAYA 3CO8A 4LFYA 3GTXA 2D2OA 4KIRA 4ZQNA 1F76A 1NWRA 1ISVA 3VTRA 3CL6A 4UDYX 3KCJA 1KKOA 3L3OM 3VM7A 3OB8A 1A50A 2NQ5A 4JTQA 4XBKA 3OTRA 1TV5A 1R3TA 3FHAA 2VM8A 3ITVA 5G1TA 5HDRA 1FWSA 4GNVA 4C5ZA 2A3HA 3PNZA 3M0IA 4HA4A 1DE6A 1H7PA 2FIQA 2CERA 2H9AA 3AZRA 2WB5A 3JRKA 3KM8A 3RX3A 3TLLA 4HSOA 1GHRA 3BVXA 3W7EA 5CJ5A 4MWAE 4D6FA 1X1NA 4FX6M 1EP1A 4A3QA 3WK1A 3CHDA 3CUHA 3LHYA 2E6DA 3S2CA 4DF2A 3CB3A 3L2LA 2HBXA 3VIOA 4CCZA 2PI6A 4B9ZA 4L65A 3OHIA 1LL4A 2EG8A 2ZUUA 4C1LA 2VZVA 2B7NA 4ADTA 3BLLA 4CVUA 3N9KA 1ALDA 2AAMA 1IR1A 2XH2A 3NQMA 6ALDA 3VPLA 4E2VA 3V1HA 3C5QA 5LIXX 4REQB 4MPQA 3BARA 2WZTA 3BOFA 1VEPA 3VKHA 1I49A 2PDIA 3R1ZA 2X7VA 5FJUA 4HPNA 3B40A 4S3CA 3QHNA 5DANA 2QCLA 4Y8FA 4CGTA 2PZ0A 3C0LA 2QV5A 2CLOA 1I8JA 4DVOA 1DIDA 4KWWA 1RALA 4AF0B 5E70A 1GK8A 1LLZA 2OU4A 3HQOA 5EFFA 1WKYA 5BWAA 3OIXA 4O1AA 4PTWA 3WUEA 1FY6A 4HBKA 4FB7A 2HE8A 3WL1A 3Q45A 3S9ZA 3AUOA 3JS3A 3B8DA 2QMKA 3LGGA 3RDKA 2J25A 1WUEA 1PBGA 1X7FA 3GAYA 3U8GA 1RK6A 1MW3A 4JKLA 1OHLA 3EKZA 4ZFMA 3KRUA 2DSWA 2GJRA 3E2RA 4KWOA 4HQVA 3FSTA 1JCNA 2BVDA 1E6XM 3SCTA 2D20A 3STGA 2Q71A 3CAWA 2ZUMA 3GXPA 1GOOA 3HZ3A 3CB8A 3MSGA 4M56A 1BVZA 2OBMA 4JTKA 1XPYA 3ITXA 4C90A 2HBVA 3BSMA 2NSOA 5HMEA 5LA2A 2NZLA 2VC5A 1UD4A 3SQMA 5T8GA 1GT8A 4WSHA 2F9RA 4BWLA 2VFDA 4MB4A 4HJFA 1OGSA 2G8ZA 3K1GA 1B90A 1UIPA 1J2BA 3E0LA 3WNKA 1GONA 3UG3A 4AAJA 3CV7A 1P43A 4KPLA 2HMCA 1E72M 3M44A 4HMEA 1KXHA 5BOFA 2YR1A 4KCVA 1J0IA 4WSJA 1OCQA 1K8XA 4H7CA 3VIKA 3B9NA 3VC5A 3MPGA 4PUJA 2YFNA 3ZVHB 5CPTA 2XWEA 1A0CA 1ZFJA 2PDMA 2PDJA 4B5XA 5TKYA 3HGRA 4EANA 3K4AA 3GD6A 4J3UA 1XICA 3KHJA 3AYRA 4IPNB 3DYPA 1MXGA 2QW5A 4LVAA 3C0QA 4RZ6A 3P61A 5DMYA 3D2EA 1VJZA 2P3ZA 3O63A 3AALA 3AZTA 5BOOA 5A6BD 3BH4A 1SW0A 2X1TA 4NNBA 4Y9NA 2P10A 1W5PA 1R3VA 1OIMA 1WX0A 2RAGA 3WBXA 4JWIA 3W6MA 4PRTA 3RR1A 4EZPA 3P81A 3DFNA 3GNNA 4RDWA 3A4JA 5ABFB 3DXIA 3XINA 1US2A 1UUMA 5J5RA 4UNLA 3AIWA 3BGAA 4XD5A 4O1BA 2VCCA 2E9MA 1DTUA 2VRJA 3GR8A 2FH6A 3MMTA 4NILA 1E0TA 3UZYA 4NI3A 4GINA 1QNRA 5DEZA 1W5MA 3POHA 3GFYA 3RJYA 4EZXA 3A13A 1WV2A 2W66A 3QHOA 3DDGA 3M43A 2RKXA 4ZENA 3EMCA 3ELFA 1DXIA 1MNSA 3W53A 3H7RA 2BFGA 4DWDA 1PZ0A 2ESCA 3WJSA 2V2DA 4DUOA 3DKJA 4UBPC 3RAOA 3AIRA 4YL2A 2Y70A 4LC6A 1SQ7A 3CUXA 2V5LA 4FZSA 3VDAA 4ZSUA 2G96A 4O14A 5K9DA 2G3NA 4H19A 1CENA 5CG0A 2WANA 2CXEA 5BRBA 5JH1A 5EBUA 2D4CA 1LG1A 2HPMA 2I5QA 1H51A 1VLWA 3OBAA 1AL8A 1M41A 1VYSX 2VDGA 1PYFA 5F4XA 1UIOA 4OV4A 1ZGDA 1EOKA 3PUDA 1CWYA 2VOTA 1V3JA 4UMBA 3B8VA 1DIEA 3QMRA 3JZEA 5EA9A 4PUUA 2VOMA 4PMOA 1OYCA 4TQTA 3DFSA 4H9VA 2HTMA 3EXSA 3LQLA 1XUZA 5DELA 1VFMA 5TAOA 2FLIA 1HJSA 1RQBA 1I2QA 2DGAA 4FIQA 1GOKA 3VFCA 1E9YB 2G4FA 4J1OA 4XVEA 1A3WA 4DO6A 3MMDA 3E49A 1EBGA 4PB3A 1DKWA 3NSNA 1ESWA 1RBLA 4ZOAA 4U4MA 2E5BA 3WUFA 1SMDA 3CPUA 1XYBA 1OA0A 2D0GA 1D9EA 1P7TA 3OP2A 1QX1A 5GNYA 3RPTA 1TJ2A 3O7UA 1R34A 1BWVA 2C3ZA 1FWWA 2VEGA 4AHQA 4ZEPA 1M7JA 2NVAA 5CZJA 2E9LA 1UKPA 1XCWA 2PDQA 4UTUA 1GKPA 1HKKA 4XD3A 1XIFA 1E5NA 4YTUA 4CN6A 2ZE0A 2PLKA 4JIRA 3FA4A 2NXIA 1TVPA 3WQFA 3QR1A 2AQOA 1EHNA 4LU0A 3QLDA 4WZHA 4YS1A 1FCBA 4DWSC 1LQ0A 4HNLA 4Z2HA 2QJMA 3OLEA 1R87A 3DECA 3MMWA 2BGQA 3HQPA 1X98A 1DE5A 3SSJA 2GGJA 1JZ7A 1GQJA 2HXUA 5CPMA 2NX1A 4XISA 3FDGA 3GU1A 3NG3A 5HINA 4C6CA 1OAOA 1UJPA 1UR3M 2V3FA 4KRZA 4HR1B 1OB0A 1VFLA 3FJ4A 3O07A 3ITOA 3I3BA 3SRHA 1LORA 3MCMA 4FXFA 4O54A 4X3ZA 2QMJA 4QEHA 1UWIA 1JF6A 1LWIA 1DWFM 2RDXA 5DO8A 1XD1A 1KD0A 1RAKA 3HFYA 3VYLA 3DZ1A 4EX4A 5TF0A 4DBDA 1XBZA 3D47A 4CNNA 2Y4SA 4E4PA 2PTYA 3S83A 4Q8OA 5CCZA 2WQPA 3IRSA 4HYBA 2E5CA 1M9HA 3THQA 2IUZA 2GJXB 3W1RA 1VBJA 5E9XA 3BG3A 1Q2SA 1WDZA 3TYCA 1ZTVA 2B31A 2YI8A 3QHMA 1CCWB 4A05A 2JKAA 5I24A 4KRTA 3O2LA 3S1UA 5GPRA 2IXUA 1W9UA 4HNNA 1WUFA 1UR9A 2Y85A 4Q7IA 5AHLA 3S1GA 2WMIA 1SFJA 4UNIA 3SBFA 1ISXA 2DJXA 3G18A 2J6VA 2GGHA 5E0CA 1ZY9A 2J7GA 3TQ0A 1LLWA 2QDDA 3GVRA 1Y8BA 1UWQA 1RH9A 3B4UA 3OZYA 2CLFA 1UHVA 2OZ0A 2DSVA 2FMOA 3D3FA 4C6DA 1PDYA 5LIUX 2ADAA 3WK2A 4U28A 1EGMA 2D0FA 1TUXA 4ML9A 3U3HA 2YL8A 1EJUC 2WJEA 4HN8A 4JS3A 1R9YA 1E1DA 4AZGA 5FF3A 3UNTA 3VIGA 4A3RA 5C9WA 4G9PA 3OA3A 2XFYA 1MEIA 2YCIX 2JNKA 2RHGA 3URNA 4XZNX 1OIFA 1IIGA 2JK2A 1PIIA 3P7YA 4GC4A 1W37A 3TTYA 1OD0A 3VO0A 4JTDA 3L4XA 4GJJA 5CPNA 3V5CA 4HNOA 1Y65A 4Q8PA 4UTIA 5GJMA 4FOKA 2J75A 4KETA 1XXXA 3AMLA 4GUHA 3WQPA 2WO5A 2WNWA 2NXGA 3N6QA 2Z1VA 2O0TA 4AYGA 1BTCA 5KEZA 3HBLA 3NDYA 4MNJA 2VYOA 3WDIA 3QVQA 4XB3A 2ASHA 1H1YA 3HAIA 4NX0A 2QR6A 4AZ5A 3RLHA 2D2JA 3TQKA 1UB3A 4MWAC 3F1QA 2Z25A 4JNFA 1BXCA 3CZLA 4IQLA 4F8XA 4PCPA 3TZFA 2HK1A 3W75A 5HXMA 2NX3A 1N8WA 1WB0A 3DYTA 4N02A 1RPKA 2CLEA 5BU6A 1DKYA 4BF5A 3M0VA 5D2WA 1A4LA 3KXQA 4DLFA 4XQ6A 1TQWA 3W81A 4LC8A 4A2SA 4FLSA 2B7OA 3PAJA 7TAAA 5A2BA 4XZMX 1BHGA 2OOFA 1YE6A 5I3IA 1DWHM 4PULA 1VFOA 5C9RA 2J88A 5F2MA 4LUYA 1XGDA 4JX6A 5I23A 3PBVA 3QY6A 4LAMA 3UZ5A 5C0QA 3EDEA 4W8BA 1Z42A 1BF2A 2ZZ6A 1XIEA 4BQ4A 2O7SA 3S9IA 3B05A 4W9TA 2NQLA 4MNLA 1L6FA 1CX9A 3W2JA 2P50A 1JYNA 1GHSA 1DWGM 3HPSA 1Q85A 1ZBVA 2WJDA 3QA8A 4JHZA 1X7IA 3GXDA 3DG3A 2OX4A 4B5WA 2H8ZA 4KWVA 3STFA 3HQNA 3HV8A 3CMFA 2W27A 1Q8JA 3ZLFA 4MAZA 3RPMA 1E6NA 1GORA 3E0VA 3T0AA 2PLCA 4RK8A 3TWBA 4HPJA 2F84A 2MUCA 3Q4DA 4RLIA 1JNEA 1PWMA 3TROA 4V28A 4IWOA 3KWXA 4ACZA 4LT9A 3KP1A 2WHMA 1EBHA 1Z7AA 3W22A 3PR2A 2PD9A 1GYNA 1C8YA 1ZSXA 1P0NA 2DSKA 1G4PA 4ERAA 2WBGA 3G6LA 3KBSA 4J27A 3WQ6A 1XRFA 5AYBA 3MV11 3PZVA 1PIFA 4WJEA 3TJ4A 3DGBA 1K3UA 3VNIA 3W29A 4DUWA 1YXDA 2TMDA 4AC1X 3MYOA 2ZC1A 5CPQA 4MLRA 5PTDA 3VIJA 4D6JA 4G56A 3IWPA 5D09A 4JY9A 2VD8A 4ZB2A 3VCCA 1H7RA 2RH9A 3UJFA 4JFTA 1NEYA 3L5AA 3CPRA 4AWSA 2DW7A 3QOKA 4ZQRA 3TOPA 4RPPA 1PEZA 4CCCA 3BQ6A 4XAZA 4AHPA 3RM8A 4O8RA 3M0JA 2X3XA 3TE9A 3ZVIA 3R2GA 1JL8A 3T0BA 1AG1O 2OSWA 2X0YA 5F7UA 4MF4A 3MT1A 4NAFA 5I3HA 2DUXA 4C60A 3VX1A 3ZT7A 2FVKA 3KWSA 1EHAA 3R79A 1EXPA 1K6WA 2XVLA 2OWXA 2GQ8A 3N2CA 4GI9A 3NQFA 1AW2A 3ABSA 4MJMA 3VILA 4G1NA 4MZYA 3FAWA 3WJZA 3PJXA 4PMNA 1Z69A 3T2PA 3OIHA 1KW1A 2OLAA 2WVVA 1UOZA 3BVJA 5BRQA 2XH4A 1GVRA 3VGDA 8RUCA 4BZYA 3CWOX 3N14A 1GOMA 3TW7A 1NQKA 3WNNA 4RNJA 5D37A 5D9NA 3LHUA 3R8HA 3C3UA 2WVSA 4C1NA 1UD5A 1WA3A 3WJWA 3CUFA 4KWSA 3CQ0A 1GJWA 2BHZA 3CAKA 3C6CA 1IZCA 4FNUA 4FNQA 4JTRA 2QF7A 7XIMA 2Y63A 4JOMA 1KR1A 5CZ0A 4GVGA 4HA0A 3BVTA 1LZOA 1PX4A 3O6CA 2HJPA 4Q4OA 3GTNA 1G7UA 4PR4A 1H63A 4WOZA 3LNPA 4B15A 2YCEA 4LALA 1Y5WA 4Q4PA 2P8BA 4X22A 4O12A 1QASA 3KS6A 2HZGA 1FWHC 3PP7A 2BWGA 3CASA 4TXEA 4PUKA 1ZB5A 2XJ7A 2HEJA 4KIKB 3ABRA 3G1XA 4UC5A 5I78A 3OBEA 3B0YA 5EKYA 1GZJA 1QPQA 2X3VA 1UR0A 1JQKA 4CEUC 2VELA 8XIMA 1MW0A 3KUMA 4Z08A 3LCXA 4O19A 2G3IA 4B3ZA 4WKHA 2W63A 1S5VA 1AODA 4EF8A 2WOQA 1EIXA 3IJQA 2WC7A 2JBMA 4M3PA 5F1UA 2YSWA 1VIZA 3TC7A 5I06A 3QH2A 3CIVA 3D51A 1UUQA 2EBNA 1WDSA 1F6KA 4PRWA 4F2TA 5HJLA 4LAKA 5AHIA 1HP4A 3D0CA 1E2UA 4F0SA 4KH2A 3I7QA 3V3WA 5FEXA 4N9CA 3WLIA 2DORA 4X9SA 3KS5A 4Y9OA 5FSDC 2ANUA 4JNEA 4Z2IA 2IXVA 2YLLA 1BKSA 4ZL1A 1ZRQA 2V5BA 3PVFA 3FGCB 4JY8A 3TN4A 1YXCA 3PN8A 1UH4A 1A47A 4M6QA 1WZKA 3BV4A 4R53A 4PBGA 1RJPA 3DPPA 5MHBA 5BMXA 1AZ2A 1I2OA 3B8TA 4B5UA 2GQ9A 3KL5A 1MDRA 3VFLA 5KZ6A 1JDFA 2BY0A 2ALRA 4OBTA 2QJJA 4XD4A 1HL9A 1KFEA 1TMLA 4ATDA 4EKJA 1NWTA 4A6GA 3PUGA 1G1YA 3Q2DA 1SMAA 4HYWA 4AVMA 1LM1A 2GL5A 4LVBA 1XM3A 3N6JA 2JFEX 2DSZA 3U0HA 1TWSA 4I5RA 5AC5A 1HXKA 3ANVA 3G0UA 5FKYA 2YPIA 3OU8A 4ZBCA 3TTQA 3TJXA 1R5EA 2H90A 1J6PA 3GZAA 1H49A 2XSXA 3HG3A 1M6JA 4IX2A 2EX3B 1TR1A 3NZRA 4PFHA 3UG4A 2RFGA 1MFVA 3BAWA 1E0VA 2QAPA 4GACA 5F4SA 3RLVA 4Q6XA 1OY0A 4JTUA 5AYYA 2G3JA 1V02E 3PNUA 3KVLA 4MKVA 4FZPA 1C9DA 3DX3A 3I3DA 3WUBA 3EWCA 3BOXA 2QCDB 1RA0A 2QCMA 1W91A 1W2PA 1HN1A 4DLMA 3W70A 3HG2A 3GQYA 4R7WA 5BWFA 2JNSA 4GHRA 4D8LA 2GFTA 1CGUA 1WDQA 4RE4A 4PMYA 1VLIA 2YIVX 2GGGA 1XIDA 5D2TA 4CQAA 1PJ9A 1XYCA 4PEKA 2WINM 1IYXA 1WZMA 4JNMA 4FPSA 5GNXA 1AH0A 1D3HA 3U9IA 4O1DA 1XR2A 1W0MA 3WBEA 4Z1YA 3R0DA 4LPCA 1TMHA 1B3ZA 1TV4A 5CC7A 3C3NA 1DKXA 4LUJA 4GKTA 2REQA 3TJIA 3GG1A 4P8WA 5FF0A 1S2CA 3URBA 2CWXA 2OCZA 5HMDA 3USZA 5FOOA 2F7OA 3S2JA 1OZMA 3VDCA 1KB3A 2PF0A 5A3HA 1CBGA 4OOUA 4WY0F 4KEUA 2F7QA 1VCVA 4JDBA 3W2NA 1I0BA 5FL0A 3VD4A 3MI2A 5I7GA 1FXPA 1MDLA 1U30A 3QOMA 1EQCA 3VOCA 3C8NA 3L5LA 4JXCA 5ECVA 3GNRA 2QQ6A 4AH7A 3VIMA 3FJLA 3TAKA 1QATA 1QHOA 1WDRA 3WDHA 1B5TA 3OEXA 3STPA 9RUBA 1MZRA 3HPZA 1WZAA 2DPEA 4FX7A 3MANA 1QXLA 2FB2A 3R11A 2HNHA 2VI0A 2HISA 2J24A 1PKLA 4I9AA 3JW7A 4XZIA 2UV8G 4UQEA 2ZZ5A 2E77A 1NDVA 1A0EA 4E4FA 1F9CA 1JEZA 4G7FA 1O7DC 3VNJA 4E0CA 4MHBA 5D9PA 2W4XA 1ZAIA 1DTNA 2OGJA 5KBPA 1C92A 4NASA 3L4TA 4YWIA 3PTKA 4AC7C 5A8PA 4V33A 5CLWA 5FI8A 3K8KA 4HZ6A 4NF7A 3CV2A 3VUSA 3SZ8A 4J28A 1P1XA 3APYA 2CCRA 4NVTA 4ZTYA 4JX5A 1F73A 1KFBA 3W1AA 3WEZA 3ARWA 8TIMA 3IIVA 3ZOAA 3K2GA 2Y5EA 2ALDA 2IKGA 3LRMA 3KBJA 3W7CA 4L4LA 3EEZA 1E70M 4NRSA 4LW7A 3ABXA 2PP3A 4Q8MA 4PH6A 4P7NA 1ZCCA 4FS9A 4UOJA 3IANA 3FKRA 1GVYA 4JLCA 2FZBA 4XBSA 3LNMA 4M82A 1DXEA 2AQWA 1KCZA 3W85A 1A4MA 4O8AA 4IP5A 2PS2A 3KBNA 3WLMA 4NT0A 4CVWA 1GW1A 2ZXAA 2QIIA 4B5NA 2VL4A 3RHGA 3QV9A 4R7JA 3A23A 2C0AA 4B3KA 3TZNA 5G4HC 4CU6A 4YIWA 4YYFA 2ZRZA 9XIMA 2E3ZA 2V68A 2HVOA 3VDHA 2Y88A 3AO0A 3WSUA 1A5MC 4JQ2A 1PTGA 1IIHA 1PHQA 3E0IA 3WLPA 3A5FA 3UBPC 4DO7A 1DYSA 1E6ZA 3I04A 1ZNNA 1NDZA 1GZGA 1M5WA 1H41A 3LERA 1FWAC 3UETA 4ZCWA 2BVWA 4H9MA 3L4VA 1JPMA 3I68A 3EOLA 3EJRA 2XWDA 4L64A 4RNIA 4JTIA 2CLHA 5D2YA 3ARTA 3GWQA 3IPWA 1UKOA 4FP1A 2YDQA 1K1DA 1TPUA 1BAGA 1PTAA 5BYWA 2VO5A 4RDYA 4RXFA 3WH8A 4W85A 3C0JA 1UC4A 5FF2A 1XCXA 1XKYA 4H41A 3W76A 1FWJC 1X39A 1F3XA 1KLYA 4AMAA 3ACOA 3GKFA 5D9MA 4QSFA 3IS4A 4AZCA 4K2SA 3VKBA 3W7NA 1IZKA 4US6A 1X6NA 1NTHA 1F3EA 2X30A 2C6QA 4PBFA 4OVXA 4AW7A 2OXNA 4K1WA 4H6RA 3T4AG 1EFZA 1OVDA 1EUAA 2R1PA 3FXYA 3KFTA 4OWGA 2VC7A 1EJRC 4F9DA 3C2YA 5I79A 3SGGA 4Z2KA 4PMVA 4KGJA 1HX0A 2A3CA 4UFIA 1KWKA 2YIBA 3L12A 2V2CA 1NOFA 3EOOA 2QDEA 2JGQA 2PTZA 3A4AA 1XISA 3NQAA 4RDVA 4LCRA 1KM5A 2OG9A 5DY3A 4GIYA 4HZ7A 2YKTA 2YA0A 3F5KA 1DJZA 3WNPA 2PRMA 2WSRA 4Y9PA 1SO6A 3O16A 5KZMA 3CZKA 3TK7A 4LYKA 1SR0A 4C6QA 3ITGA 4BA0A 1EO7A 3JR2A 3UA4A 4DJDC 1S2AA 3A64A 5AN7A 3GVWA 4JL9A 3T44A 3T1GA 1C3FA 3H23A 4IIDA 4Z0SA 3R0UA 3KDOA 2F2HA 1V6VA 3EDKA 2ISFA 3PZMA 3AZSA 1DPMA 4N9BA 3B0VC 3SEPA 1U5HA 3WD0A 4ZB0A 4C6LA 3HURA 3W82A 1LUCB 1YEYA 5A6SA 3BG5A 2IPGA 5H1WA 3MW7A 4AEFA 4KWUA 4L4MA 4HCHA 2OT1A 2OX1A 2C08A 3TUUA 1Y2OA 2GDVA 4ZO8A 3JVAA 5LYRA 3ERPA 2NLYA 3SUTA 1ME8A 2ZCGA 3NYDA 1XBXA 3ARZA 2A3EA 2JF6A 1XIMA 4CUCA 3WBAA 2JKPA 4HCLA 3N18A 3CC1A 2YW4A 4AIEA 4DJED 3LBMA 3PG8A 3WF4A 2WLZA 3D4YA 4B90A 3ZLGA 2LM0A 3NL6A 1ZL1A 4NP7A 3W7PA 1FWEC 2J79A 2PY6A 1QHZA 3GNXA 5IDIA 1ZJHA 4WGHA 4YWSA 4E3TA 3ZR6A 2CNCA 4IJBA 3SIMA 3CS2A 4S3DA 5D30A 5AKQA 3UWUA 1XDMA 5HNUA 1TQVA 3CNYA 3ZEDA 1P5BA 4FAMA 1MFUA 4HK7A 5MKGB 3B51X 1V4YA 4I3GA 4IMCA 4WR3A 2E67A 3GH7A 1UWUA 1H0GA 2YJQA 3LCFA 3GKAA 2C18A 3RX4A 1O94A 3KRSA 1OFQA 1KBLA 1NFBA 3TAOA 3CHFA 1PPIA 1SO3A 3RRXA 5LIWX 4BF7A 1J79A 4ACZB 3SGZA 3ZS4A 3UXDA 1LQ2A 3RV0A 4DBSA 1MW2A 4G1KA 3GDMA 1PKMA 4Y7EA 4U5IA 4KFNA 2Y5SA 3LMYA 2XN0A 2DW6A 3QM3A 3DX2A 2V5DA 4O0KA 4EPBC 4L56A 3BVWA 1H62A 4UMAA 2FKPA 1GPWA 1XRSA 4ORMA 4AIUA 1RJRA 5LNSA 2F1BA 4AHOA 3PTQA 4N4QA 1GEQA 5FJIA 2OBLA 2E8YA 4W86A 4WSKA 4IG2A 1LCOA 4ZQCA 3UCQA 5A8MA 4O16A 3ITTA 3AMDA 4OFCA 1R9ZA 4NQIA 3CUIA 4M7TA 2QV4A 2CLKA 4A8IA 4Y2WA 2ZADA 3VMNA 1RCOB 4YTRA 3W7IA 2XVKA 4AD0A 2WBKA 4WJ8A 4DJFC 1B0IA 2F6KA 2XGBA 2W9MA 5LKYA 2IMRA 3FN9A 1FX6A 3AYVA 3GIPA 3OVPA 4Q8NA 3WJYA 4LWWA 3D46A 4KCUA 4S39A 4NKCA 4RE3A 3CAZA 4NYUA 5HOSA 5FIGA 3MUIA 3QZAA 4EWJA 1TX2A 4PTNA 5HR7A 2WMHA 3MU7A 3QPZA 4LEQA 5JIPA 4QHRA 1BWKA 1PSCA 1GJUA 3PZ9A 2I5GA 3ARVA 1NU5A 1K9DA 5HNTA 2R24A 4E4UA 4KF1A 4FMVA 4IJCA 6CGTA 3AJXA 3VAVA 3FYYA 3H2EA 2DT2A 1F8MA 3VU2A 1DQWA 5CPOA 4AXNA 3VOHA 4ICMA 3OZOA 1Q6EA 3V0SA 3TW6A 1E0UA 3FKKA 1UQYA 3QYQA 1PDZA 4DM1A 1QK0A 2E6AA 4HA3A 4M0MA 3H55A 2Y5JA 1O5KA 1UW9A 4L80A 1L6SA 4YHGA 3LI0A 3K4WA 4GISA 3U5UA 4QITA 2VWTA 3CZNA 4PL1A 3F2CA 2J7BA 3EX3A 1TIMA 3DHFA 3TC6A 1VEOA 3LLLA 3REQA 1RLCL 4M8UA 1CLVA 3Q65A 1SFSA 4ACYA 4DB7A 2YI9A 2NVDA 4JQAA 1P4CA 1SO5A 4DX3A 1YDNA 3UNDA 1V77A 4IL2A 4IMEA 4UZUA 3AJ7A 4ROPA 2Z0NA 5IXEA 2Z2BA 3B0UX 3SRKA 1QI4A 1UR4A 3H54A 3Q67A 1NQ6A 4F0MA 4PUEA 3L0GA 1BPLB 3G1FA 3VD3A 2P1FA 1JFXA 3P3BA 4D6GA 3QKZA 3TXZA 3SN1A 4KIEA 5E9AA 5D8WA 3MV01 4TO8A 3THCA 4D1IA 4XWUA 5A6JA 5M2FX 5SWUA 4PFMA 4PSRA 4C6KA 1FWDC 1TWWA 3OGVA 5KETA 2VC6A 4Y96A 1FBAA 1ECQA 2GJPA 4KESA 2ZBTA 1KBIA 5EYWA 3T6CA 3UY8A 7ODCA 3N11A 2PGRA 1JUKA 1ADDA 3CH9A 2PWEA 4QM1A 2C14A 3VKCA 5EB8A 4MTVA 3L4YA 2C79A 1HZYA 4NUWA 2HVMA 4A3YA 4H2HA 3HGOA 3GHTA 3NL2A 2PDBA 2BASA 4YTTA 4HHLA 3ZYZA 1GPFA 1KCXA 1MQRA 4QLKA 2FB3A 3PG9A 3V5FA 4UTWA 5M17A 2BHYA 5DFAA 1N7KA 3VM5A 1U33A 3NUKA 4EZWA 1AJ2A 4K8EA 1X8FA 3QF0A 3W1QA 4AU0A 5FJJA 3APGA 4TU1A 4U10A 3S5NA 4GNKB 1OYAA 2EXOA 3R12A 1WOBA 4N0RA 1EJ7L 5JXQA 3EB2A 3EWUA 4M1BA 1UKSA 3TR9A 1G4EA 3WEOA 3LB0A 1A5BA 4ASTA 5EFDA 1A5NC 4OECA 3WLHA 3RLGA 2NUXA 1WE5A 3CGTA 3A4XA 4EXBA 4O15A 1YXYA 1MQQA 4DF1A 1OFOA 2HSAA 1Q66A 3WMCA 2Q02A 3DI0A 3TFXA 3LZ5A 4WY0B 2D73A 4BEUA 7REQB 4HHPA 3IGXA 4NJIA 1W3KA 4IPJA 1JAEA 1V02A 4D71A 4RZ5A 1G0CA 4L4OA 1A5UA 1JUEA 3NZGA 4JTGA 2MNRA 2FYVA 2V6AA 4C65A 4LOCA 4RUBA 5AHEA 3FAXA 3SCPA 3TN6A 3D3AA 3PSWA 1T41A 2EKCA 3CAVA 5DMNA 1N55A 3EB3A 3R4IA 3KOYA 1JRCA 5FAGA 3BOLA 4UTFA 4MPKA 2A85A 4HU8A 1DOSA 3PBWA 5G1MA 2B7QA 1DIOA 2F2KA 3WENA 2UY3A 4ZO9A 3F4NA 1TPWA 1I4LA 4F48A 5T91A 4ZTXA 4PUMA 4AZIA 2BLEA 2BBFA 2FHBA 3U48A 1CXIA 3I65A 2V0TA 4WUIA 3VNDA 2F61A 3WCZA 1R2RA 1TZ7A 9CGTA 1GYMA 4OBSA 4P8XA 3A12A 5HUOA 4LVFA 2TRSA 2BX7A 1T99A 3QV8A 1V0NA 1EOMA 1BF6A 4J40A 1F61A 1FVPA 1X6LA 2NV1A 5T9BG 3OLGA 1FWTA 4REQA 3VK5A 4F01A 3S5ZA 1V08A 5T26A 4QQ3A 1E4IA 2VVSA 2FFCA 4UZSA 3RO6A 1LT8A 1H7XA 4R27A 4E5TA 4D6IA 3VE7A 2VX4A 1D8CA 1SFLA 3DCPA 4DF0A 3N9SA 2D69A 4DZ5A 1L2QA 4K3ZA 3ANYA 3QEZA 4M19A 5HPCA 1RXOB 4C6JA 1SUXA 4HOZA 2C1GA 1FUYA 2FZ8A 3VZYA 3RF9A 4AF0A 1X1OA 5JQ9A 3VGGA 4FK9A 5KMYA 3C0SA 3HB9A 4H04A 4KERA 2PWFA 3EWXA 1LRTA 3TWAA 1H09A 1WKFA 1XLKA 4UIOA 1NELA 1XLCA 3SAZA 3EMZA 2ICSA 1Q13A 1KFKA 1EX5A 1O66A 2J8GA 1PL9A 3G24A 1KTBA 2IKIA 5D38A 4WDTA 1P1MA 4K39A 3GK0A 1SZNA 4PSPA 4JIEA 4E8DA 3SQSA 1QNSA 1K7FA 1CT5A 1HKIA 1FWGC 1PKYA 3W7OA 2V81A 1TTJA 3GE7A 3W01A 3H4XA 3VMPA 2ZX8A 2PD5A 1TTIA 1FP8A 3FSUA 3C8FA 3T8LA 1UD3A 4GG9A 3T48A 4IWWA 1EL3A 3F2BA 2QGHA 1JPIA 5E5CA 3WQ8A 4IFKB 4AZHA 1K70A 4AWUA 3OZMA 3MB9A 5AVNA 2ND1A 2JE8A 2A3BA 1X03A 3CVRA 4HGXA 3LRLA 3F03K 2QCNA 5CJNA 5F4WA 1KO0A 1FFRA 1TRDA 1OC6A 3P8IA 1ZQ5A 2VFHA 4FOJA 1E43A 3WDJA 2VWSA 4LV4A 3HU7A 2P0IA 2ZWZA 3SCVA 2OOGA 3V16A 1Z9AA 1JYXA 3CPGA 3QQWA 3UCDA 1K02A 3UG5A 1Q6LA 3C56A 4U3CA 2OPJA 5A8OA 1CPUA 3PPHA 2BODX 3H6OA 3EB4A 4UFKA 2GQ3A 4N9DA 1HWWA 8CGTA 1IEVA 1TJPA 4LCQA 1BXBA 3W23A 5G1YA 4DO5A 3B9OA 4WLCA 3BUIA 2Z0VA 4JTJA 1JCMP 2AKZA 4D6DA 1ZALA 3B4YA 3WQOA 3O3MB 1LROA 4GZ7A 3W1NA 1TZ9A 4PTMA 1WNOA 1E1CB 2P76A 3MI6A 3UESA 4J35A 3OPSA 3CXOA 1UD6A 3BLIA 3BW3A 5HWNA 1K77A 1V3HA 5ABFA 3R58A 2GGIA 2HWGA 3DYMA 4MB5A 2J74A 1ONWA 1KM4A 3TQVA 1EP3A 1E4NA 2EJAA 4FNRA 4JQ3A 5HMSA 3CKDA 1MRAA 2JQXA 1AA1B 2YIAA 2Z1WA 4QEEA 1EDGA 4WK9A 3N04A 1BFNA 4HD5A 3W1UA 1DWAM 2PUZA 3UWVA 2CZEA 3W28A 1F07A 1JG9A 1NVMA 3GG0A 3NM3A 1A5LC 4U33A 4AD4A 3NIYA 3N2BA 5KZEA 3N29A 2F6UA 4R9OA 1HFBA 3BWWA 4H6HA 4M80A 2PWUA 4B91A 3SGUA 3WFLA 2C16A 1FWRA 4FLRA 3T55A 2YYUA 4INFA 1UR8A 3TSDA 1ME9A 3HG4A 1UQZA 2I56A 1AK5A 4CU7A 3OG2A 2FHCA 2FGZA 4IIFA 1EC9A 4BNEA 3W2MA 5HMFA 1ZP4A 5A6LA 1VJSA 4ZR8A 4KEMA 5F2IA 4DUXA 4S38A 3WDQA 1VBUA 1QHPA 4IGMA 5A69A 1TX0A 1K8ZA 2QVNA 3M3WA 2Z28A 4UMCA 3GLCA 2UBPC 5FACA 5HATA 3WBYA 1TYGA 3N34A 4YXGA 1W56A 4TX9A 1T40A 1K6AA 3VX0A 1QNVA 8XIAA 3UA3A 4YCOA 4RR4A 1HT6A 4G2DA 2XFRA 4KS0A 3OA5A 1OX5A 3E3HA 4N9EA 5AC8A 2I5IA 1VEMA 1XL9A 1W54A 3EPNA 3EGJA 3WQ4A 3S6TA 2B4GA 1UJQA 1BKHA 1ISZA 3HM7A 2A6LA 3RCMA 2HV5A 3PZGA 1KM0A 4BI7A 5AC4A 1QW8A 3VNYA 1YNPA 2DZUA 2WKLA 4I8YA 3W1XA 2VFIA 5D05A 1QI0A 1KQZA 2FH8A 2O55A 4NG3A 1PUDA 3B03A 5TQLA 2FTYA 1K9FA 2CW6A 4I1QA 1EIBA 4F40A 1EWEA 2Z6JA 4DNMA 2ZA3A 1XDLA 1OQFA 1SR9A 3B0XA 3MBDA 1SUFA 1YADA 4O11A 1V8EA 3WQWA 3O1NA 2VJXA 3H7UA 3PZUA 3RPDA 4QG6A 5LIYX 1WBJA 2CYGA 3FIGA 1S2VA 3ERCC 3BUVA 4JTAA 2R9RA 3UWWA 3WH6A 2NQHA 4FNSA 4M29A 2FPTA 4GZEA 4Q8WA 4GK8A 1I4TA 4GWEA 3NNTA 3HMCA 3CZ8A 7CGTA 2BSLA 1DWIM 2VR5A 2PDLA 5U7SA 2WMJA 4AX7A 2DV0A 3AROA 4X0VA 3O05A 4J3WA 4A4AA 1XUUA 3AS3A 4GIEA 3L4UA 4GYPC 4F00A 2OW7A 1AQFA 3LMZA 2JEPA 4HK6A 4O4WA 3LGDA 5LXXA 4GQBA 4JTCA 2XYLA 3SO7A 2SFPA 3ZJ6A 4JNZA 3HTWA 1W1B1 4GVHA 5HNNA 3TMLA 1E51A 2C1HA 3XIMA 4HR1A 1BSIA 5HAOA 5A5WA 4IG2B 2ZUSA 3DC0A 2DVUA 4JPGA 3M0XA 1EPXA 5A8NA 3E96A 3KTCA 1XX1A 3QGKC 2FZNA 3ARPA 4Z17A 3BVUA 1KRAC 4LANA 1I2RA 1YBQB 3NGJA 4S3JA 3UFYA 1CGXA 4UCFA 4Z0JA 3BQ5A 4AZ6A 2ABBA 4NZJA 3K30A 1MJGA 4FLOA 4I90A 1SJDA 1IT0A 1JYWA 2KHOA 3MKKA 3SDOA 5FL1A 4H9YA 1V6TA 1QI5A 5LHEA 2V0OA 3P62A 3AMGA 2GJXA 5CSUA 3L7RA 1XYAA 2NQ9A 4IL0A 3NSXA 1E73M 1QU4A 3F7WA 4W5UA 1JYVA 2X2YA 1RZMA 2JGYA 1B9BA 4KEZA 4PRRA 4MJ4A 1L6YA 3IV8A 4KRUA 4RJEA 1NWUA 4AIOA 4I9MA 4UWMA 2DZXA 1ZAJA 1CTNA 2UWFA 1JZ8A 2Z1BA 4TIMA 1AJZA 2QUMA 1MI3A 4DXXA 3DIPA 4TR9A 1A5CA 3O8AA 4YVXA 1XH0A 1JZ3A 3VUPA 1FDZA 3ITCA 3L65A 4TX6A 2I9UA 4PTXA 4C1KA 4GFIA 2WVTA 1Q6FA 3GDKA 3WF1A 4DWSB 1TFVA 3HAHA 3WF0A 2A4AA 4UQCA 3STEA 1U5VA 3KEHA 1KM6A 4AYSA 1RY8A 1PZ2A 2CFFA 3PPCA 1X8CA 4L7ZA 4Y6GA 1TQSA 5EMJA 1LQ7A 1RLDA 1FDYA 4F2UA 1SU5A 3DESA 4IP4A 4H9UA 4RXGA 1ZS2A 4MY8A 4CD7A 1HTYA 1Q8AA 3REQB 4AY8A 4DYKA 4ZE4A 2EPOA 1CGVA 3F5JA 1TQUA 3A22A 3BTNA 1UP3A 5C71A 2PWHA 1CXEA 3PJUA 3MCOA 1PO9A 2PMQA 4N6FA 2FTWA 2Z29A 4FLQA 1XH2A 4JTHA 1V6WA 3MSYA 3AYTA 3DOPA 4JCMA 2YDSA 3GR4A 3BZGA 3UZWA 2VUNA 1WO2A 4H3DA 5E6ZA 4FF7A 3W2KA 3LG3A 1NY1A 4S3GA 3ARSA 3DHUA 1HW6A 3E74A 4Z1DA 4LUSB 3VKJA 3CWNA 1FXQA 2VUYA 4GX9A 4JL1A 3CTTA 1QOQA 3WELA 1SW7A 1O95A 6A3HA 2IQTA 1UASA 3F4VA 2CESA 1R46A 3G22A 1TPB1 3M0ZA 3QW4B 4CQCA 1ODUA 2FMNA 3NZQA 1LL6A 3P67A 1XC6A 4ZSTA 1PIGA 2OR2A 1FHLA 6TIMA 5A2AA 3EA3A 1KTCA 3NCOA 2EJ1A 1QBBA 3O9NA 1LLOA 3F2DA 2RDTA 1VBHA 2Y8KA 3L68A 3O6DA 4A8LA 4IPLA 2E28A 4MM1A 1PB0A 2QPXA 1SSGA 3HA1A 3VIPA 3IV3A 5D04C 1Q7QA 1W9BM 4R5KA 2ZDSA 1O60A 1QWUA 3VI2A 4NZ3A 4AVFA 1TZZA 1W3NA 3LD5A 4UTJA 1UWTA 2GGEA 2PTDA 4UXDA 3M5YA 1OINA 5DMLA 2QCGA 4GYKA 5KINA 3GH4A 4D8ZA 2YKKA 3C52A 5G4WA 3MI3A 5KSWA 3RJXA 1RCQA 3HAJA 4UTLA 3PM6A 4ATLA 1XS2A 4U2ZA 3BPWA 2N3KA 4XTIA 5M5DA 4E3VA 3OQ8A 3TEVA 3GW3A 1DJYA 4LQ1A 4AMCA 1T7LA 2PP1A 4MDPA 2ZX5A 1H5YA 5BOEA 2GK1B 4JTFA 4DJDA 4X9YA 4H2CA 4IM2A 2X05A 3IUDA 4MWAB 1TE1A 2XFWA 1CI1A 4ZO7A 1GNLA 3BMXA 4P7RA 3QTGA 3GTIA 1LG2A 1IEXA 3UWQA 3UGVA 1H5VA 3P0XA 1XLEA 2FQIA 1R47A 1EGVA 1YMYA 4HPGA 3AS1A 3E0FA 1IEIA 1QPOA 2PWVA 1AMYA 2XM1A 1ZENA 3SRDA 2ZFAA 2A5HA 3CHVA 5C70A 1BQCA 2XIMA 1U2YA 3GTHA 3PZIA 3H4GA 2GWGA 1NDYA 4WDWA 4JWEA 2CBJA 4C6FA 4DAFA 4EF9A 1GOWA 1Q6OA 3ZSSA 2O56A 3NL5A 3G8RA 1TA3B 4KFPA 4FM3A 1F74A 3M0LA 1ENUA 1KLZA 3KTXA 4BJHA 1IT8A 4JD4A 4XAFA 1TELA 3OLDA 4HPHA 1EJWC 1U22A 3FOKA 4EVZA 1KXQA 4IISA 4R33A 2PAJA 1KM3A 4JIPA 4DZHA 5AOUA 2GVJA 5BXPA 1EA0A 5LIKX 4LX4A 5DXXA 2A3LA 2ZZ1A 4J3SA 3Q37A 3SYVA 1QO5A 3VGBA 1KFJA 1WAWA 1RD6A 5KITA 4NQ1A 2W62A 2CZ5A 1CYGA 1H1ZA 4RCXA 4Q7BA 1MVYA 3FD9A 2EKGA 3UERA 4LVDA 3E2QA 3NQDA 2WCAA 2PSNA 1S5WA 3ZIZA 3CK5A 4IIHA 3P6LA 1DJHA 1XD0A 3IJDA 3O06A 2XUCA 4QE1A 1QUMA 4IIGA 4YYCA 3KOZA 1QJWA 2DUZA 4OOZA 4UTHA 4YNGA 2QULA 1M68A 4GNJA 4TVUA 1P6WA 3MA8A 1VR6A 1DXFA 5ABEA 2W79A 2Z7GA 3N6HA 3BJFA 4XAPA 3BUQA 3LLFA 1O1ZA 4B4FA 3B04A 3UXAA 2EPLX 3UPBA 4KKXA 4CQBA 4KIKA 3O6AA 2H6RA 3IUHA 1PCWA 5C2XA 3WX7A 2PEVA 3THUA 2CBVA 1HKWA 4O0QA 4W87A 3GS6A 3HPFA 1TSIA 3L9CA 2J9XA 3WO8A 3DC8A 4OUIA 4Z1BA 2Y7EA 3CTLA 3H8AA 1PS9A 4DCNC 4O28A 3WDRA 3G77A 2VKZG 2ZVRA 3WK3A 3I10A 3MUXA 5GJNA 4FNPA 4BFAA 1QW9A 2WSPA 3ZWSA 4GQRA 3KL0A 3IGHX 1ZJIA 1YTKA 4DJFA 1LWHA 3RITA 4HPXA 2J78A 4M0XA 1XIGA 3AXIA 2CLLA 4IWPA 3DFTA 3RO8A 3FY1A 1MEWA 2X3WA 1B1YA 1GVOA 3EKLA 2Q8XA 2DQWA 2CKRA 3URAA 4JCLA 3WNLA 3EJUA 3FGCA 5DN1A 2V3DA 4IQJA 1XLIA 2R91A 3ITYA 4WKFA 4CU8A 1XG3A 1I0DA 3P60A 1J0KA 2Z0IA 4IM3A 1OYBA 4GQ0A 4GFSA 5K3VA 1XC4A 3UR7A 3W71A 2Y62A 4QNWA 1XIHA 4RZ4A 3S46A 3ES8A 5D9OA 4CD4A 2P5NA 4EZYA 2HROA 1PZ1A 1JZ6A 1I9CB 3NGFA 4MZ8A 4HB7A 1VB9A 3AHTA 4CN4A 3UT0A 3QMSA 1KA9F 3L4WA 3KW3A 2JALA 3G3DA 4AB4A 2ACUA 2FPYA 5DT5A 2HPIA 3UY7A 4JHMA 1R38A 4XZBA 4HOWA 3WD3A 3TN3A 4K1GA 4FEZA 3ER9B 2OQYA 4WIWA 2WMFA 2O9OA 3KRBA 3L5MA 3CL7A 3MWAA 3KOXA 2TODA 6XIMA 2ISVA 4IZGA 3ATYA 1YTEA 2BTMA 3KBVA 3GNPA 2JIEA 3I3EA 4L6OA 1PX8A 2J9YA 2YZRA 1C7SA 3WLKX 1KCKA 4YHEA 1B31A 4XKYB 1MUWA 3CV6A 3PFRA 2QCDA 5A94A 2X2GA 2WSKA 3LN3A 3MMUA 3BG9A 1RJQA 5JVLA 3UITA 5DBTA 1VPQA 5JU6A 2OO0A 3W73A 3U5YA 1UA3A 2R94A 3U7VA 4LAUA 4C6NA 4K8HA 1TIWA 4Z42C 3N2XA 3SR7A 1YW1A 2ONEA 5IOBA 4FIRA 3DGRA 4EP8C 3QNJA 3WN6A 1ML1A 5BMWA 1EF3A 3LPPA 5D8ZA 4EXAA 5CAKA 3ZXWA 4C6BA 3M64A 3V7PA 1MUMA 4V1YA 1BTMA 3W74A 3MO4A 1O6IA 3R6IA 3SY1A 3QJAA 3WH9A 1VPXA 2RAJA 4Q4KA 2O92A 4EAYA 4EZNA 3GVVA 4A35A 1Y7VA 1G94A 1OEPA 5B80A 2I7GA 3PPGA 3NTYA 1I4DA 3QKEA 4JWCA 3W37A 3EWWA 5FJRA 2PTXA 1Y5VA 1RVGA 5T9CE 4M6VA 4W89A 2X0HA 1SYTA 5E0KA 3RNDA 3IIZA 2BY3A 1CZ1A 4K37A 3KE0A 3W7KA 3ALGA 1W1VA 1R3YA 3F4CA 1H4PA 2CHRA 3ID7A 3LYEA 3Q94A 3VC6A 1XYZA 4M81A 3SCOA 1OX4B 2WYHA