2ND0A

Solution nmr structures of brd4 et domain with lana peptide
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
83
structure length
83
Chain Sequence
SEEEDKCKPMSYEEKRQLSLDINKLPGEKLGRVVHIIQSREPSLKNSNPDEIEIDFETLKPSTLRELERYVTSCLRKKRKPQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bromodomain-containing protein 4
publication title Structural Mechanism of Transcriptional Regulator NSD3 Recognition by the ET Domain of BRD4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/viral protein
total genus 27
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2016-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17035 BET Bromodomain extra-terminal - transcription regulation
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.220 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 2nd0A01
2ND1A 2N3KA 2ND0A 2JNSA 2NCZA
chains in the Genus database with same CATH superfamily
2YL5A 4IM3A 1MJGA 3RV1A 4IWQA 3DDFA 2GA9D 3EJRA 3QA8A 4R5IA 3EJUA 2ELBA 3CV5A 4DCNC 3O3OB 2PY6A 2FYVA 4JWIA 2F1AA 3T49A 3M3WA 1R34A 3BLBA 1YWMA 4EZVA 4D8JA 5TKYA 3BVVA 3DX1A 2F7QA 1TQTA 2QKWA 3C7NA 3I01A 3EJPA 2YKTA 1I4LA 2OBMA 2WYIA 2D1LA 1UPXA 3BVTA 2GAFD 3CKDA 5C5BA 4UDYX 4ATMA 2YIAA 1GN9A 4AZHA 3VEBA 1DKXA 1X03A 3D2EA 1R5EA 4EZOA 4EZTA 2JNSA 2D4CA 3VKHA 4KIKA 4AZ6A 1I4TA 3B51X 4IM2A 4IW0A 3T4AG 3O3NB 4EZYA 2GF4A 4FZPA 3SYVA 2F18A 2O0I1 2YLLA 2RAJA 3I2WA 1OA0A 4E3CA 3T47A 1TQSA 2X3VA 3O3MB 5KBPA 3B52X 4B9QA 3D50A 2X3XA 4R5KA 2FICA 4WPEA 2ALWA 1DKZA 3L3OM 4EZRA 4M0MA 2Z0OA 1TQVA 4FM3A 2N3KA 3OK8A 3L3PA 4JNEA 3Q84A 1SU8A 1WDZA 3EJQA 2X3WA 3ZEDA 1I4DA 4EZNA 2OBLA 2RAKA 3B53X 1X04A 2RT6A 3T46A 1QWUA 4JWDA 2Z0VA 4G6QA 2Z0NA 4R5GA 1HWWA 3HAJA 4EZZA 2EWFA 4NSWA 3D4YA 4NPHA 3CZNA 3A98A 3OWGA 1E2UA 3GI7A 3Q0KA 2ND1A 3D4ZA 3BVXA 2QXLA 3DPPA 2LXYA 3KDRA 2RAIA 1R33A 4HY9A 4H6HA 4AZGA 3CVRA 3DYTA 1I49A 2X5CA 1TQUA 1E1DA 3DX4A 1OA1A 4E81A 1SU7A 3LLLA 4AZBA 5E84A 3QNJA 2JNKA 3QWEA 1DKYA 3F7WA 3CZSA 3OHXM 4PO2A 4AZCB 3G9GA 3BVUA 2ZXQA 1U00A 3KAVA 4AZIA 1ZWWA 1QWNA 2YIBA 3D52A 4NQIA 3DX0A 4EZUA 2YI9A 3QE6A 4EZSA 4JWCA 2WYHA 2YI8A 3BVWA 4AZ5A 3BUQA 2LM0A 2C08A 3EJTA 3PLTA 3ER8C 2OO2A 3T48A 4EZPA 2EFLA 4FZOA 4R5LA 2V0OA 2KHOA 3BUIA 3D2FA 2OZNB 4HR1B 4DYLA 2Q13A 2F7OA 3KAWA 2Z8YA 2YL9A 3BUBA 3BUDA 1PS3A 3ABHA 3HAHA 4JLCA 2PMRA 4JN4A 1O7DB 2YL8A 1URUA 5FIGA 1GNLA 4F00A 1SUFA 3SOGA 4I1QA 4AZ7A 3ERCC 3I39X 2YLAA 4HYBA 1O7DC 3HAIA 4JL9A 3CAZA 1TQWA 4BNEA 2F1BA 4IWPA 1Y2OA 3UITA 3DPOA 2EFKA 1E9VA 3VEAA 2F7RA 4F01A 3D51A 2F7PA 1ZYLA 4R5JA 1SU6A 4IWOA 4JWEA 3ER9B 1OAOA 2YL6A 5C5BB 3EJSA 3DX2A 2EX3B 1HXKA 2MI7A 3BUPA 2Q12A 2OW6A 4H8SA 3RV0A 4H6IA 4AZCA 3DX3A 2NCZA 4EZWA 3LMFA 4WPCA 4FZSA 2YIVX 4IM0A 1JQKA 1W9MA 4JNFA 3LVTA 3ACOA 4KIKB 4EZXA 2QFFA 4AVMA 2OW7A 1LQ7A 3I04A 2ND0A 1HTYA 4HR1A 3DDGA 5FLEX 3FD9A 3QNIA 3RPMA 4EZQA 1QX1A 4UDXX 2WINM 3DPQA 4AKVA 1GNTA
chains in the Genus database with same CATH topology
4IM3A 1OA1A 1MJGA 4IWPA 4E81A 3RV1A 1SU7A 3UITA 4IWQA 1OA0A 5E84A 3DPOA 4E3CA 3T47A 3QNJA 1E9VA 3VEAA 2GA9D 1DKYA 4F01A 3F7WA 3QA8A 3O3MB 4R5IA 3B52X 1ZYLA 3OHXM 4R5JA 4PO2A 4B9QA 1SU6A 4IWOA 3KAVA 1U00A 4JWEA 3O3OB 4R5KA 2PY6A 4JWIA 3ER9B 1DKZA 3L3OM 3T49A 2YIBA 4EZRA 1OAOA 4M0MA 4EZUA 4FM3A 4EZVA 2YI9A 2N3KA 4EZSA 4JWCA 2EX3B 4D8JA 2YI8A 5TKYA 3RV0A 4JNEA 2LM0A 1SU8A 4H6IA 3ER8C 2NCZA 4EZWA 3LMFA 3C7NA 3I01A 3ZEDA 3T48A 4EZNA 4EZPA 2OBLA 2YIVX 2RT6A 3B53X 2OBMA 4R5LA 2KHOA 3D2FA 1UPXA 3T46A 4IM0A 2GAFD 4HR1B 4JWDA 1JQKA 4G6QA 4UDYX 1W9MA 4R5GA 3KAWA 4JNFA 4EZZA 2EWFA 2Z8YA 4KIKB 2YIAA 4EZXA 1GN9A 4NPHA 2QFFA 3A98A 3VEBA 4JLCA 3OWGA 1E2UA 1DKXA 3GI7A 4JN4A 2ND1A 3D2EA 3I04A 4EZOA 4EZTA 5FIGA 1GNLA 4F00A 2JNSA 1SUFA 2QXLA 3DPPA 3KDRA 2ND0A 4HY9A 4H6HA 4HR1A 5FLEX 3FD9A 3VKHA 3ERCC 3I39X 4EZQA 2X5CA 4KIKA 4HYBA 1E1DA 4UDXX 2WINM 3B51X 3DPQA 4IM2A 4IW0A 4JL9A 3T4AG 3O3NB 4EZYA 1GNTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ND1 A;  2N3K A;  2ND0 A;  2JNS A;  2NCZ A; 
#chains in the Genus database with same CATH topology
 2YL5 A;  4IM3 A;  1MJG A;  3RV1 A;  4IWQ A;  3DDF A;  2GA9 D;  3EJR A;  3QA8 A;  4R5I A;  3EJU A;  2ELB A;  3CV5 A;  4DCN C;  3O3O B;  2PY6 A;  2FYV A;  4JWI A;  2F1A A;  3T49 A;  3M3W A;  1R34 A;  3BLB A;  1YWM A;  4EZV A;  4D8J A;  5TKY A;  3BVV A;  3DX1 A;  2F7Q A;  1TQT A;  2QKW A;  3C7N A;  3I01 A;  3EJP A;  2YKT A;  1I4L A;  2OBM A;  2WYI A;  2D1L A;  1UPX A;  3BVT A;  2GAF D;  3CKD A;  5C5B A;  4UDY X;  4ATM A;  2YIA A;  1GN9 A;  4AZH A;  3VEB A;  1DKX A;  1X03 A;  3D2E A;  1R5E A;  4EZO A;  4EZT A;  2JNS A;  2D4C A;  3VKH A;  4KIK A;  4AZ6 A;  1I4T A;  3B51 X;  4IM2 A;  4IW0 A;  3T4A G;  3O3N B;  4EZY A;  2GF4 A;  4FZP A;  3SYV A;  2F18 A;  2O0I 1;  2YLL A;  2RAJ A;  3I2W A;  1OA0 A;  4E3C A;  3T47 A;  1TQS A;  2X3V A;  3O3M B;  5KBP A;  3B52 X;  4B9Q A;  3D50 A;  2X3X A;  4R5K A;  2FIC A;  4WPE A;  2ALW A;  1DKZ A;  3L3O M;  4EZR A;  4M0M A;  2Z0O A;  1TQV A;  4FM3 A;  2N3K A;  3OK8 A;  3L3P A;  4JNE A;  3Q84 A;  1SU8 A;  1WDZ A;  3EJQ A;  2X3W A;  3ZED A;  1I4D A;  4EZN A;  2OBL A;  2RAK A;  3B53 X;  1X04 A;  2RT6 A;  3T46 A;  1QWU A;  4JWD A;  2Z0V A;  4G6Q A;  2Z0N A;  4R5G A;  1HWW A;  3HAJ A;  4EZZ A;  2EWF A;  4NSW A;  3D4Y A;  4NPH A;  3CZN A;  3A98 A;  3OWG A;  1E2U A;  3GI7 A;  3Q0K A;  2ND1 A;  3D4Z A;  3BVX A;  2QXL A;  3DPP A;  2LXY A;  3KDR A;  2RAI A;  1R33 A;  4HY9 A;  4H6H A;  4AZG A;  3CVR A;  3DYT A;  1I49 A;  2X5C A;  1TQU A;  1E1D A;  3DX4 A;  1OA1 A;  4E81 A;  1SU7 A;  3LLL A;  4AZB A;  5E84 A;  3QNJ A;  2JNK A;  3QWE A;  1DKY A;  3F7W A;  3CZS A;  3OHX M;  4PO2 A;  4AZC B;  3G9G A;  3BVU A;  2ZXQ A;  1U00 A;  3KAV A;  4AZI A;  1ZWW A;  1QWN A;  2YIB A;  3D52 A;  4NQI A;  3DX0 A;  4EZU A;  2YI9 A;  3QE6 A;  4EZS A;  4JWC A;  2WYH A;  2YI8 A;  3BVW A;  4AZ5 A;  3BUQ A;  2LM0 A;  2C08 A;  3EJT A;  3PLT A;  3ER8 C;  2OO2 A;  3T48 A;  4EZP A;  2EFL A;  4FZO A;  4R5L A;  2V0O A;  2KHO A;  3BUI A;  3D2F A;  2OZN B;  4HR1 B;  4DYL A;  2Q13 A;  2F7O A;  3KAW A;  2Z8Y A;  2YL9 A;  3BUB A;  3BUD A;  1PS3 A;  3ABH A;  3HAH A;  4JLC A;  2PMR A;  4JN4 A;  1O7D B;  2YL8 A;  1URU A;  5FIG A;  1GNL A;  4F00 A;  1SUF A;  3SOG A;  4I1Q A;  4AZ7 A;  3ERC C;  3I39 X;  2YLA A;  4HYB A;  1O7D C;  3HAI A;  4JL9 A;  3CAZ A;  1TQW A;  4BNE A;  2F1B A;  4IWP A;  1Y2O A;  3UIT A;  3DPO A;  2EFK A;  1E9V A;  3VEA A;  2F7R A;  4F01 A;  3D51 A;  2F7P A;  1ZYL A;  4R5J A;  1SU6 A;  4IWO A;  4JWE A;  3ER9 B;  1OAO A;  2YL6 A;  5C5B B;  3EJS A;  3DX2 A;  2EX3 B;  1HXK A;  2MI7 A;  3BUP A;  2Q12 A;  2OW6 A;  4H8S A;  3RV0 A;  4H6I A;  4AZC A;  3DX3 A;  2NCZ A;  4EZW A;  3LMF A;  4WPC A;  4FZS A;  2YIV X;  4IM0 A;  1JQK A;  1W9M A;  4JNF A;  3LVT A;  3ACO A;  4KIK B;  4EZX A;  2QFF A;  4AVM A;  2OW7 A;  1LQ7 A;  3I04 A;  2ND0 A;  1HTY A;  4HR1 A;  3DDG A;  5FLE X;  3FD9 A;  3QNI A;  3RPM A;  4EZQ A;  1QX1 A;  4UDX X;  2WIN M;  3DPQ A;  4AKV A;  1GNT A; 
#chains in the Genus database with same CATH homology
 4IM3 A;  1OA1 A;  1MJG A;  4IWP A;  4E81 A;  3RV1 A;  1SU7 A;  3UIT A;  4IWQ A;  1OA0 A;  5E84 A;  3DPO A;  4E3C A;  3T47 A;  3QNJ A;  1E9V A;  3VEA A;  2GA9 D;  1DKY A;  4F01 A;  3F7W A;  3QA8 A;  3O3M B;  4R5I A;  3B52 X;  1ZYL A;  3OHX M;  4R5J A;  4PO2 A;  4B9Q A;  1SU6 A;  4IWO A;  3KAV A;  1U00 A;  4JWE A;  3O3O B;  4R5K A;  2PY6 A;  4JWI A;  3ER9 B;  1DKZ A;  3L3O M;  3T49 A;  2YIB A;  4EZR A;  1OAO A;  4M0M A;  4EZU A;  4FM3 A;  4EZV A;  2YI9 A;  2N3K A;  4EZS A;  4JWC A;  2EX3 B;  4D8J A;  2YI8 A;  5TKY A;  3RV0 A;  4JNE A;  2LM0 A;  1SU8 A;  4H6I A;  3ER8 C;  2NCZ A;  4EZW A;  3LMF A;  3C7N A;  3I01 A;  3ZED A;  3T48 A;  4EZN A;  4EZP A;  2OBL A;  2YIV X;  2RT6 A;  3B53 X;  2OBM A;  4R5L A;  2KHO A;  3D2F A;  1UPX A;  3T46 A;  4IM0 A;  2GAF D;  4HR1 B;  4JWD A;  1JQK A;  4G6Q A;  4UDY X;  1W9M A;  4R5G A;  3KAW A;  4JNF A;  4EZZ A;  2EWF A;  2Z8Y A;  4KIK B;  2YIA A;  4EZX A;  1GN9 A;  4NPH A;  2QFF A;  3A98 A;  3VEB A;  4JLC A;  3OWG A;  1E2U A;  1DKX A;  3GI7 A;  4JN4 A;  2ND1 A;  3D2E A;  3I04 A;  4EZO A;  4EZT A;  5FIG A;  1GNL A;  4F00 A;  2JNS A;  1SUF A;  2QXL A;  3DPP A;  3KDR A;  2ND0 A;  4HY9 A;  4H6H A;  4HR1 A;  5FLE X;  3FD9 A;  3VKH A;  3ERC C;  3I39 X;  4EZQ A;  2X5C A;  4KIK A;  4HYB A;  1E1D A;  4UDX X;  2WIN M;  3B51 X;  3DPQ A;  4IM2 A;  4IW0 A;  4JL9 A;  3T4A G;  3O3N B;  4EZY A;  1GNT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...