3I2WA

Crystal structure of efc/f-bar domain of drosophila syndapin/pacsin
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
290
structure length
270
Chain Sequence
SDSFWEPGNYKRTTKRIEDGYKLCNDLQQLIQERADIEKGYAKSLRTWSKKWGELIEKGPEYGTTEAAWKGVLTESERISDVHMKIKDNLCNDVNSQIKTWQKENYHHTLMQIKERKDLEDLFKKAQKPWAKLLAKVEKAKADYHSACKTERSATHDRVQKTKDQVQKCREKYEQAIAEITKYNSVYIEDMTSVFEKCQTFEKTRLQFFKEILFNVHSCLDLTKVQSLPQIYEEFSHTINNADQQKDLKWWSNNHGINMAMNWPSFVEYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Syndapin
publication title Structural requirements for PACSIN/Syndapin operation during zebrafish embryonic notochord development.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Endocytosis
total genus 111
structure length 270
sequence length 290
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00611 FCH Fes/CIP4, and EFC/F-BAR homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 3i2wA01
2RAIA 2D4CA 2Z0NA 4NQIA 4AKVA 4DCNC 3QE6A 3ACOA 2Q12A 4AVMA 2C08A 3DYTA 1I4TA 2Q13A 2YKTA 1I49A 3LLLA 3QWEA 4H8SA 3SYVA 2RAKA 3Q84A 1URUA 2EFLA 3Q0KA 5C5BA 4WPEA 4ATMA 2D1LA 2RAJA 2FICA 1ZWWA 4DYLA 3M3WA 4FZSA 1X03A 3CAZA 5C5BB 1X04A 2X3WA 3OK8A 1I4LA 2ELBA 3HAJA 4I1QA 2V0OA 3HAHA 3I2WA 4BNEA 1Y2OA 1WDZA 3HAIA 1I4DA 3ABHA 3QNIA 3SOGA 2Z0OA 3G9GA 3PLTA 2EFKA 4WPCA 2X3VA 2X3XA 4NSWA 2Z0VA
chains in the Genus database with same CATH superfamily
2F7QA 4JWDA 3KDRA 2OO2A 4R5GA 4DCNC 3ACOA 3DYTA 4EZXA 2Q13A 4IM0A 3QWEA 5FIGA 3D50A 3EJSA 4JNFA 2QKWA 1SU6A 1HXKA 4R5KA 1TQUA 3EJPA 3DDGA 3D51A 3QA8A 4R5LA 2EFKA 2PMRA 1HTYA 4JNEA 4FZOA 2YL6A 3SYVA 4D8JA 2F7PA 3Q0KA 4HY9A 1R33A 3CKDA 3D52A 4NPHA 4EZVA 2OBLA 1I4DA 2GAFD 4AZGA 2RAIA 1E1DA 4AZCB 4B9QA 1U00A 2ALWA 2JNKA 3L3OM 2F7OA 3T4AG 2FYVA 4AZ5A 3VEBA 1X03A 2NCZA 1SU8A 2KHOA 1DKYA 4IM2A 3BVVA 1HWWA 1W9MA 3QNIA 2Z8YA 4FZSA 3VEAA 3CZSA 2WINM 3C7NA 3KAWA 3BUDA 4I1QA 4HR1A 3ABHA 4EZPA 4AZBA 4JLCA 1TQWA 3BUBA 3D4ZA 2YLAA 1QWUA 2F1BA 2YIBA 3O3OB 4IWPA 1I4TA 2YKTA 2RAKA 3QNJA 4HYBA 2GF4A 1PS3A 4EZSA 5E84A 3T49A 1Y2OA 2F7RA 3PLTA 1R34A 4AKVA 3B51X 3CZNA 3DX4A 4E81A 3A98A 3O3MB 2RAJA 2X3WA 1OAOA 4HR1B 2MI7A 1OA0A 3EJUA 4IWOA 2ZXQA 1R5EA 3OWGA 1JQKA 3DDFA 2EFLA 3M3WA 4F00A 1TQTA 2YIVX 4R5JA 1OA1A 3SOGA 2QXLA 3D4YA 1QWNA 4EZNA 4EZWA 5C5BB 3EJQA 1I4LA 4JWIA 3BVWA 3HAIA 4EZRA 3G9GA 1YWMA 4JL9A 2X3VA 3UITA 2O0I1 2LXYA 3LLLA 2YL8A 2EWFA 1E9VA 4ATMA 2D1LA 4EZTA 4EZZA 4AZ6A 2F18A 3T46A 2OW6A 4F01A 2LM0A 2ND1A 3T48A 2EX3B 4EZOA 4KIKA 1SUFA 2Z0NA 1I49A 3ER8C 3BUPA 3ERCC 4AZIA 3DX3A 3L3PA 2FICA 4DYLA 2YL9A 3BUQA 4E3CA 3OK8A 4JN4A 3HAJA 1GNLA 3EJTA 2GA9D 4AZHA 3GI7A 4FM3A 3CAZA 1DKZA 4NSWA 3ZEDA 4AZ7A 3DPPA 4PO2A 4H8SA 3O3NB 5C5BA 4M0MA 1DKXA 3DPQA 4G6QA 3DPOA 2OZNB 3F7WA 1GN9A 4WPCA 1QX1A 1UPXA 5TKYA 2D4CA 3RV1A 3I04A 2RT6A 2Q12A 4AVMA 2C08A 4KIKB 4WPEA 4H6IA 4IM3A 3LVTA 4H6HA 2WYIA 2V0OA 2N3KA 3VKHA 3I01A 2JNSA 1LQ7A 4R5IA 3B53X 1MJGA 3QE6A 3ER9B 1GNTA 1SU7A 3LMFA 3D2EA 1ZWWA 1TQVA 2YIAA 3DX0A 4JWCA 3T47A 1X04A 4BNEA 2YI9A 3FD9A 3EJRA 3D2FA 1O7DC 2YI8A 2ND0A 3BUIA 2X5CA 1O7DB 4UDXX 3Q84A 3RV0A 4EZUA 2PY6A 3B52X 3BLBA 4IWQA 3HAHA 3I2WA 1WDZA 3CVRA 3RPMA 1ZYLA 2X3XA 5FLEX 5KBPA 2OW7A 2QFFA 4NQIA 4EZYA 1E2UA 2YLLA 4JWEA 3BVUA 1TQSA 2ELBA 3BVTA 2Z0OA 2Z0VA 4UDYX 4EZQA 3DX1A 3CV5A 2WYHA 1URUA 3BVXA 3DX2A 3KAVA 4IW0A 3OHXM 4AZCA 2OBMA 2YL5A 2F1AA 4FZPA 3I39X
chains in the Genus database with same CATH topology
2RAIA 2D4CA 2Z0NA 4NQIA 4AKVA 4DCNC 3QE6A 3ACOA 2Q12A 4AVMA 2C08A 3DYTA 1I4TA 2Q13A 2YKTA 1I49A 3LLLA 3QWEA 4H8SA 3SYVA 2RAKA 3Q84A 1URUA 2EFLA 3Q0KA 5C5BA 4WPEA 4ATMA 2D1LA 2RAJA 2FICA 1ZWWA 4DYLA 3M3WA 4FZSA 1X03A 3CAZA 5C5BB 1X04A 2X3WA 3OK8A 1I4LA 2ELBA 3HAJA 4I1QA 2V0OA 3HAHA 3I2WA 4BNEA 1Y2OA 1WDZA 3HAIA 1I4DA 3ABHA 3QNIA 3SOGA 2Z0OA 3G9GA 3PLTA 2EFKA 4WPCA 2X3VA 2X3XA 4NSWA 2Z0VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RAI A;  2D4C A;  2Z0N A;  4NQI A;  4AKV A;  4DCN C;  3QE6 A;  3ACO A;  2Q12 A;  4AVM A;  2C08 A;  3DYT A;  1I4T A;  2Q13 A;  2YKT A;  1I49 A;  3LLL A;  3QWE A;  4H8S A;  3SYV A;  2RAK A;  3Q84 A;  1URU A;  2EFL A;  3Q0K A;  5C5B A;  4WPE A;  4ATM A;  2D1L A;  2RAJ A;  2FIC A;  1ZWW A;  4DYL A;  3M3W A;  4FZS A;  1X03 A;  3CAZ A;  5C5B B;  1X04 A;  2X3W A;  3OK8 A;  1I4L A;  2ELB A;  3HAJ A;  4I1Q A;  2V0O A;  3HAH A;  3I2W A;  4BNE A;  1Y2O A;  1WDZ A;  3HAI A;  1I4D A;  3ABH A;  3QNI A;  3SOG A;  2Z0O A;  3G9G A;  3PLT A;  2EFK A;  4WPC A;  2X3V A;  2X3X A;  4NSW A;  2Z0V A; 
#chains in the Genus database with same CATH topology
 2F7Q A;  4JWD A;  3KDR A;  2OO2 A;  4R5G A;  4DCN C;  3ACO A;  3DYT A;  4EZX A;  2Q13 A;  4IM0 A;  3QWE A;  5FIG A;  3D50 A;  3EJS A;  4JNF A;  2QKW A;  1SU6 A;  1HXK A;  4R5K A;  1TQU A;  3EJP A;  3DDG A;  3D51 A;  3QA8 A;  4R5L A;  2EFK A;  2PMR A;  1HTY A;  4JNE A;  4FZO A;  2YL6 A;  3SYV A;  4D8J A;  2F7P A;  3Q0K A;  4HY9 A;  1R33 A;  3CKD A;  3D52 A;  4NPH A;  4EZV A;  2OBL A;  1I4D A;  2GAF D;  4AZG A;  2RAI A;  1E1D A;  4AZC B;  4B9Q A;  1U00 A;  2ALW A;  2JNK A;  3L3O M;  2F7O A;  3T4A G;  2FYV A;  4AZ5 A;  3VEB A;  1X03 A;  2NCZ A;  1SU8 A;  2KHO A;  1DKY A;  4IM2 A;  3BVV A;  1HWW A;  1W9M A;  3QNI A;  2Z8Y A;  4FZS A;  3VEA A;  3CZS A;  2WIN M;  3C7N A;  3KAW A;  3BUD A;  4I1Q A;  4HR1 A;  3ABH A;  4EZP A;  4AZB A;  4JLC A;  1TQW A;  3BUB A;  3D4Z A;  2YLA A;  1QWU A;  2F1B A;  2YIB A;  3O3O B;  4IWP A;  1I4T A;  2YKT A;  2RAK A;  3QNJ A;  4HYB A;  2GF4 A;  1PS3 A;  4EZS A;  5E84 A;  3T49 A;  1Y2O A;  2F7R A;  3PLT A;  1R34 A;  4AKV A;  3B51 X;  3CZN A;  3DX4 A;  4E81 A;  3A98 A;  3O3M B;  2RAJ A;  2X3W A;  1OAO A;  4HR1 B;  2MI7 A;  1OA0 A;  3EJU A;  4IWO A;  2ZXQ A;  1R5E A;  3OWG A;  1JQK A;  3DDF A;  2EFL A;  3M3W A;  4F00 A;  1TQT A;  2YIV X;  4R5J A;  1OA1 A;  3SOG A;  2QXL A;  3D4Y A;  1QWN A;  4EZN A;  4EZW A;  5C5B B;  3EJQ A;  1I4L A;  4JWI A;  3BVW A;  3HAI A;  4EZR A;  3G9G A;  1YWM A;  4JL9 A;  2X3V A;  3UIT A;  2O0I 1;  2LXY A;  3LLL A;  2YL8 A;  2EWF A;  1E9V A;  4ATM A;  2D1L A;  4EZT A;  4EZZ A;  4AZ6 A;  2F18 A;  3T46 A;  2OW6 A;  4F01 A;  2LM0 A;  2ND1 A;  3T48 A;  2EX3 B;  4EZO A;  4KIK A;  1SUF A;  2Z0N A;  1I49 A;  3ER8 C;  3BUP A;  3ERC C;  4AZI A;  3DX3 A;  3L3P A;  2FIC A;  4DYL A;  2YL9 A;  3BUQ A;  4E3C A;  3OK8 A;  4JN4 A;  3HAJ A;  1GNL A;  3EJT A;  2GA9 D;  4AZH A;  3GI7 A;  4FM3 A;  3CAZ A;  1DKZ A;  4NSW A;  3ZED A;  4AZ7 A;  3DPP A;  4PO2 A;  4H8S A;  3O3N B;  5C5B A;  4M0M A;  1DKX A;  3DPQ A;  4G6Q A;  3DPO A;  2OZN B;  3F7W A;  1GN9 A;  4WPC A;  1QX1 A;  1UPX A;  5TKY A;  2D4C A;  3RV1 A;  3I04 A;  2RT6 A;  2Q12 A;  4AVM A;  2C08 A;  4KIK B;  4WPE A;  4H6I A;  4IM3 A;  3LVT A;  4H6H A;  2WYI A;  2V0O A;  2N3K A;  3VKH A;  3I01 A;  2JNS A;  1LQ7 A;  4R5I A;  3B53 X;  1MJG A;  3QE6 A;  3ER9 B;  1GNT A;  1SU7 A;  3LMF A;  3D2E A;  1ZWW A;  1TQV A;  2YIA A;  3DX0 A;  4JWC A;  3T47 A;  1X04 A;  4BNE A;  2YI9 A;  3FD9 A;  3EJR A;  3D2F A;  1O7D C;  2YI8 A;  2ND0 A;  3BUI A;  2X5C A;  1O7D B;  4UDX X;  3Q84 A;  3RV0 A;  4EZU A;  2PY6 A;  3B52 X;  3BLB A;  4IWQ A;  3HAH A;  3I2W A;  1WDZ A;  3CVR A;  3RPM A;  1ZYL A;  2X3X A;  5FLE X;  5KBP A;  2OW7 A;  2QFF A;  4NQI A;  4EZY A;  1E2U A;  2YLL A;  4JWE A;  3BVU A;  1TQS A;  2ELB A;  3BVT A;  2Z0O A;  2Z0V A;  4UDY X;  4EZQ A;  3DX1 A;  3CV5 A;  2WYH A;  1URU A;  3BVX A;  3DX2 A;  3KAV A;  4IW0 A;  3OHX M;  4AZC A;  2OBM A;  2YL5 A;  2F1A A;  4FZP A;  3I39 X; 
#chains in the Genus database with same CATH homology
 2RAI A;  2D4C A;  2Z0N A;  4NQI A;  4AKV A;  4DCN C;  3QE6 A;  3ACO A;  2Q12 A;  4AVM A;  2C08 A;  3DYT A;  1I4T A;  2Q13 A;  2YKT A;  1I49 A;  3LLL A;  3QWE A;  4H8S A;  3SYV A;  2RAK A;  3Q84 A;  1URU A;  2EFL A;  3Q0K A;  5C5B A;  4WPE A;  4ATM A;  2D1L A;  2RAJ A;  2FIC A;  1ZWW A;  4DYL A;  3M3W A;  4FZS A;  1X03 A;  3CAZ A;  5C5B B;  1X04 A;  2X3W A;  3OK8 A;  1I4L A;  2ELB A;  3HAJ A;  4I1Q A;  2V0O A;  3HAH A;  3I2W A;  4BNE A;  1Y2O A;  1WDZ A;  3HAI A;  1I4D A;  3ABH A;  3QNI A;  3SOG A;  2Z0O A;  3G9G A;  3PLT A;  2EFK A;  4WPC A;  2X3V A;  2X3X A;  4NSW A;  2Z0V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...