3I2WA

Crystal structure of efc/f-bar domain of drosophila syndapin/pacsin
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
290
structure length
270
Chain Sequence
SDSFWEPGNYKRTTKRIEDGYKLCNDLQQLIQERADIEKGYAKSLRTWSKKWGELIEKGPEYGTTEAAWKGVLTESERISDVHMKIKDNLCNDVNSQIKTWQKENYHHTLMQIKERKDLEDLFKKAQKPWAKLLAKVEKAKADYHSACKTERSATHDRVQKTKDQVQKCREKYEQAIAEITKYNSVYIEDMTSVFEKCQTFEKTRLQFFKEILFNVHSCLDLTKVQSLPQIYEEFSHTINNADQQKDLKWWSNNHGINMAMNWPSFVEYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis
molecule keywords Syndapin
publication title Structural requirements for PACSIN/Syndapin operation during zebrafish embryonic notochord development.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 111
structure length 270
sequence length 290
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00611 FCH Fes/CIP4, and EFC/F-BAR homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 3i2wA01
4DYLA 2X3XA 2X3VA 3HAJA 1I4TA 1WDZA 3SYVA 4AVMA 2EFLA 1X04A 3ACOA 3QWEA 4WPEA 2Q13A 1I49A 1X03A 4FZSA 1ZWWA 2RAKA 1I4LA 1URUA 1Y2OA 3G9GA 3QNIA 4NQIA 3LLLA 3ABHA 2YKTA 2FICA 3I2WA 2D1LA 4DCNC 3CAZA 2EFKA 2Q12A 5C5BB 3Q0KA 2RAJA 3DYTA 1I4DA 3SOGA 5C5BA 3PLTA 2C08A 2V0OA 4WPCA 2Z0NA 3OK8A 2Z0VA 2D4CA 3QE6A 2X3WA 4H8SA 4NSWA 4ATMA 4BNEA 2ELBA 2Z0OA 3HAIA 3M3WA 2RAIA 4I1QA 4AKVA 3Q84A 3HAHA
chains in the Genus database with same CATH superfamily
1UPXA 2OW7A 2X5CA 2MI7A 2Q13A 4FZSA 3O3MB 5FIGA 2YKTA 4DCNC 3GI7A 4WPCA 2YIVX 3BUBA 1O7DC 3ER8C 3EJPA 3HAIA 1E9VA 3L3PA 3UITA 1E1DA 4AVMA 2ALWA 2FYVA 1ZWWA 4IWPA 1TQVA 3D2EA 3I2WA 3CZSA 2WINM 2RAJA 4M0MA 1DKXA 4HYBA 2ZXQA 3DPPA 3BUIA 3CVRA 2Z0VA 4HR1B 2N3KA 2ND0A 2GF4A 2PMRA 4JNEA 4EZVA 4AKVA 3Q84A 4EZQA 2F1BA 2QXLA 3EJQA 4E3CA 1I49A 2RAKA 3DPQA 2YIBA 3FD9A 1R33A 3VEBA 2PY6A 3D50A 5C5BB 1GNTA 1SU7A 3B53X 3SOGA 3CKDA 4JLCA 4ATMA 2X3XA 1I4TA 2EFLA 3DDFA 3L3OM 4JNFA 3O3OB 3I01A 3T49A 2GA9D 2NCZA 2YI8A 2JNKA 4JL9A 2OW6A 4AZBA 4R5IA 1OAOA 3KAWA 1JQKA 3BUPA 4F00A 2Z8YA 2X3VA 1LQ7A 4FM3A 3D51A 5E84A 3F7WA 4KIKB 1I4LA 1URUA 1DKYA 3DYTA 1U00A 2QFFA 1HWWA 2LXYA 3OHXM 3HAHA 4NPHA 3KAVA 4EZWA 3BUQA 3QNJA 3T47A 3EJRA 2D1LA 3QA8A 5TKYA 2F7QA 3OK8A 4H8SA 4BNEA 2X3WA 4AZ5A 4AZCB 3BVXA 3ER9B 1X03A 2F1AA 1QX1A 3ABHA 2JNSA 3LMFA 4IW0A 3CZNA 4EZRA 3VKHA 2C08A 1OA0A 3I04A 2ELBA 2EWFA 4HR1A 3HAJA 3B51X 4WPEA 3OWGA 1SUFA 4IWQA 2O0I1 4EZPA 4EZZA 2F7OA 5C5BA 2F7RA 4H6HA 2F18A 4G6QA 4AZIA 4R5GA 2LM0A 4EZSA 1YWMA 1SU6A 4EZOA 2YIAA 3SYVA 4IM0A 4R5KA 3B52X 4R5LA 3Q0KA 3C7NA 3DX2A 2EX3B 2YLAA 4EZUA 4EZXA 3O3NB 2KHOA 1W9MA 1WDZA 3DPOA 3BVWA 3T46A 3BVVA 3T4AG 4KIKA 3BVUA 5KBPA 4D8JA 2YL8A 3CAZA 2OBLA 1I4DA 1QWUA 4JWEA 2V0OA 2OZNB 2Z0NA 3QE6A 3M3WA 3DX3A 1GNLA 4PO2A 3KDRA 4AZ7A 4H6IA 4JN4A 3ACOA 3I39X 2WYHA 4NQIA 3DDGA 1ZYLA 4FZPA 3EJTA 3DX4A 1TQUA 3BLBA 1R34A 4AZCA 3BVTA 3CV5A 1QWNA 3ERCC 1SU8A 3RPMA 4F01A 2YL5A 2OO2A 3T48A 4I1QA 1PS3A 1O7DB 4JWIA 4EZNA 2YL6A 1HXKA 3RV1A 1TQSA 1X04A 4JWCA 4FZOA 2QKWA 2GAFD 2Q12A 4AZHA 4IM2A 4NSWA 2YI9A 2Z0OA 4UDYX 4HY9A 1HTYA 3RV0A 2RT6A 5FLEX 4JWDA 1Y2OA 3G9GA 3QNIA 3D4YA 2ND1A 4R5JA 3DX0A 3BUDA 3EJSA 1E2UA 3D4ZA 1TQTA 4DYLA 2OBMA 3EJUA 1R5EA 3QWEA 3LVTA 1MJGA 3LLLA 4IM3A 2D4CA 4AZ6A 2RAIA 2YLLA 2WYIA 3VEAA 4EZYA 3D52A 2F7PA 3A98A 4B9QA 4E81A 2FICA 3D2FA 2YL9A 2EFKA 1OA1A 4EZTA 4UDXX 1TQWA 1DKZA 1GN9A 3PLTA 4AZGA 4IWOA 3ZEDA 3DX1A
chains in the Genus database with same CATH topology
4DYLA 2X3XA 2X3VA 3HAJA 1I4TA 1WDZA 3SYVA 4AVMA 2EFLA 1X04A 3ACOA 3QWEA 4WPEA 2Q13A 1I49A 1X03A 4FZSA 1ZWWA 2RAKA 1I4LA 1URUA 1Y2OA 3G9GA 3QNIA 4NQIA 3LLLA 3ABHA 2YKTA 2FICA 3I2WA 2D1LA 4DCNC 3CAZA 2EFKA 2Q12A 5C5BB 3Q0KA 2RAJA 3DYTA 1I4DA 3SOGA 5C5BA 3PLTA 2C08A 2V0OA 4WPCA 2Z0NA 3OK8A 2Z0VA 2D4CA 3QE6A 2X3WA 4H8SA 4NSWA 4ATMA 4BNEA 2ELBA 2Z0OA 3HAIA 3M3WA 2RAIA 4I1QA 4AKVA 3Q84A 3HAHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DYL A;  2X3X A;  2X3V A;  3HAJ A;  1I4T A;  1WDZ A;  3SYV A;  4AVM A;  2EFL A;  1X04 A;  3ACO A;  3QWE A;  4WPE A;  2Q13 A;  1I49 A;  1X03 A;  4FZS A;  1ZWW A;  2RAK A;  1I4L A;  1URU A;  1Y2O A;  3G9G A;  3QNI A;  4NQI A;  3LLL A;  3ABH A;  2YKT A;  2FIC A;  3I2W A;  2D1L A;  4DCN C;  3CAZ A;  2EFK A;  2Q12 A;  5C5B B;  3Q0K A;  2RAJ A;  3DYT A;  1I4D A;  3SOG A;  5C5B A;  3PLT A;  2C08 A;  2V0O A;  4WPC A;  2Z0N A;  3OK8 A;  2Z0V A;  2D4C A;  3QE6 A;  2X3W A;  4H8S A;  4NSW A;  4ATM A;  4BNE A;  2ELB A;  2Z0O A;  3HAI A;  3M3W A;  2RAI A;  4I1Q A;  4AKV A;  3Q84 A;  3HAH A; 
#chains in the Genus database with same CATH topology
 1UPX A;  2OW7 A;  2X5C A;  2MI7 A;  2Q13 A;  4FZS A;  3O3M B;  5FIG A;  2YKT A;  4DCN C;  3GI7 A;  4WPC A;  2YIV X;  3BUB A;  1O7D C;  3ER8 C;  3EJP A;  3HAI A;  1E9V A;  3L3P A;  3UIT A;  1E1D A;  4AVM A;  2ALW A;  2FYV A;  1ZWW A;  4IWP A;  1TQV A;  3D2E A;  3I2W A;  3CZS A;  2WIN M;  2RAJ A;  4M0M A;  1DKX A;  4HYB A;  2ZXQ A;  3DPP A;  3BUI A;  3CVR A;  2Z0V A;  4HR1 B;  2N3K A;  2ND0 A;  2GF4 A;  2PMR A;  4JNE A;  4EZV A;  4AKV A;  3Q84 A;  4EZQ A;  2F1B A;  2QXL A;  3EJQ A;  4E3C A;  1I49 A;  2RAK A;  3DPQ A;  2YIB A;  3FD9 A;  1R33 A;  3VEB A;  2PY6 A;  3D50 A;  5C5B B;  1GNT A;  1SU7 A;  3B53 X;  3SOG A;  3CKD A;  4JLC A;  4ATM A;  2X3X A;  1I4T A;  2EFL A;  3DDF A;  3L3O M;  4JNF A;  3O3O B;  3I01 A;  3T49 A;  2GA9 D;  2NCZ A;  2YI8 A;  2JNK A;  4JL9 A;  2OW6 A;  4AZB A;  4R5I A;  1OAO A;  3KAW A;  1JQK A;  3BUP A;  4F00 A;  2Z8Y A;  2X3V A;  1LQ7 A;  4FM3 A;  3D51 A;  5E84 A;  3F7W A;  4KIK B;  1I4L A;  1URU A;  1DKY A;  3DYT A;  1U00 A;  2QFF A;  1HWW A;  2LXY A;  3OHX M;  3HAH A;  4NPH A;  3KAV A;  4EZW A;  3BUQ A;  3QNJ A;  3T47 A;  3EJR A;  2D1L A;  3QA8 A;  5TKY A;  2F7Q A;  3OK8 A;  4H8S A;  4BNE A;  2X3W A;  4AZ5 A;  4AZC B;  3BVX A;  3ER9 B;  1X03 A;  2F1A A;  1QX1 A;  3ABH A;  2JNS A;  3LMF A;  4IW0 A;  3CZN A;  4EZR A;  3VKH A;  2C08 A;  1OA0 A;  3I04 A;  2ELB A;  2EWF A;  4HR1 A;  3HAJ A;  3B51 X;  4WPE A;  3OWG A;  1SUF A;  4IWQ A;  2O0I 1;  4EZP A;  4EZZ A;  2F7O A;  5C5B A;  2F7R A;  4H6H A;  2F18 A;  4G6Q A;  4AZI A;  4R5G A;  2LM0 A;  4EZS A;  1YWM A;  1SU6 A;  4EZO A;  2YIA A;  3SYV A;  4IM0 A;  4R5K A;  3B52 X;  4R5L A;  3Q0K A;  3C7N A;  3DX2 A;  2EX3 B;  2YLA A;  4EZU A;  4EZX A;  3O3N B;  2KHO A;  1W9M A;  1WDZ A;  3DPO A;  3BVW A;  3T46 A;  3BVV A;  3T4A G;  4KIK A;  3BVU A;  5KBP A;  4D8J A;  2YL8 A;  3CAZ A;  2OBL A;  1I4D A;  1QWU A;  4JWE A;  2V0O A;  2OZN B;  2Z0N A;  3QE6 A;  3M3W A;  3DX3 A;  1GNL A;  4PO2 A;  3KDR A;  4AZ7 A;  4H6I A;  4JN4 A;  3ACO A;  3I39 X;  2WYH A;  4NQI A;  3DDG A;  1ZYL A;  4FZP A;  3EJT A;  3DX4 A;  1TQU A;  3BLB A;  1R34 A;  4AZC A;  3BVT A;  3CV5 A;  1QWN A;  3ERC C;  1SU8 A;  3RPM A;  4F01 A;  2YL5 A;  2OO2 A;  3T48 A;  4I1Q A;  1PS3 A;  1O7D B;  4JWI A;  4EZN A;  2YL6 A;  1HXK A;  3RV1 A;  1TQS A;  1X04 A;  4JWC A;  4FZO A;  2QKW A;  2GAF D;  2Q12 A;  4AZH A;  4IM2 A;  4NSW A;  2YI9 A;  2Z0O A;  4UDY X;  4HY9 A;  1HTY A;  3RV0 A;  2RT6 A;  5FLE X;  4JWD A;  1Y2O A;  3G9G A;  3QNI A;  3D4Y A;  2ND1 A;  4R5J A;  3DX0 A;  3BUD A;  3EJS A;  1E2U A;  3D4Z A;  1TQT A;  4DYL A;  2OBM A;  3EJU A;  1R5E A;  3QWE A;  3LVT A;  1MJG A;  3LLL A;  4IM3 A;  2D4C A;  4AZ6 A;  2RAI A;  2YLL A;  2WYI A;  3VEA A;  4EZY A;  3D52 A;  2F7P A;  3A98 A;  4B9Q A;  4E81 A;  2FIC A;  3D2F A;  2YL9 A;  2EFK A;  1OA1 A;  4EZT A;  4UDX X;  1TQW A;  1DKZ A;  1GN9 A;  3PLT A;  4AZG A;  4IWO A;  3ZED A;  3DX1 A; 
#chains in the Genus database with same CATH homology
 4DYL A;  2X3X A;  2X3V A;  3HAJ A;  1I4T A;  1WDZ A;  3SYV A;  4AVM A;  2EFL A;  1X04 A;  3ACO A;  3QWE A;  4WPE A;  2Q13 A;  1I49 A;  1X03 A;  4FZS A;  1ZWW A;  2RAK A;  1I4L A;  1URU A;  1Y2O A;  3G9G A;  3QNI A;  4NQI A;  3LLL A;  3ABH A;  2YKT A;  2FIC A;  3I2W A;  2D1L A;  4DCN C;  3CAZ A;  2EFK A;  2Q12 A;  5C5B B;  3Q0K A;  2RAJ A;  3DYT A;  1I4D A;  3SOG A;  5C5B A;  3PLT A;  2C08 A;  2V0O A;  4WPC A;  2Z0N A;  3OK8 A;  2Z0V A;  2D4C A;  3QE6 A;  2X3W A;  4H8S A;  4NSW A;  4ATM A;  4BNE A;  2ELB A;  2Z0O A;  3HAI A;  3M3W A;  2RAI A;  4I1Q A;  4AKV A;  3Q84 A;  3HAH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...