2ND0A

Solution nmr structures of brd4 et domain with lana peptide
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
83
structure length
83
Chain Sequence
SEEEDKCKPMSYEEKRQLSLDINKLPGEKLGRVVHIIQSREPSLKNSNPDEIEIDFETLKPSTLRELERYVTSCLRKKRKPQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/viral protein
molecule keywords Bromodomain-containing protein 4
publication title Structural Mechanism of Transcriptional Regulator NSD3 Recognition by the ET Domain of BRD4.
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2016-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17035 BET Bromodomain extra-terminal - transcription regulation
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.220 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 2nd0A01
2ND1A 2N3KA 2JNSA 2ND0A 2NCZA
chains in the Genus database with same CATH superfamily
2Z0NA 1R34A 1O7DB 4JWEA 1I4DA 3CAZA 4NPHA 5C5BA 2F7QA 2F18A 4AZHA 4F01A 1DKXA 4HYBA 4HY9A 2ND0A 3DDGA 4H6IA 2YKTA 3OK8A 2X5CA 1HWWA 3OWGA 3CKDA 3SYVA 4EZSA 3BUIA 4E81A 3D2FA 4KIKA 4I1QA 1YWMA 4R5GA 2OBLA 3DX2A 3BVWA 2C08A 3DX0A 3SOGA 2EX3B 4HR1A 2OW6A 1Y2OA 3BVXA 2RAIA 1GNTA 3CVRA 4FM3A 4EZQA 4IWPA 4M0MA 4B9QA 2Q12A 2GF4A 3C7NA 4UDYX 5C5BB 4JN4A 1GN9A 3RV0A 2F7OA 2OBMA 4EZRA 3VEAA 1DKYA 3T49A 3B52X 3DDFA 2JNSA 2WYIA 3T47A 4KIKB 2YLLA 2Z0OA 2EWFA 2RT6A 4JL9A 1ZWWA 3G9GA 2D4CA 4AKVA 2O0I1 4HR1B 4NQIA 4EZOA 4IM2A 3LVTA 4JWIA 4DYLA 2F7RA 3BVTA 4NSWA 2X3VA 1HTYA 5TKYA 3EJRA 4FZPA 2LXYA 1LQ7A 1OA1A 1X03A 3ZEDA 3I04A 3T48A 4AZIA 3BLBA 2RAJA 4PO2A 2FYVA 3D4YA 4AZCA 1SU6A 4AZBA 3RPMA 3OHXM 3L3OM 4JWDA 4BNEA 1TQTA 2YI8A 1SU8A 1I4TA 2X3WA 2YLAA 4R5IA 1W9MA 4AZ5A 3D51A 4G6QA 3CV5A 2GAFD 1OA0A 4FZSA 3HAJA 2EFKA 4IW0A 3ER9B 3DX3A 4AVMA 4AZGA 3DPPA 4WPCA 4IM3A 1OAOA 3DPQA 3I2WA 3EJPA 1R33A 5FLEX 3KAWA 3BUPA 3D50A 3DX1A 1SU7A 4EZWA 4AZCB 3ABHA 2Z0VA 2Z8YA 3CZSA 2YL9A 3O3NB 3PLTA 3Q0KA 2FICA 3DPOA 4R5LA 4FZOA 2QXLA 3B51X 4DCNC 1PS3A 3QA8A 4R5JA 2X3XA 3QNJA 4EZPA 4JLCA 3ERCC 4IM0A 1MJGA 2ELBA 2MI7A 1TQSA 1TQWA 2EFLA 2ND1A 2F7PA 2WYHA 1SUFA 1I4LA 4F00A 4D8JA 3HAHA 3O3MB 1TQUA 3D4ZA 2YIAA 3CZNA 3I39X 1QWNA 4R5KA 2ALWA 3EJTA 2F1BA 4EZXA 3ER8C 3DX4A 2OO2A 3Q84A 3D52A 5KBPA 1E2UA 4UDXX 1X04A 3EJSA 4EZYA 4H8SA 4EZTA 4AZ7A 4IWOA 3ACOA 1DKZA 4ATMA 3QNIA 3D2EA 1E1DA 3I01A 3FD9A 3T4AG 2QFFA 4EZNA 5FIGA 3VKHA 3M3WA 2KHOA 2QKWA 4H6HA 5E84A 1HXKA 3BUBA 3A98A 4AZ6A 3BUQA 4IWQA 3KAVA 4EZZA 3F7WA 1JQKA 2OW7A 3BVUA 3QWEA 3EJUA 2YIVX 1QWUA 3O3OB 1TQVA 2GA9D 3HAIA 1UPXA 2WINM 2NCZA 3EJQA 2YI9A 3VEBA 4WPEA 3LLLA 2N3KA 2RAKA 3KDRA 3BUDA 4JNEA 3LMFA 4E3CA 2PY6A 2Q13A 2YIBA 2YL5A 1QX1A 4EZVA 3UITA 1URUA 2ZXQA 2YL6A 4EZUA 3RV1A 1WDZA 2LM0A 2JNKA 3QE6A 3DYTA 3GI7A 1ZYLA 2YL8A 3T46A 3L3PA 4JWCA 2OZNB 1U00A 2V0OA 1O7DC 2PMRA 2F1AA 4JNFA 3B53X 1R5EA 1I49A 2D1LA 1GNLA 1E9VA 3BVVA
chains in the Genus database with same CATH topology
3T4AG 4EZOA 2QFFA 4IM2A 4EZNA 5FIGA 4JWEA 3VKHA 3O3NB 2KHOA 4JWIA 4H6HA 5E84A 3DPOA 4R5LA 4NPHA 2QXLA 4F01A 3A98A 1DKXA 4HYBA 4IWQA 3KAVA 4HY9A 3B51X 5TKYA 4EZZA 2ND0A 3F7WA 1JQKA 4H6IA 2X5CA 3QA8A 3OWGA 1OA1A 4R5JA 3ZEDA 3I04A 2YIVX 3QNJA 4EZSA 4E81A 3T48A 3D2FA 4KIKA 3O3OB 4EZPA 4JLCA 4PO2A 2GA9D 4R5GA 3ERCC 1UPXA 2WINM 2NCZA 4IM0A 2YI9A 1MJGA 3VEBA 1SU6A 2OBLA 2N3KA 3OHXM 3L3OM 2EX3B 4HR1A 4JWDA 2ND1A 2YI8A 3KDRA 1SU8A 4R5IA 1SUFA 1GNTA 4D8JA 4F00A 4JNEA 1W9MA 3O3MB 4G6QA 3LMFA 4E3CA 2PY6A 2GAFD 4FM3A 4EZQA 2YIBA 4EZVA 1OA0A 4IWPA 4M0MA 3UITA 4EZUA 2YIAA 4B9QA 3RV1A 3I39X 3C7NA 4UDYX 4IW0A 3ER9B 4R5KA 2LM0A 4JN4A 3DPPA 4EZXA 1GN9A 3ER8C 3RV0A 4IM3A 2OBMA 4EZRA 1OAOA 3VEAA 3DPQA 1DKYA 3GI7A 3T49A 3B52X 1ZYLA 1E2UA 2JNSA 4UDXX 3T46A 5FLEX 3KAWA 3T47A 4JWCA 4KIKB 4EZYA 4EZTA 2EWFA 1SU7A 1U00A 4EZWA 2RT6A 4IWOA 4JNFA 3B53X 4JL9A 1DKZA 3D2EA 1E1DA 2Z8YA 3I01A 1GNLA 1E9VA 4HR1B 3FD9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ND1 A;  2N3K A;  2JNS A;  2ND0 A;  2NCZ A; 
#chains in the Genus database with same CATH topology
 2Z0N A;  1R34 A;  1O7D B;  4JWE A;  1I4D A;  3CAZ A;  4NPH A;  5C5B A;  2F7Q A;  2F18 A;  4AZH A;  4F01 A;  1DKX A;  4HYB A;  4HY9 A;  2ND0 A;  3DDG A;  4H6I A;  2YKT A;  3OK8 A;  2X5C A;  1HWW A;  3OWG A;  3CKD A;  3SYV A;  4EZS A;  3BUI A;  4E81 A;  3D2F A;  4KIK A;  4I1Q A;  1YWM A;  4R5G A;  2OBL A;  3DX2 A;  3BVW A;  2C08 A;  3DX0 A;  3SOG A;  2EX3 B;  4HR1 A;  2OW6 A;  1Y2O A;  3BVX A;  2RAI A;  1GNT A;  3CVR A;  4FM3 A;  4EZQ A;  4IWP A;  4M0M A;  4B9Q A;  2Q12 A;  2GF4 A;  3C7N A;  4UDY X;  5C5B B;  4JN4 A;  1GN9 A;  3RV0 A;  2F7O A;  2OBM A;  4EZR A;  3VEA A;  1DKY A;  3T49 A;  3B52 X;  3DDF A;  2JNS A;  2WYI A;  3T47 A;  4KIK B;  2YLL A;  2Z0O A;  2EWF A;  2RT6 A;  4JL9 A;  1ZWW A;  3G9G A;  2D4C A;  4AKV A;  2O0I 1;  4HR1 B;  4NQI A;  4EZO A;  4IM2 A;  3LVT A;  4JWI A;  4DYL A;  2F7R A;  3BVT A;  4NSW A;  2X3V A;  1HTY A;  5TKY A;  3EJR A;  4FZP A;  2LXY A;  1LQ7 A;  1OA1 A;  1X03 A;  3ZED A;  3I04 A;  3T48 A;  4AZI A;  3BLB A;  2RAJ A;  4PO2 A;  2FYV A;  3D4Y A;  4AZC A;  1SU6 A;  4AZB A;  3RPM A;  3OHX M;  3L3O M;  4JWD A;  4BNE A;  1TQT A;  2YI8 A;  1SU8 A;  1I4T A;  2X3W A;  2YLA A;  4R5I A;  1W9M A;  4AZ5 A;  3D51 A;  4G6Q A;  3CV5 A;  2GAF D;  1OA0 A;  4FZS A;  3HAJ A;  2EFK A;  4IW0 A;  3ER9 B;  3DX3 A;  4AVM A;  4AZG A;  3DPP A;  4WPC A;  4IM3 A;  1OAO A;  3DPQ A;  3I2W A;  3EJP A;  1R33 A;  5FLE X;  3KAW A;  3BUP A;  3D50 A;  3DX1 A;  1SU7 A;  4EZW A;  4AZC B;  3ABH A;  2Z0V A;  2Z8Y A;  3CZS A;  2YL9 A;  3O3N B;  3PLT A;  3Q0K A;  2FIC A;  3DPO A;  4R5L A;  4FZO A;  2QXL A;  3B51 X;  4DCN C;  1PS3 A;  3QA8 A;  4R5J A;  2X3X A;  3QNJ A;  4EZP A;  4JLC A;  3ERC C;  4IM0 A;  1MJG A;  2ELB A;  2MI7 A;  1TQS A;  1TQW A;  2EFL A;  2ND1 A;  2F7P A;  2WYH A;  1SUF A;  1I4L A;  4F00 A;  4D8J A;  3HAH A;  3O3M B;  1TQU A;  3D4Z A;  2YIA A;  3CZN A;  3I39 X;  1QWN A;  4R5K A;  2ALW A;  3EJT A;  2F1B A;  4EZX A;  3ER8 C;  3DX4 A;  2OO2 A;  3Q84 A;  3D52 A;  5KBP A;  1E2U A;  4UDX X;  1X04 A;  3EJS A;  4EZY A;  4H8S A;  4EZT A;  4AZ7 A;  4IWO A;  3ACO A;  1DKZ A;  4ATM A;  3QNI A;  3D2E A;  1E1D A;  3I01 A;  3FD9 A;  3T4A G;  2QFF A;  4EZN A;  5FIG A;  3VKH A;  3M3W A;  2KHO A;  2QKW A;  4H6H A;  5E84 A;  1HXK A;  3BUB A;  3A98 A;  4AZ6 A;  3BUQ A;  4IWQ A;  3KAV A;  4EZZ A;  3F7W A;  1JQK A;  2OW7 A;  3BVU A;  3QWE A;  3EJU A;  2YIV X;  1QWU A;  3O3O B;  1TQV A;  2GA9 D;  3HAI A;  1UPX A;  2WIN M;  2NCZ A;  3EJQ A;  2YI9 A;  3VEB A;  4WPE A;  3LLL A;  2N3K A;  2RAK A;  3KDR A;  3BUD A;  4JNE A;  3LMF A;  4E3C A;  2PY6 A;  2Q13 A;  2YIB A;  2YL5 A;  1QX1 A;  4EZV A;  3UIT A;  1URU A;  2ZXQ A;  2YL6 A;  4EZU A;  3RV1 A;  1WDZ A;  2LM0 A;  2JNK A;  3QE6 A;  3DYT A;  3GI7 A;  1ZYL A;  2YL8 A;  3T46 A;  3L3P A;  4JWC A;  2OZN B;  1U00 A;  2V0O A;  1O7D C;  2PMR A;  2F1A A;  4JNF A;  3B53 X;  1R5E A;  1I49 A;  2D1L A;  1GNL A;  1E9V A;  3BVV A; 
#chains in the Genus database with same CATH homology
 3T4A G;  4EZO A;  2QFF A;  4IM2 A;  4EZN A;  5FIG A;  4JWE A;  3VKH A;  3O3N B;  2KHO A;  4JWI A;  4H6H A;  5E84 A;  3DPO A;  4R5L A;  4NPH A;  2QXL A;  4F01 A;  3A98 A;  1DKX A;  4HYB A;  4IWQ A;  3KAV A;  4HY9 A;  3B51 X;  5TKY A;  4EZZ A;  2ND0 A;  3F7W A;  1JQK A;  4H6I A;  2X5C A;  3QA8 A;  3OWG A;  1OA1 A;  4R5J A;  3ZED A;  3I04 A;  2YIV X;  3QNJ A;  4EZS A;  4E81 A;  3T48 A;  3D2F A;  4KIK A;  3O3O B;  4EZP A;  4JLC A;  4PO2 A;  2GA9 D;  4R5G A;  3ERC C;  1UPX A;  2WIN M;  2NCZ A;  4IM0 A;  2YI9 A;  1MJG A;  3VEB A;  1SU6 A;  2OBL A;  2N3K A;  3OHX M;  3L3O M;  2EX3 B;  4HR1 A;  4JWD A;  2ND1 A;  2YI8 A;  3KDR A;  1SU8 A;  4R5I A;  1SUF A;  1GNT A;  4D8J A;  4F00 A;  4JNE A;  1W9M A;  3O3M B;  4G6Q A;  3LMF A;  4E3C A;  2PY6 A;  2GAF D;  4FM3 A;  4EZQ A;  2YIB A;  4EZV A;  1OA0 A;  4IWP A;  4M0M A;  3UIT A;  4EZU A;  2YIA A;  4B9Q A;  3RV1 A;  3I39 X;  3C7N A;  4UDY X;  4IW0 A;  3ER9 B;  4R5K A;  2LM0 A;  4JN4 A;  3DPP A;  4EZX A;  1GN9 A;  3ER8 C;  3RV0 A;  4IM3 A;  2OBM A;  4EZR A;  1OAO A;  3VEA A;  3DPQ A;  1DKY A;  3GI7 A;  3T49 A;  3B52 X;  1ZYL A;  1E2U A;  2JNS A;  4UDX X;  3T46 A;  5FLE X;  3KAW A;  3T47 A;  4JWC A;  4KIK B;  4EZY A;  4EZT A;  2EWF A;  1SU7 A;  1U00 A;  4EZW A;  2RT6 A;  4IWO A;  4JNF A;  3B53 X;  4JL9 A;  1DKZ A;  3D2E A;  1E1D A;  2Z8Y A;  3I01 A;  1GNL A;  1E9V A;  4HR1 B;  3FD9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...