4IM3A

Structure of tank-binding kinase 1
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
659
structure length
605
Chain Sequence
GSMQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNRPVDVQMREFEVLKKLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGMNHLRENGIVHRNIKPGNIMRVIGEDGQSVYKLTDFGATVDLWSIGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITGKPSGAISGVQKAENGPIDWSGDMPVSCSLSRGLQVLLTPVLANILEADQEKCWGFDQFFAETSDILHRMVIHVFSLQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQELIYEGRRLVLEPGRLAQHFPKTTEENPIFVVSREPLNTIGLIYEKISLPKVHPRYDLDGDASMAKAITGVVCYACRIASTLLLYQELMRKGIRWLIELIKDDYNETVHKKTEVVITLDFCIRNIEKTVKVAAELGEISDIHTKLLRLSSSQGTIETSLQDIDSRLSPGGSLADAWAHQEGTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLAYNEEQIHKFDKQKLYYHATKAMTHFTDECVKKYEAFLNKSEEWIRKMLHLRKQLLSLTNQCFDIEEEVSKYQEYTNELQET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase TBK1
publication title Structure of Tank-Binding Kinase 1
rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 194
structure length 605
sequence length 659
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-01-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF18394 TBK1_CCD1 TANK-binding kinase 1 coiled-coil domain 1
A PF18396 TBK1_ULD TANK binding kinase 1 ubiquitin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4im3A02
1.20.1270.420 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4im3A04
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4im3A03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4im3A01
3QA8A 4BIDA 3OCBA 5CF5A 3FLSA 3D2KA 3FXZA 3PREA 2HY81 3E93A 2YERA 2UW7A 2Z02A 2VTQA 2XJ1A 2PHKA 4PX6A 2AC5A 5K5XA 2R2OA 5HG5A 3UBDA 3PSBA 4BDAA 4BDHA 3PZDA 1YKRA 4W9DA 3A60A 2C0OA 4QTDA 4KIKB 5FP6A 4QD6A 3V04A 1GZ8A 4I93A 5C26A 2UZNA 1ZWSA 4O84A 2PVHA 1QCFA 2HYYA 3DAKA 2QHMA 4W9EA 1J0GA 3SV0A 2BRGA 4MXZA 4CQGA 3IKAA 5L83A 3VTVA 4D1XA 2ZPNA 3KRLA 2LGXA 3ET7A 2M8SA 4YTCA 1Q8ZA 2YN8A 2FSOX 3SVVA 1AD5A 4FF8A 1WFCA 3WAOA 4YMJA 2Z8CA 4WUAA 3LMIA 5EDRA 5CZIA 3EH9A 2RKUA 4YJSA 4J97A 4IWPA 3GU6A 3V5WA 4G3FA 1WXVA 3FL4A 4W9IA 4TW9A 4BCKA 2WTVA 3ORIA 5FDPA 4KS8A 4PPCA 1Q1OA 2G45B 3IBEA 3CKXA 2R3QA 1WI0A 3OROA 4YC3A 2C6TA 2WOTA 2ZCCA 3UE4A 5EM7A 3D9VA 3B2WA 1WBVA 5E8TA 5HE0A 4IM3A 4E20A 1WBWA 4IXPA 2NR2A 2GTMA 3QKLA 1KV1A 4F6SA 1B38A 3TN8A 2O2UA 4FJVB 3FZ1A 5E8YA 3HNGA 2B9HA 2JKMA 2XKFA 3AD6A 4ZLOA 4BCFA 3FMMA 5IA5A 2BYVE 4KBCA 4GXBA 4UXLA 2PJHA 1C3TA 3KXHA 4O7YA 2B3AA 4D1SA 5AMNA 4L42A 2X1NA 4YNEA 3PPJA 3C5IA 1TZ1A 2BAKA 5G6VA 4CFUA 4OAUC 1IR3A 4Y8DA 4IX5A 3FMNA 5LARA 2C1BA 1MP8A 1XWSA 1RAXA 4OTHA 5CNOA 4IZYA 2BF8B 2JT4B 1PY5A 5DR6A 3VF9A 1Z2MA 2OH4A 4YJQA 2W96B 3KRXA 5EYDA 5DPSA 3I5NA 3FKNA 4M8MA 3H3CA 4FIFA 4TRLA 5AP7A 3I1AA 4MD9E 5BO4B 1A9UA 3PXRA 2VAGA 1SMHA 2OGVA 4K6ZA 3R3MA 4RJ7A 2W1EA 4RIXB 3NYXA 2OF4A 3L8SA 5EKNA 3B1LX 1YJ1A 3DBQA 1M2RA 5B2MA 4YSJA 3S3IA 5DRDA 5CEQA 5TO8A 3D5XA 5D7AA 3H30A 4WOVA 3KVXA 5L8LA 4IW0A 4PDSA 4FBXA 4QTEA 2ZV9A 3VAPA 4RVTA 4O81A 1HE8A 1H28A 2OSCA 5IDPA 2YZLA 4RX8A 5FTGA 3FBVA 4ERKA 2NBVB 5JK3A 3UZTA 5FBNC 4WRGA 1OKWA 4AGDA 2QU5A 5E8VA 3VS6A 5L6PA 4KIKA 4BDFA 3D83A 4V0GB 2ZZPB 3DQVA 2IW8A 3TZMA 3VS5A 3G51A 5E8UA 5CTPA 4ALWA 5J7BA 4WG4A 1U4AA 2GHMA 3BCEA 1E8WA 3N32A 2JAMA 3ZTXA 4NCTC 3F2AA 4DH7A 4YO4A 3BLHA 3HLLA 3U87A 3NW6A 5EHOA 4KDIC 3ZMMA 4H39A 3ORXA 3IECA 3F88A 4HWIB 3A7HA 3ULIA 4NQLB 3CKWA 3OS3A 4UYAA 2CN5A 3MN3A 4C02A 4QMTA 2C30A 4O2PA 2R2QA 4XV9A 3E8DA 3F3UA 4W8EA 4JT3A 3O8TA 4A9UA 4K18A 5HCZA 3CQWA 5AUTA 3BBTB 1BI8A 4WJQA 3VUIA 2JIIA 2VTMA 5LWMA 1WR6E 2W5AA 4WIHA 1O6LA 2C6OA 4A07A 3R9RA 3C0IA 4MXYA 4LDTB 3ZNHB 2O64A 3T8MA 4GDKA 5T68A 2G4DB 3VQHA 2KULA 2K25A 3HAMA 3RM7A 2WTKC 3UMXA 4BCPA 5FM3A 4ZTHA 3F6XA 3RALA 2WMRA 3UVQA 3ORKA 2N1VA 4MJSA 2L3ZA 4ZLZA 3QTWA 4G6OA 5LMKA 5KHOA 4HPUE 4FZ6A 4XG4A 3QX1A 2KANA 3BE9A 1CSNA 2F2UA 2BIYA 4U9AA 1RLFA 5BVNA 4IMYA 2OZAA 5M4FA 3N4TA 2ITPA 2WIPA 5DNRA 5CEPA 5AP6A 2ZV2A 1IA8A 2FIDA 5JFWA 3ZEWA 2JIVA 5HKMA 3DDCB 3QQFA 3M95A 5I0BA 4XV1A 3B08A 3NR9A 4IM0A 4YURA 1IRKA 4OBPA 4X6RA 2J0JA 3EIDA 2WMQA 4FV9A 3PJ2A 3A9KB 3P1AA 1WVYA 3QQKA 4H05A 3L16A 4FT7A 4E3CA 4X3JA 1H1RA 5DPRA 2WB8A 4WT6A 5BNJA 3C0RB 4X3FA 3SXSA 2UWQA 2FNJB 4JDKA 2WMSA 2A27A 4D0XA 4H3QA 3PXZA 1Q99A 1VYZA 4TTHB 4X7QA 3TKUA 3O51A 3I0QA 5IPJA 4R5YA 4BTJA 4O0UA 5AZGA 4FKIA 5IA3A 3L8VA 3B0AA 3JVZX 5CSXA 3GOEA 5IQEA 3P86A 3QRKA 5G1XA 4E6DA 3I5ZA 3HMIA 3BRBA 2W5HA 4RJ4A 4CRLA 1KSWA 1SVEA 3FDNA 1KOBA 3T9TA 5IZFA 3DOWA 3RCZA 5EM8A 4E71A 5LCJA 4IZ5A 5HO8A 5IISA 4FKGA 2FSLX 4YJVA 5BVOA 2NS5A 2JLDA 4FNYA 4F9AA 1Z5SB 1OL5A 2RR9A 3R7VA 2CNUA 2HZNA 2RG5A 1OPLA 2C3JA 3OVVA 2REXA 3R00A 3PA4A 4PTCA 2F4JA 5J79A 1Y8RC 4AZTA 4D4RA 2ZVOA 4RWKA 5A9UA 1W7HA 2R9SA 5EOLA 4PTGA 4HZSA 2XKCA 5AUUA 4UB7A 5CAUA 3LM5A 1R39A 4O0RA 4BZNA 4HGLA 4G6NA 3X0WA 3ML8A 4LRKA 5H8BA 4AGUA 4EH6A 4X6QC 1TQIA 3FKLA 4R1YA 1OBDA 4N6ZA 2PE0A 3A9JA 1QL6A 3DVGX 1V0BA 4UY9A 3DVNU 1UBQA 2DYMA 3FKOA 2V22A 4IDTA 4Y46A 4QP2A 3AMAA 3AD5A 4EYMA 2C9WB 3LCTA 2E9OA 2J50A 2W1HA 2PK9A 4GIVA 1TKIA 3TCPA 4L6QA 5LXHA 1YW2A 4K1RB 4F0GA 4EK5A 5GZ9A 3EKKA 4QMPA 3V6RA 3KMMA 5IMEA 4H1JA 3PJ3A 4UMQA 4V04A 2ITZA 2OG8A 4D28A 4I5HA 5HNIX 2Y8OA 3FQSA 4RWJA 4EOJA 5KZIA 4M68A 4MDKE 1VYWA 4ZJJA 5L2IA 5J9LA 4L01A 4BKTA 4GVJA 4O82A 2KJHB 3NNWA 3P7CA 5IF1A 3TZ8A 3UIBA 3EZVA 4MD8E 3TIXA 3W55A 3OAWA 3CIKA 3ZO3A 4O7SA 2MBBB 2QC6A 4CG8A 2YIWA 2YFXA 5A6NA 2PE2A 4R3PA 5D9HA 1WCCA 4G17A 4GEOA 2GNGA 4GGQA 1OUYA 2JEDA 3KRWA 4G3GA 1H0WA 4DEHA 2E9NA 2C5VA 3LKMA 2IY0B 2OJFE 3U30A 3DU8A 5HTIA 2CKPA 4FSZA 3WYYA 2ZM3A 3IDPA 1GIIA 2QOOA 4NKAA 4OLIA 4NZWB 3RAHA 5IQHA 4BBNC 1ZYCA 2Q0NA 2XK8A 3GP0A 4KUJA 3I4BA 3A1QA 3JVSA 3ZUTA 2G2HA 4KINA 5AIRA 5CVHA 1U46A 4BN1A 4AP7A 4QP3A 4C3FA 4IC7A 4P5ZA 2OZOA 2R0IA 3LFNA 5GJFA 4K0YA 4RT7A 4JNWA 1CTPE 1BL6A 3HKOA 2C5XA 4YJUA 5F4NA 2RL5A 4E93A 3AU5A 1W83A 2IZTA 2GOWA 4M15A 2FVDA 4AG8A 4IAZA 4PYZA 4F0IA 3EQHA 4F63A 3ZIMA 4DFXE 5B2KA 5HKHA 3VVWB 2L76A 3C4WA 3FQHA 4IB1A 2J5FA 5DPVA 3CD3A 4FV6A 5IKWA 4N0SA 4DTBA 4U79A 3WIGA 4EJ7A 2PVJA 4FV5A 3PXYA 4P7IA 1T45A 4KVGB 4P7EA 1M7QA 4NSTA 2DHZA 3C0HA 4E4NA 4IFGA 3O71A 3AMBA 2NVUI 4E73A 1H1PA 4C59A 1GZKA 2WEIA 4IAFA 1YHVA 2GHGA 3ANQA 4S31A 3AXWA 2OIQA 2GCDA 3IHPC 4C4GA 3GC9A 4HDOA 4C35A 3L54A 3R2BA 2ZYBA 4HCUA 4ZZMA 5CI6A 3NY5A 4KSKC 1IYFA 3UO5A 2JAVA 4LOQA 4XUFA 4RFMA 3TNWA 5ETIA 4ZS4A 5HE3A 3TUDA 3FLWA 3ZTCA 1GUAB 4HCPB 2C6MA 4FEVA 5CANA 3RPVA 3QFVA 4RWIA 5AUVA 3H7SA 3TNQB 2W05A 3OJ3A 5KMKA 2L00B 1YI4A 3ZLWA 1TGZB 3NIEA 4HK2A 2A4LA 4D5KA 2OIDA 2YM3A 1KV2A 4ZSLA 5J17A 2ITQA 3QTXA 3ZYAA 4B6LA 3O8PA 4AZEA 3F3ZA 4OBQA 4M69B 3KC3A 4L7FA 1ND4A 3NUAA 2PWLA 3R8PA 4PUZA 3QK0A 4EZ5A 4I6FA 4CG9A 3R8UA 3P5KA 3CJFA 4GRBA 4CYEA 4LJPB 3VRZA 1WMKA 4FVQA 3A7GA 4FTCA 1M17A 3FY0A 3BIZA 1NVRA 2DX5B 2X6EA 5LMKC 3WIKA 5LCKA 2PL0A 4MGKE 3U55A 4W9WA 5DYJA 3E92A 2BUJA 3ALNA 2C0IA 3Q9YA 3HZTA 3QZGA 1V5TA 1FPUA 4AXAA 1Q5KA 3RKBA 1Z9XA 4LRMA 1OI9A 2YIRA 2VD5A 3ZUVA 4C4EA 4YZBA 1OGUA 4B99A 1WGGA 3HVCA 4BIEA 3PJ8A 5KMLA 1YQJA 2A0CX 2JZ3B 2VX0A 3C1XA 2X2KA 3NX8A 3M62B 5AP0A 3BU6A 2KX0A 4PDYA 2P2IA 1L3RE 5LQFA 4X3FC 3DJ7A 3PXFA 4KABA 1H8CA 2ZB0A 2YDKA 1JKLA 4MGZE 5IMXA 2O2VB 5JH6A 3POOA 1AQ1A 5FP5A 4AN2A 4W4XA 1FBNA 3LFCA 2QOFA 4BYJA 3MH3A 4R6VA 4F9CA 4IAAA 3C4FA 2OJ9A 2EKEC 3QJZA 2P2HA 4DEEA 5KHWA 1J7LA 4ANQA 3MPAA 4O0SA 4CFNA 4BBEA 4ICUA 4HJOA 3LLAA 5HVYA 3SQQA 2B9FA 5JRQA 5IA0A 2KTFA 3E63A 3F3WA 4GMVA 2LGCA 4WNPA 2CHZA 3L10B 4E4XA 1OEYA 3UZRA 3F7WA 4S33A 2W4KA 4X2KA 4ZTRA 3RVGA 3Q9ZA 4F09A 4W9HA 3BHUA 3MIYA 5DT3A 1J3HA 2RSUA 3QXPA 4F7JA 2XNEA 4HYIA 2C3KA 2EUFB 2VTJA 3AC4A 3PYYA 1FXTB 4FKRA 2ITYA 2W17A 3VUKA 4ASEA 4IX3A 2X6DA 3IQ7A 4F1OA 3AT2A 3WF8A 3EN6A 4CCUA 4JR3A 3PP1A 2WTWA 5I9ZA 4D58A 3I6WA 2PZPA 4RSSA 2VTIA 4HYSA 4Z3VA 2B55A 3QXOA 4RQVA 4ZTQA 2H34A 4FKWA 3VBYA 2HENA 4C38A 2C3IB 4C3PA 1GJOA 2V3SA 4J71A 5TF9A 5CHVC 4LL5A 2QR8A 3AC5A 3HL7A 2C6LA 3FQEA 5ANDA 4U97A 3TBLD 4NH1A 3S0OA 4YJOA 4RPVA 4GMYA 2UZWE 4HNIA 4GT4A 2HD5B 3OCGA 1GC7A 5HO7A 1H1WA 1P3QU 2Y6MA 5I9YA 4WJNA 5D94A 5AV2A 3CSFA 2GDOA 4AZVA 3UODA 3E7OA 2JITA 1NVSA 1BLXA 4BZDA 1XQZA 4AE9A 2PZYA 2X9FA 2WU6A 1E8YA 3FV8A 1WZ0A 1UA2A 2KDIA 3CGFA 4B8MA 4I5CA 4JS8A 4K7UA 2K39A 3RGFA 4H3BA 3V01A 4EKUA 5GHVA 3DV3A 3VS4A 5JHAA 4ZYNA 2R3RA 1QPEA 1M2PA 2P33A 1DI8A 3CS9A 3H9FA 4XYFA 3EHVA 3OY3A 4I21A 1BMKA 3N9XA 4ZTSA 4JXFA 2JKKA 3QUDA 3NVMB 4IHPA 3EN7A 4ZRJA 1IAHA 3AOXA 1OTRB 4ALUA 3PXKA 5EW3A 4O7RA 5CYIA 3NIZA 4Z7HA 1J8CA 1SNXA 5HD4A 3BYSA 2QLQA 2BHEA 5A14A 2ITTA 3JXWA 2CGUA 3Q04A 3O96A 2WXVA 2PMNX 1L7YA 3ORZA 4MF0A 4ZRKA 3LM0A 3IO7A 1XHAA 3D15A 3DT1A 3K3JA 3FHRA 2FSMX 4A9RA 3BLQA 3K3IA 2WKMA 3HV6A 3D7ZA 3BZ3A 4M13A 2JKQA 5C8NA 4O2ZA 2DZKA 4J96A 3BYVA 2F7XE 4QP7A 2DUVA 2G4SA 1YOMA 5EW8A 2HTHA 3QYWA 5GZAA 3UPXA 5BVEA 5AZHA 2E2BA 4G9CA 4GUEA 3AG9A 1PXNA 4AAAA 4UWBA 5J5SA 2YA9A 3ZNZB 4NFMA 3UINB 3ZRKA 2R3KA 3TNHA 2GMIC 2HOGA 2JDTA 3PRMB 3LE6A 4ZZNA 1V2YA 2P4IA 4LGHA 1Q8UA 4E5AX 1G3NA 3MFTA 5ETAA 4ASZA 5L3AA 4FKJA 5HCXA 3W32A 3MH2A 4M66A 3DZOA 2LXCA 3VBTA 4EHZA 3VH3B 4D4VA 4FK3A 3ZM4A 4F7LA 2P0CA 3A8WA 3VAWA 2KVRA 1S3SG 5AUYA 4I4FA 3DTWA 4DGMA 2B54A 2XM9A 4RFZA 3EFUA 4D55A 3UQAA 1H8FA 5DH3A 4QYYA 2X39A 4DG0E 3UG2A 2RFDA 4DFBA 1XBBA 3TWJA 1FGIA 3ML9A 3W2QA 3DDQA 3KXGA 3R66C 5IQCA 4Q9SA 4W9GA 3JYAA 4IAIA 1UNHA 3GNIB 3QRUA 4YLKA 3MI9A 3GVUA 3MJ1A 1UU7A 3HV3A 4AWJA 4EUUA 4NIFA 2BAJA 4E6CA 2WMUA 3GC8A 5JGDA 3P23A 4GG5A 3I81A 4PF4A 3WE4A 3RCJA 3KK9A 3OBGA 2PTKA 4B8LA 3QTSA 3GC7A 3OXZA 4I5MA 4MNFA 4QMZA 4ENYA 4GB9A 3H0YA 3R28A 2CU1A 2DZJA 2KTYA 3UNKA 2VX1A 3KH0A 5IQAA 1BL7A 1UV5A 3WAPA 2YHVA 2UZUE 4G11A 2PMOX 5EI6A 2ZDUA 3OEFX 3VHTC 4MF1A 4YUQA 2C5NA 1Y8GA 3M3JA 3ZXTA 4GDLA 2OICA 3LJ3A 4UX9A 4KIOA 1JKSA 2LAVA 2PMLX 5DBXA 4BYIA 4ZRIA 4ANWA 2PVRA 2JRIB 4IQ6A 3QC4A 2BRHA 3A99A 3EB0A 2KQ7A 4WBOA 4BDBA 1ZYJA 4RJ3A 5TE0A 4PS8A 4TN6A 1ZY5A 4GT3A 4CV8A 4PPAA 4DINA 5I4NA 3OEZA 2RFSA 5EDPA 4LQMA 5IAAC 4XP3A 4PNKA 4EHVA 5IEXA 4DFYA 4XMOA 2OW3A 3F5GA 3SGCA 3NSZA 4AQCA 2UW3A 2VWZA 1UWJA 1WBNA 4FTMA 2WHBA 2WMBA 5KKRB 4FSUA 3LLTA 1QZEA 3CMMB 5AR7A 3MFRA 2AC3A 2VTPA 3MFUA 5BX0A 1OZ1A 1XH6A 3NUUA 2UZBA 3LDZE 4RM8A 4XX9A 4J95A 2Z7SA 4QMVA 3VQUA 3C4ZA 4C57A 3RAKA 4ARKA 3NNVA 3C0GA 3OY1A 2IYDB 5D41A 1PYEA 4FODA 3F9NA 3LXPA 3FJQE 2XIXA 3ZZEA 5J8IA 5K4JA 4EOYA 3QX4A 3KYCD 5GIOE 1Q3WA 5H2UA 3AXCA 1VJYA 4G50A 4NW5A 2VWVA 4IEBA 2J6MA 3W18A 2OJRA 3HA8A 4JG7A 4RQKA 4ANXA 5M07A 4XG6A 1A06A 1H0VA 3O50A 4W9JA 4FKUA 1ZARA 1OECA 3LHJA 3RHKA 4OW8A 4F8CB 3V6SA 2OXYA 4UMTA 5BVDA 4WQOB 2IBIB 2X4FA 1E8XA 4DDID 4PDOA 5L8KA 1V86A 2ZNVB 5IA1A 5CXHA 1W0XC 5KZ0A 4KBAA 4TWCA 2O6VD 5AUXA 4ZAUA 3R8MA 2B7AA 5DFPA 1JKKA 1OVEA 1YHWA 2K8HA 4FKVA 4LCDE 5A4LA 1IPGA 3UNJA 4TWPA 4QTCA 2CNQA 3WIMA 2IO3B 3IVFA 1V81A 2MX2A 1ZGUB 4USEA 1YXUA 4X2JA 2OJJA 3ZLYA 5CY3A 5D10A 2WU7A 2XK5A 1GZNA 5K4IA 5CAVA 2HY0A 1TQPA 1Z57A 4TZRA 3QCXA 3QKMA 1JSVA 5FUTA 1Q4LA 3QLFA 3TNIA 4QYHA 4PS7A 1PXKA 2KDBA 4FOBA 4MTAA 4NAWA 3QZFA 5CX3A 3PY0A 5AX9A 4D5HA 4EOQA 3L9MA 2J0KA 4FTUA 4FSWA 4FIJA 5CU3A 5I9VA 4AT3A 2XCHA 1JSUA 5HLNA 2Z0DB 3FLYA 5EQYA 3GU5A 3WARA 3ZHPC 3R8LA 3EQGA 2JBOA 5K0XA 3U8WA 1XBCA 3C51A 5J9YA 4IG7B 2YVCA 4GIHA 2KC2A 3F82A 4DEDA 4QMMA 4BY9E 3GU8A 4NFNA 3DA6A 1E1VA 5EK7A 5HIDA 2O0UA 2BILB 3O8UA 4NM0A 1KE5A 4RRVA 3R9HA 3ORMA 3PG3A 2I0VA 5CLPA 4II3B 3AGLA 4HVHA 1F3MC 5EM6A 3GEQA 4GFMA 2F2CB 2GS6A 4EOMA 4R78A 1OGWA 4HVGA 1OB3A 4NEUA 3E3BX 2R64A 2Z2WA 3OOMA 3QWKA 3V61A 1W98A 3T3UA 1E9HA 3TTIA 3KEXA 5IH4A 2P55A 5GMVA 3F2RA 5JSMA 2QLUA 4O1PA 3R02A 4CZYB 2KMCA 5AADA 5D12A 4L8MA 3KYDD 3Q6UA 4JR7A 2VO3A 2C7MB 3EFKA 4A3OA 3DAEA 5HEZA 3DXNA 5AWMA 5CASA 4K2RA 3TL8A 3FMEA 4RLLA 2VTAA 2WQMA 2J51A 4RZVA 3PJ1A 4OTQA 2J0IA 3UG1A 5EFQA 5LVPA 4RVKA 1WXSA 3TV7A 2K1FA 4AW0A 2DQ7X 2G01A 2BALA 3QD2B 4GFGA 3O0GA 3HM6X 4M12A 2VRXA 4RC2A 1FGKA 3CE3A 4OTDA 4FK6A 4II5A 4UWYA 5CSVA 2J0MB 2Y0AA 3HX4A 3BKBA 5EH0A 4IC8A 5D11A 4CMOA 3PTGA 2LVOA 4B95A 1RFAA 5E8XA 2BKKA 4ZIMA 3AGMA 5GIPE 1UBIA 4U0IA 1YXXA 2CKQA 4EH5A 5FDXA 3V51A 4BHNA 4YZDA 1DM2A 4U3ZA 2WQEA 4J7BA 1XH8A 2YJRA 4IBMA 4IZAA 2OO8X 2JWZA 2B4SB 1UZXB 3HP2A 5DE2A 4RIYA 3VBQA 3UOJA 1CKPA 3X23A 3BY4B 5IEVA 4ZMFA 4KA3A 2QOLA 4D2VA 3VVHA 3JSVB 3SD0A 1SZMA 2DYBA 3DBRI 4ASWC 4KIPA 4XRJA 1I35A 4BTMA 4E6QA 4ZJVA 5IUIA 4CRSA 5DPTA 4OTWA 2BPMA 1Q8YA 2AUHA 2FUHB 3FMJA 1U4DA 5E4HA 5KMOA 4GVAA 3NW5A 2ITUA 2DAJA 1VR2A 3EQIA 5A54A 3NUYA 2OI4X 1JKTA 4ANUA 4Z16A 4BTKA 3ECIA 3ENMA 4HPMB 3VUWA 1I44A 4IVAA 2XVDA 2C0TA 2WNTA 2W1DA 3R7GA 3G9NA 2HAKA 5AUZA 4BCIA 2KHWB 4A9SA 4DFNA 3ZBFA 2KWCA 5E6OA 4HVIA 4X57B 3FXWA 4CV9A 3MDYA 2XNNA 3R01A 2G15A 3RAWA 3ZLZA 2HCKA 3MESA 3THBA 2BFYA 3DB8A 4DXAB 3TJPA 3T9IA 1CMXB 3F5XA 3W1SA 3UGBB 2X8EA 5HNBA 1XD3B 3BEAA 3V5JA 2IW6A 4DHZB 3U6IA 4YBKA 3VXWA 4IB3A 4EOLA 3PVLA 4GH2A 4R3CA 4IWDA 5CT7A 5ANKA 5LVLA 3OBJA 1P98A 2WTIA 3P2BA 3NGAA 4Y72A 4XX5A 5HX6A 4YR8A 4EH4A 1EF5A 4AA0A 2EMTA 4YZ9A 3BLRA 3M2WA 5CSHA 4WWNA 4EZLA 4J6IA 3WF7A 4YJRA 4NTSA 3Q6WA 5DHJA 3N51A 3V8WA 3DS6A 3ZZWA 4AE6A 3QQUA 4AUQC 2I6LA 3CD8A 3UOHA 3BGQA 3R7OA 1GNUA 4BB4A 4K81A 3W1YA 1GJZA 3KB7A 3PVGA 3WF9A 1GOLA 4AT5A 4Z7GA 2ITOA 1Q0WB 2C69A 1BKXA 4S30A 4MHAA 2R3NA 3HMNA 4FZAB 3GGFA 2QO2A 5AR2A 3DZQA 2BDFA 2GNFA 4CFFA 1K8RB 3ORLA 2J0MA 3HGKA 3R6XA 3SHQA 5JN2A 4TY1A 3FZSA 1WGRA 3F2NA 2R3HA 3DCVA 1P5EA 5CI7A 5BVWA 1V0PA 4I6PA 3KULB 5B7VA 4LDTD 4HW7A 5FTQA 4ENXA 3L8XA 4K11A 1Q3DA 3GQLA 4AW2A 4OAVB 4AUAA 4EH2A 3IDBA 4UEUA 3QWZB 4IFCA 3SRVB 2BRBA 1TVOA 4HVBA 5M4UA 3ZFXA 2G1TA 2XCKA 3COKA 3UIXA 3ZFMA 2VGOA 3KXXA 2JZZA 5CXZA 2FCSA 1H1SA 3K2LA 4U8ZA 3QZHA 3ORNA 4FTRA 4S2ZA 3RMFA 5J2RA 3MH0A 3Q3BA 4U42A 2XK6A 4NK9A 4PV0A 4CFWA 1NW1A 4EHGA 5LXMA 4UMRA 4BR3A 4OTPA 4YC6A 3EECA 1ISNA 4QMYA 4BL1A 2NBWB 2KDFB 1OMWA 4B9KA 4BVUA 2CSNA 4KD1A 2W1IA 2QG5A 4QMLA 2V55A 3VUYA 4FV3A 3DJ6A 4V05A 2IZUA 3AC8A 5AV1A 3P0MA 4Q5HA 4TUUA 4EKLA 1T46A 3UO4A 3K54A 3DBFA 3ZONA 1KE7A 3GU7A 4JL9A 4WNOA 3QA0A 4XV2A 4MEMA 3ULZA 3VJNA 4OBOA 2F49A 4FJYA 5J7HA 3BGZA 4WKQA 3UQFA 4MXCA 5FQDC 4XS2A 4GUBA 2NPTB 3EQBA 4UZHA 3B2TA 4PRJA 2YCFA 4IX6A 4TYJA 1WGHA 5HU9A 4ZSEA 3S00A 4HXDA 3NRMA 5HLWA 3PLAE 4O7TA 4RIWB 5DT4A 4F9YA 2XK9A 3R7RA 1OQYA 3JPVA 5AAGA 1R4MI 4B0GA 4B6WA 2KFKB 1PXJA 3QAME 5K0KA 2B9IA 4GSBA 2XIZA 4JRNA 4FSMA 3VBWA 4DYMA 4GK3A 4ACMA 1WJUA 2OKRA 2VNWA 1JQHA 2R0UA 4RMZA 4F7SA 4LI5A 1VZOA 2H8HA 4R7BA 4C36A 1ZKHA 3FE3A 4G0NB 1G5SA 3O65B 5KMNA 4F0FA 1DI9A 1ZMWA 3R1YA 3QIJA 1YX5B 2WDTB 1BX6A 5FBOA 2WTCA 3C7QA 3RZFA 1FOTA 5BUEA 2VTHA 2WIHA 5ACBC 4C3RA 3I0OA 2DAFA 4J8NA 4DLJA 3WZEA 2X9EA 3H0ZA 4EUTA 5K9IA 3H4JA 1OKYA 2PE1A 3DVNV 1WJ4A 1CM8A 3O7LD 3FYKX 4L9IA 3BPRA 3KULA 2DZIA 3D14A 1MUOA 3AD4A 2I0HA 4NM7A 5K3YA 3H9RA 1WR1A 2Q83A 4ASDA 4FG7A 4C4JA 4ZLYA 4W9KA 3ZDIA 2QD9A 3UIOB 5AV3A 4JG8A 2ZJDA 5JQ5A 4PTEA 3QKKA 4BBNF 1P0RA 4JDIA 2ONLA 4OTFA 5JFSA 1V49A 2HZ0A 2XIRA 2LRUA 5EQPA 1QMZA 3H10A 2OU7A 3PPAA 3G2FA 4RVMA 4YL8A 4P2KA 1ZZLA 2QKWB 4EFOA 3ZDMC 2BVAA 1U5RA 1WE6A 3V5QA 4NYEA 4EK4A 2XM8A 3NZ0A 4HCTA 3OWJA 3BEGA 2GTNA 3GCUA 4W9CA 3E8NA 4ZP5A 5IQFA 1YWNA 4O7NA 4XJ0A 2IVSA 3Q4TA 3ENEA 4BKYA 4YLLA 3MGYA 2ZDTA 4XBRA 4XLVA 1QPJA 4HLEA 4KRDA 1H24A 3DAJA 4F4PA 1F5QA 4FGBA 4QMNA 2R4BA 1RJBA 4FIIA 4ITHA 4C8BA 4I5PA 2GFSA 2QO9A 2BIKB 5M56A 4DE4A 3PG1A 5I5ZA 3H6NA 4RX5A 2WTJA 4EEWA 2XMYA 4FLHA 4IH8A 2YM4A 4MEDA 2CPKE 3R30A 3B8QA 2D2QA 2BZKB 4N57A 3DFAA 3QHTA 2C68A 3QUPA 2Y6OA 3VJOA 2VRRB 3BX5A 2XUUA 1B39A 5HICA 4RMAA 2N7EA 2XYNA 4RJ5A 4QYEA 4QPAA 3EQDA 3QAQA 3P79A 5L6WL 2ZVNA 3BE2A 4LFIA 5ITAA 1C1YB 4FNXA 3ORTA 4RIWA 1PXLA 3G0EA 2PVFA 2R2PA 1KUTA 4EZ3A 2MLBA 2AWTA 2YAKA 3IG7A 2WYQA 1GY3A 4FICA 4YTFA 3OW4A 4Q5EA 2UZOA 3W1SC 1E8ZA 2NCNA 3LVPA 3PVWA 2CNVA 3OD6X 5EI2A 1OKVA 5M51A 2FUMA 1XH9A 5CF4A 5LWNA 4LRJA 3JY0A 3KMUA 4WBBB 4RC4A 2FCNA 3FL5A 2GSFA 3OTUA 2O6VA 5J1WA 3KREA 3OTVA 3MFSA 4WD5A 1WY8A 3SOAA 2UZDA 3HRBA 4C7TA 4DFZE 5JZEB 5C4LA 3H7PA 5HQ0A 2QODA 2BCJA 3OHTA 1G8AA 4ANMA 3TL5A 4FMQA 3P4KA 5JKGA 5HIBA 2REIA 3CQEA 3DXQA 3LFFA 4MX9A 2BAQA 4MH0E 4YJTA 5CU0A 1MG8A 4XNEA 4ZSGA 3MVLA 3QRIA 4YPSA 3ZLSA 2CS4A 1A48A 1WBTA 5A6OA 3ATTA 2WMXA 1MRUA 2ZEQA 1WJNA 4BI1A 3PZHA 4MBJA 2UV2A 5E92A 3V8TA 1GIHA 3K9OB 3TJDA 2LRWA 4CLIA 2RPQA 2QR7A 2PVLA 2HXLA 3QCQA 2R7BA 4I94A 3KL8A 4GSWA 3PIZA 3DQXA 2G2FA 1PKGA 5EYCA 2PPHA 4O6LA 3DK3A 2BDJA 2H96A 1K3AA 2MA9B 1OIRA 3M42A 2JD5A 4F9BA 3IGGA 2X8IA 4EH8A 3BWFA 4WG3A 2FSTX 2XBJA 3DKFA 2GS7A 4O7WA 4LMUA 4B7TA 5ETCA 2NNWB 5AEKB 1P9DU 3CY3A 4EI4A 3S95A 4CKIA 5ANEA 4BGHA 5T3QA 4JBPA 3LXKA 2C5OA 1WM3A 2FH9A 1V80A 2OH0E 3EC8A 5ETFA 4KDLB 2JDVA 3A4PA 2BYFA 1OM1A 3DGKA 4ACCA 2Y4IC 2V1YA 3G33A 3ELJA 3GCSA 2M0XA 3WZJA 2EB2A 1JLUE 1GNGA 1ZAOA 2N9EB 3FI8A 2W1ZA 4KRCA 2IZRA 4LGGA 4EH3A 3FYJX 4QP9A 2QG7A 4PMTA 2GBRA 4KSQA 3DK7A 4JAIA 5F95A 5IUGA 5KNJA 5KO1A 1XR1A 4U40A 2KQSA 4NJ7A 2D3GA 3CPCA 4G3EA 3D7TB 4TNBA 3OWLA 3CTHA 3G0FA 1G6JA 2M1MA 4BVUC 2I0YA 2KTRB 1JAMA 5BPYA 3ZRFA 4J8MA 4I3ZA 4MGIE 4DITA 4AX8A 4D2TA 3TDVA 4UMPA 1NVQA 3KKVA 2E9UA 3O2MA 4QPMA 3RPRA 5DGZA 1J19A 3LZBA 5AR3A 5HO6A 4NJ6A 3OJ4B 4FL3A 1WMHB 1DAWA 2BDWA 4GU9A 3OT8A 4XCUA 3ZRCA 4KS7A 1YOLA 4DC2A 3ANRA 2XF0A 3LW0A 3LQ3A 1HCLA 2K8BA 1UU3A 5EI8A 4ANOA 3ACKA 4BDDA 4YHTA 3KY2A 1R3CA 3ZXZA 3LMHA 4F1SA 4QOXA 3EYHA 3NLBA 2ITNA 2YM6A 5H8EA 4MXOA 2UVYA 5EM5A 3W2CA 5FTOA 5FEEA 2JKOA 3LXNA 4U80A 5AFVA 5C27A 2YEXA 1MQBA 3NWWA 5BYZA 5FM2A 1X8BA 3D94A 4URKA 1S1QB 3PRPB 4M8TA 5CWZA 2JFMA 3C13A 3HAVA 2M17A 4WJPA 3E5AA 4FL2A 3CC6A 2HZ4A 4JQ7A 3KQ7A 4F65A 3UC3A 1STCE 3JUHA 1CKIA 4TPTA 3PY1A 3GENA 2EB3A 3UTOA 4FYNA 3RINA 4RIXA 1REKA 2CKHB 5J95A 1L8TA 3BU3A 2LASA 3GC0A 2UZEA 1FVRA 3C4EA 4IB5A 2QVSE 1KJTA 4TQ1A 4G3XB 4N6YA 1YX6B 4IADA 4JGHB 4FHKA 3QX2A 4C61A 1RQQA 1K9AA 5HBHA 2ONLC 5BMMA 5L2SA 2P3GX 4JIKA 1V0OA 1ZMUA 5D7GA 3FZPA 3RPYA 3VQIA 3BYMA 4WSQA 3UIMA 4V0GA 4FKOA 4EK6A 1O9UA 1OITA 4C4IA 4USFA 2QCSA 2WQNA 4WRSA 3VH4B 4S32A 4L68A 5IDNA 4JX3A 4Y73A 4L67A 3RPSA 3QD3A 3MB6A 1Q8TA 4PWNA 3D7TA 2CN8A 5J1VA 2BMCA 2VNYA 1PXMA 1WZYA 2WTKB 3WYXA 1EF1A 3PP0A 3ZC6A 3CTJA 3TEIA 4TL0A 3OCTA 4FBJB 3W8LA 4YLJA 2PULA 2MP2B 3I7BA 4ZTLA 4IJ9A 2PMIA 4A3PA 4HCNB 5GJGA 4FV4A 3RWPA 4ACDA 4L52A 2EXMA 2FYSA 4P4CA 5AV4A 5E6NA 3GB2A 3Q4CA 3IK3A 2XZSA 3VS2A 3FXXA 1HOWA 3QZIA 3PS6A 4J52A 3BHYA 2I1JA 2W5BA 4DGLC 3D32A 3OUNB 2ZAZA 5HHWA 3PTFC 4IM2A 4FG8A 4WJOA 1E7UA 3A8XA 1XH5A 1E5WA 1KOTA 4FEXA 4I6QA 3PIXA 4ALVA 4K7WA 1U54B 1WM2A 3RCDA 3RD2A 4NTTA 2XNMA 2VWXA 2ACXA 5FRIA 4EJNA 4Z55A 4F64A 4DEBA 3OWPA 3DBSA 5DOSA 3KK8A 1M94A 2OJGA 3L0WB 4KB8A 3BQCA 5IQIA 4DEAA 4II2B 5IA2A 1XT9B 2ETRA 4BKGA 3Q3JA 4EOKA 4YNOA 4FHJA 3T3VA 4J53A 4YJNA 4FC0A 1GZOA 4U45A 4KBKA 4M0WB 4EZ7A 4U81A 3KN5A 3COIA 2BFXA 4GKIA 4C0TA 4RBLA 4FV7A 3HMPA 2BZJA 3QTQA 3F3VA 1J7IA 3ZUUA 5KCVA 2VO7A 2PVKA 3EN9A 3A9KA 3BWJA 4W9FA 3Q4UA 3IW4A 1NXKA 4D9TA 3L9PA 2XRUA 4DHJB 1W82A 2R3OA 4Z9LA 4GW8A 3PRFA 3DKCA 4D2RA 4FL1A 2CHXA 2ERZE 1UWHA 5KE0A 3R1NA 4CTCA 3FLQA 3VW6A 3DLSA 3FLNC 4L53A 3R8ZA 3MY0A 5CENA 2N1WA 3R21A 4K8AA 4PS3A 2R3JA 4QP1A 1M7NA 5E8WA 4CKJA 3FC2A 2VTLA 3VULA 4HDQA 4FIEA 2L7RA 1PKDA 2YIQA 4EK3A 3HECA 4GFOA 1ZRZA 4X21A 2VUWA 2UW5A 4BWPA 4PL3A 1WGDA 4RLKA 5DPWA 3NAXA 2LGYA 3RUIB 3KVFB 4E8AA 3VUMA 2UW0A 4FKQA 3ZO2A 3E3PA 5L95C 2PVNA 2XA4A 3MVMA 1OPJA 3KU2A 3QGWA 2QOBA 3OXTA 3UQCA 1JOWB 3SA0A 5EHYA 3U9NA 4BF2A 4JLCA 4NM3A 2PEAA 1UKIA 2JC6A 3KUDB 4LL0A 1YIWA 4I24A 2GQSA 1LEWA 5DMZA 5CAPA 4BC6A 1LUFA 4DH8A 4ITIA 3AU4A 4PMMA 1IEPA 3IOKA 4TYEA 4E26A 2UZTA 4UN0C 4OT6A 2N9PC 2ZJWA 4TQ0A 3FWQA 4I1ZA 1KE8A 3PPZA 3DCGA 2W1CA 3W2SA 4ONAA 3R7EA 3HMOA 4AOTA 4GYGA 4QQ5A 5H8GA 1PXIA 4DGNA 4F08A 3Q60A 3KGAA 2QU6A 3SAYA 3PY3A 3R63A 4AU8A 4FV1A 4PDPA 1Y6AA 1H27A 1I42A 1WIAA 3CXWA 4W4WA 2CGWA 4AGCA 5DRBA 4GJ3A 4BDCA 2FGIA 4WA9A 3EKNA 3VF8A 1PRYA 4EQMA 4DFLA 2WTDA 2PUIA 1PMUA 1SNUA 2L0TA 4JDHA 3HEGA 3PE2A 3GFEA 4D2PA 4GU2A 4R5SA 1W8CA 2QNJA 4PYUA 3UIUA 3TJCA 5A46A 4XHKB 2KXJA 2XKDA 5JT2A 5J9ZA 3L17A 1LFDA 4BDGA 3QL8A 4FKPA 2PZRA 2UW4A 4RVLA 4EWHA 3FSKA 5AR8A 5HU3A 5AR4A 5BUJA 5IU2A 3PPKA 5E6PA 4FEQA 4P90A 5HG9A 3II5A 3ZH8A 2X4ZA 2NRUA 2LZ6A 3SG8A 5EG3A 4AOFA 1M52A 4KV2A 1OL1A 3ACJA 3Q4ZA 4I0TA 5E90A 3DVGY 4LV5A 2R7IA 2MBEA 3IS5A 3VUDA 1QPDA 3W2OA 3EQFA 3CLYA 3R7QA 4DAWA 2DYOA 5CX9A 2Z59B 3ALOA 3RYTA 4N70A 1LR4A 4FN2A 4FZFB 4HYHA 3MA3A 4IVDA 4JX7A 2R3PA 4K77A 3LFAA 3W10A 3AT3A 2RD0A 4MXAA 1WXMA 2VX3A 3A7FA 3POZA 2KFJA 3SKCA 1GC6A 4MQ1A 3GCPA 3A7JA 2LVPA 4ZSJA 3OFMA 2QOKA 1ZYLA 4P5QA 5L6OA 3COMA 3CJGA 1KE9A 5HTBA 1D3ZA 4YC8A 4HGEA 3EQRA 4UBAA 5B0XA 3APFA 4CZUA 4W8DA 5ACKA 5CTRC 3MWUA 4FTTA 5D2MB 4G31A 4QO9A 3IPHA 4CLJA 2N9XA 4O21A 3UIPB 1V6EA 3TUBA 3I79A 3D0EA 5IH5A 4IE9A 4WUNA 3PVBA 4XRLA 4LG4A 4FTAA 4WO5A 3UQBA 3R7UA 2ITVA 4IIRA 2PUUA 4MWHA 3WOWA 5FGKA 3N4VA 2Y7JA 1YXSA 4YJPA 4NJDA 2F7EE 2B1PA 1LQBA 3QHRA 4QQJA 5DR2A 4E5BA 1XQQA 2VGPA 4OTIA 4EOSA 3G90X 3OOGA 2W9FB 4FIHA 4DA5A 2ERKA 4GDKB 4CGAA 1H4RA 2J90A 1EUVB 5E9EA 4O0XA 2OK1A 2GBKA 3MBLA 2CR5A 1ZOEA 2J7TA 3UC4A 3SX9A 4MJSB 3I6UA 3TIZA 5DG5A 2PVMA 3U4UA 4DT9A 5IA4A 5L2WA 3DK6A 5CEMA 1RE8A 3D5VA 1T0YA 2CGVA 4XP2A 2BKFA 4IZ7A 3SW7A 2OZAB 5F20A 4DF3A 2J9MA 3BV2A 4PNIA 3DLZA 3Q2JA 4R8QA 4RJ8A 3N4UA 2BZIB 4M69A 4F70A 3LFDA 5IH6A 2Z7QA 3KVWA 4AN3A 3LAUA 4Y85A 4ACGA 3ONSA 1PXPA 3ZBXA 3HRCA 3IFWB 4QP8A 2UZLA 1P14A 2WFYA 5AUWA 3PFQA 1LEZA 2JPHA 3FMKA 4DEGA 4TWNA 1ZMVA 4QMQA 5JZJA 5M08A 4AGWA 4X3FB 2SRCA 4I23A 4FNZA 3NNUA 1Y91A 2XNGA 2IVUA 2KWVB 5B2LA 2BWES 3NPCA 1Q97A 2GQGA 2XEZA 2R3IA 4MK0A 5AP4A 4QNYA 3MPTA 5HOAA 2BGFA 2IO1B 3QGYA 5EYMA 4RIOA 3QARA 4WSYA 3VFKA 2W0JA 5KUPA 5HLPA 2YIYA 3CF6E 2WPAA 2LGDA 3KXNA 4KWPA 1GG3A 4APCA 2XNPA 5IQBA 4ANSA 5HCYA 3O23A 4PY1A 4FT3A 2QURA 2J7QB 4FR4A 2PUNA 4EKKA 5IUHA 4APPA 3OWKA 2R3LA 3OP5A 3U4WA 3RBWA 3RT3B 4EK8A 3WALA 3ZSGA 2O2VA 5DIAA 4U44A 2L0FA 3JS2A 3P7AA 1OPKA 4TYHB 4FIGA 3BV3A 3UP7A 4J98A 3F69A 3ZVVA 3AMYA 3JW0X 3ITZA 3ZOSA 4U6RA 3TACA 3TUCA 4XZ4A 3FI4A 4R7HA 3GZNI 1J1BA 3UNZA 3KFAA 5D7VA 4I20A 3OCSA 4EEVA 4YO6A 4X2FA 3PSEB 3AT4A 3HYHA 3KCFA 4HOKA 4E5WA 3A9JB 2XIYA 2QQ7A 4ZZOA 4HNFA 2IW9A 3F5UA 4QP6A 4CT2A 1ZYDA 3GI3A 3JY9A 2DWBA 2O8YA 4QYGA 3U51A 5JEBA 2UVXA 3U54A 1Q5WB 2Z60A 2YM8A 1OEYJ 2ZM1A 1CDKA 4AJWA 4W9LA 2G9XA 3ZNID 1IASA 3EQPA 1WVXA 1ERKA 2J5EA 1B6CB 3EFJA 1URCA 3M1SA 1E7VA 2CCHA 4GKHA 3LCSA 3HK0A 3QRJA 4YZNA 4FV2A 3NZSA 1NBFC 2I40A 2OXDA 2E9PA 5A4TA 2RGFA 5HE2A 4KKEA 2BWFA 4JIOU 5AA9A 3HRFA 4OTRA 4TKSA 5LXIB 3RHXA 3QC9A 5I9WA 3RPOA 1P2AA 1WGYA 1MRVA 3FUPA 3VUGA 2K6DB 3R7IA 2BTSA 3BI6A 1O6YA 2BR1A 4L3PA 3QQGA 5DVRA 4NWMA 5AX3A 2ZOQA 3JVRA 5CHFA 3EQCA 5KBRA 3E7VA 3HDMA 3R1SA 2X7FA 3SDJA 2IY1B 4PPBA 4E1ZA 3H1UA 2XH5A 4O22A 2YDJA 1AARA 2W1GA 5DN3A 4MBIA 2ETMA 4GK4A 2B0QA 3FEGA 4QMUA 4G3CA 3RNYA 2RSVA 5CVGA 3PZEA 4O91A 3DBLI 4HVSA 2IN6A 4XV3A 3VHEA 5M53A 2WMAA 4B9DA 2IVTA 3ATSA 2AEHA 3DKGA 3MHSD 1MQ4A 5CALA 1LP4A 1Y57A 4ZOGA 3UJGA 1BI7A 3DY7A 3K5VA 4MWIA 4I4EA 5HIEA 2L8JA 2QOCA 3R8VA 3S2PA 2FAZA 4IACA 2MWSB 3A1QB 4JQ8A 4FTLA 1J7UA 4HCVA 4U43A 2W4OA 1WE7A 4IC7B 4NUSA 3TG1A 2JRHA 5L2TA 3C50A 1E90A 3V5LA 4FKSA 2QOQA 4N9F4 4JG6A 3T8OA 3W33A 4CO7A 3F61A 3KUZA 5CU6A 4CTBA 3EWHA 3I60A 4GS6A 5CF8A 3WILA 3NVKI 4RFYA 5M4CA 2A19B 2KD0A 5C4KA 3TT0A 3Q2MA 4JJRA 2I1MA 4F6WA 4TYHA 3WZUA 2PYWA 4YHFA 4DH1A 3PUPA 4PQNA 3ZU7A 4H58A 2YISA 4IAKA 4C58A 4AF3A 1VEBA 3VHKA 4JAJA 3ETAA 5DT0A 2KN5A 1L2NA 2VWYA 2O63A 3LFSA 2C6IA 3R04A 1H25A 2O5KA 4BGQA 2OBJA 4KSPA 5DLSA 2FB8A 5L2QA 4DBXA 5AZFA 1FQ1B 3KXMA 2EXCX 5KBQA 4H36A 4BFMA 3FC1X 5AAEA 4KNBA 5D1JA 3VBXA 4ZS0A 4FSNA 3PLSA 1ZOGA 4BRXA 3MSSA 5IQDA 3O7LB 3NW7A 2KWUB 4MSQB 2QKRA 4E4MA 3QUEA 1JPAA 3C4XA 3VS3A 1IA9A 3ZLXA 4O0VA 3ZS5A 3EOCA 1A5RA 5AP3A 5AP2A 2XBBC 3KMWA 4ACHA 4BWXA 4R3RA 4I0RA 1WAKA 2V0DA 3K5UA 4RX9A 4J99A 3MTFA 5CEOA 2OF2A 3I3TB 5DWRA 4BKSD 4YTIA 2B52A 3WANA 1JNKA 4F6UA 3KA0A 5CZHA 3A33B 4I0SA 4B4LA 1OBGA 1OIUA 2ZM4A 2AL6A 3E8EA 5FEQA 3RK7A 4PL4A 4CYJA 3DXPA 2X8DA 4USDA 1X1MA 4U7ZA 4L00A 4M97A 1OUKA 4UYNA 2XIKA 2BYEA 4OUCA 2KMAA 2HE7A 3EYGA 3LQ5A 3IW6A 2W99B 3CBLA 4O6EA 3OXIA 3JR1A 3DB6A 3KF4A 3G9LX 3NUXA 1WX9A 3WF5A 3A4OX 5JHBA 3A4RA 4BFRA 4OR5A 1G8SA 1ZZ2A 4FA2A 3MH1A 4MCVA 1YWRA 4RG0A 3A61A 2XK4A 2HJ8A 4C33A 2MBOA 3OLMD 2AL3A 2A4ZA 2C6DA 4ZEGA 3TMPB 4OVVA 3PVUA 3FI3A 4TXCA 3R83A 3NUSA 3EN5A 3QQLA 1IP9A 4TT7A 3OG7A 1PMNA 2HELA 4RC3A 4J1RA 4RGJA 2YLFA 4XH6A 5EKOA 1EH4A 4A4LA 2VWBA 2C47A 1PMVA 3N3KB 1YHSA 5GZ8A 4CT1A 2IZSA 4FT9A 2DZMA 4AZWA 4XOYA 1SVGA 1KOAA 4JQEA 2XBAA 4X2NA 3ZO4A 3GQIA 4ZJIA 2FIFA 5GINE 3ZO1A 4AACA 5JGAA 3AQVA 3TM0A 3KCKA 4QRCA 1ZLTA 2BZHB 5FXQA 2Z7LA 3DOGA 4EOOA 3FZRA 3RZWC 2VU3A 2WMTA 4GJ2A 4QMOA 3PIYA 3FMHA 2XJ2A 1BUHA 4EH9A 2QI8A 5AM6A 5CQUA 5IG1A 1YDRE 3Q5IA 3WAMA 5DEYA 4IAYA 3NYOA 4M8NA 4Q9ZA 3FPMA 3MJ2A 3R9OA 4XG8A 3I7CA 2WZJA 4AOIA 2K6QA 3CSTA 3V8SA 4FG9A 2HW7A 5CT0A 2QHOA 2BROA 5DCNA 4GN1A 4A7CA 4E74A 5AP5A 3SLSA 2I1KA 2JDSA 2RG6A 4DHZE 3RTPA 2WEVA 4FTQA 4U41A 2B53A 4L3JA 3OT3A 5HE1A 2LVQA 3HHMA 3P9JA 2WO6A 4M0YA 3NUNA 2G3QB 5DI1A 4RM9A 1SGHA 5H3QA 4QQTA 4GV1A 5HESA 5E8SA 2XJ0A 4W9XA 4G5JA 2MSED 3BINA 3MTLA 3CTQA 3CEKA 5BQ0A 2ETKA 3HDNA 4V01A 2X7GA 2EMSA 4ID7A 3Q96A 4LV8A 2VTNA 2OLCA 3U6JA 2YM5A 5AV0A 3UMWA 4JOAA 5ICPA 5L4QA 2ASQA 2WGJA 5KHQA 2WAJA 3D4QA 3E88A 1O6KA 2KKCA 4Q2AA 4D0WA 3H9OA 2LWPA 4BDEA 3VW8A 5KX8A 3APCA 4FTOA 2X2LA 5LVMA 4XP0A 3ZFYA 1F9JA 3S4QA 1E1XA 4L3LA 4L46A 4DH3A 4K7SA 4FVPA 3LJ2A 4Y5HA 4C37A 3FAAA 3IDCA 1Q62A 2YM7A 3CCNA 4BDIA 3WZKA 5AM7A 3RM6A 4ANNA 4BKJA 4BTFA 3V6CB 4MBLA 3IW5A 2GNHA 3HA6A 3LJ0A 4GCJA 1KM7A 2F9GA 1F0QA 3GUBA 1R78A 4E6AA 2UW6A 4FUYA 3PA5A 4ORKA 3EZRA 4XOZA 5TKDA 2BKRB 4NNJB 5TT7A 4IWQA 5CEIA 5LVNA 3PSCA 4UV0A 4CFXA 3V62A 3PWYA 4G9RA 4FUXA 2CDZA 3SOCA 3DQWA 4EOIA 1M14A 3TXOA 2B9JA 3PE1A 4O0TA 1OL2A 1SIFA 4HZRA 3L9LA 4BI0A 3QALE 4JIAA 1YI3A 3EMGA 4C4FA 2FCQA 3BYOA 5EOBA 4YU2A 3LPBA 4DK5A 3EL7A 2JGZA 2V5QA 4QMXA 3U6HA 4C2WA 5M06A 5A4EA 5J18A 2MBHA 4MKCA 4CFVA 3G15A 1YWVA 4AT4A 4PMPA 5FEDA 5FXSA 3HV4A 4DTKA 3VUXA 4FTKA 5HG7A 4ZY6A 1PW2A 5EW9A 2ZV8A 2IO0B 3SW4A 3MTNB 3K9PB 5M44A 2V7OA 3PGEA 1J1CA 4O0WA 4EBWA 4FT0A 3VTUA 1IG1A 2ZMDA 2HWOA 1OL7A 4FTJA 3V5PA 1RRBA 4WAAA 2CLQA 3AC2A 5CSPA 3F7ZA 4O86A 4BICA 3Q53A 4BOZB 1SVHA 3U9CA 3R2YA 5CS6A 4A9TA 4DLIA 3L1SA 1TQMA 3ZNGC 3NOBA 1OIYA 2BRNA 1JRUA 3TTJA 5C23A 2VO6A 4BIBA 4EWQA 2QOIA 3QCAA 4LGDA 5FLFA 3ZC5A 5A3XA 3VS0A 5CF6A 3TI1A 2CHWA 2RF9A 1QPCA 2CHLA 3E62A 2WX1A 3NNXA 3CGOA 4TYIA 4O1OA 2VTTA 3G5DA 2YCQA 2Y4PA 1V9JA 4DG3E 2EWAA 3A7IA 1WFYA 5E91A 3KXZA 3IW8A 3R73A 4H1MA 3KF7A 3UVRA 4FYOA 2GMXA 4BZOA 3VIDA 1KE6A 3ZRMA 5HORA 2ZCBA 5HTCA 1LPUA 2QONA 2WELA 2BRMA 3DKOA 3CSVA 2HIWA 4KKHA 3L13A 4NIFB 3C9WA 3UGCA 3KN6A 1PXOA 5IA7A 4HGSA 4YSMA 4M7IA 2DENB 5TOZA 3BBWA 1PYXA 5BYLA 4AP4C 3JSVA 3DNDA 4M3QA 1REJA 4A4OA 3F3TA 1FMKA 1YRPA 2C7NB 2FCMA 4JVGA 4MYGA 4Y83A 3GU4A 4HYUA 4ASXA 2W4JA 5C01A 1XO2B 2D11A 1H26A 5HX8A 4GDLB 3N30A 2VWWA 2L05A 4BGGA 2PU8A 4EORA 3OMVA 4KKGA 4EQCA 2XRWA 3R7YA 3PHXB 5FD2A 4X2GA 3ZKJC 4EC8A 5CSWA 1R0EA 3OW3A 3NYVA 3P78A 5AJQA 3SC1A 1AGWA 3TDWA 3FPQA 3OZ6A 3NZUA 2JF5A 2WMVA 4OGRA 3R0TA 2OIBA 3VDZA 4MNEB 4DBGA 1IAJA 4G5PA 3QRTA 1YXTA 2M4NA 2LI5A 5F94A 5DEWA 4FJZA 5JGBA 3QD4A 1MRYA 5FXRA 1UELA 1K2PA 4PMSA 2GNLA 5CHWA 4YTHA 4IVBA 3DNEA 1CKJA 5M09A 4ZMEA 4LUEA 2R5TA 4AW5A 2C3LA 2J0LA 2EU9A 3B8RA 3VBVA 4KZ0A 1H00A 4DHFA 5HG8A 1H1QA 2YITA 4C34A 5AA8A 3M63B 3VNTA 2IJMA 2PZIA 1YXVA 5F1ZA 5HNGA 2YDIA 2CLXA 5AIKA 1VCBA 3FLZA 5CVFA 1XKKA 3VS7A 2PE9A 3W8QA 4ZSAA 1U59A 2C5LC 3NUPA 4ZDVA 2YJSA 4AA5A 3BHTA 4MVFA 5CNNA 4GOCA 3ZO5B 2IWIA 3AC3A 2OFUA 3RWQA 4ICVA 5KKRC 2LJ5A 3AC1A 4YHJA 4UALA 2XS0A 2CCIA 4IUMB 3OUKA 5KMIA 2XEWA 3O17A 3FY2A 2XYUA 2IO2B 2W1FA 4F1MA 2A2AA 2PVYA 3EN4A 2I7QA 3BGPA 2OOBB 4K9YA 4O0YA 4EZKA 4BBMA 3L08A 4IVCA 4ANBA 2I0EA 2F7ZE 1LM8B 3MW1A 4D2WA 3TV4A 2V62A 3QBNA 3EFWA 4M0ZA 4G2FA 3Q32A 4MGYE 3ORPA 3ZDUA 1S9JA 3ID6C 1UKHA 2E9VA 4DWFA 3APDA 3BYUA 2UW8A 1UVRA 4TYGA 3Q5ZA 2XKEA 3JYUA 5EYKA 2C6EA 3FZOA 4CSVA 1UH6A 3TKHA 2KX3A 4ZY4A 3CQUA 1CMKE 4U5JA 3OC1A 3SRVA 1Q61A 1WX7A 1SYKA 3CR0A 2XK5B 4FEWA 3V6EB 3CY2A 1P4OA 3A4SC 4ANVA 4R77A 3PWDA 4LUDA 4NU1A 4CZTA 2LUEA 4ZTNA 4I6HA 2ZNVC 3FMDA 4NAWB 2WQOA 3HP5A 4GIIA 4YZCA 4RZWA 4ZK5A 2HW6A 4U3YA 3G6HA 2DS1A 4JRVA 4TKNA 4FA6A 4LOPA 3R22A 5EHLA 4A4XA 1ZW7A 5GJDA 1WF9A 3UZPA 1FMOE 3PDTA 2WX0A 3QQHA 4FADA 4HVDA 1JBPE 3QTIA 2HK5A 3MS9A 3DBDA 4A20A 3LXLA 3UP2A 3DDPA 4LMNA 2IPXA 4FSTA 3A2CA 3UOKA 4DHJD 1V5OA 4F9WA 3ZM9A 5HGIA 1R0PA 4O27B 3TKIA 3DFCB 3GCQA 3V3VA 3LIJA 3PSDA 1Y8YA 5HVJA 4MNEA 2LD9A 2CKOA 4CVAA 3NCZA 3QC8B 2N4FA 1WH3A 4BCHA 2NRYA 2GFCA 3ZUNA 4RJ6A 1OKZA 4JBOA 3UDBA 4WWOA 3UYTA 5D6JB 5KMMA 2NPTA 2C1AA 2ZV7A 3LCOA 3RJCA 5LVOA 4WNMA 5M4IA 5C9CA 1OIQA 4MELA 4BKSA 3LQ8A 4DGGA 2X7OA 1WXAA 3C5UA 5ANIA 3NAYA 3VS1A 4QQCA 1YDSE 3EJ1A 4UXQA 2KFKA 4D4SA 4JI9A 4K33A 3H9DA 1J91A 5FWKK 4JBQA 4TNDA 5K5NA 5KMJA 3EFLA 4L44A 4AWIA 3D2IA 5CEKA 4KIQA 4BDKA 4BWKA 2VWUA 4DH5A 2W9NA 1R4NI 4AN9A 5I9XA 3VUTA 3SD5A 3DJ5A 4DN5A 3MVHA 4S34A 4KSLC 1KLVA 3MPMA 3QYZA 3NEWA 5ANOA 4PP9A 4O83A 1GIJA 3NYNA 2Z7RA 2MCNB 3ALBA 2KLCA 3FMLA 4KAOA 2QOHA 5I9UA 5HI2A 2Y9QA 2JBPA 1UU8A 2BKZA 5I3OA 4O7ZA 4KZCA 3UQGA 4Y95A 3RNIA 3ZDTA 3D5UA 1Z5MA 2RFEA 4FZDB 4FE2A 5J87A 2YLMA 5JFXA 4IB0A 4G6LA 1JWHA 1JSTA 2D10A 1WX8A 1UD7A 4AOJA 3KW5B 2X81A 3PLUA 5M57A 1XH7A 3LFQA 3UO6A 4RIYB 3MY5A 4PP7A 5EDSA 3FZTA 4DT8A 2UVZA 4TV3A 3QLGA 3GT8A 4GL9A 4CFMA 1I09A 4MAOA 4Y5QA 2W7XA 4ZXTA 4E4LA 3UYSA 4MH7A 1Q41A 2IZVB 1PJKA 5GNKA 4I22A 3IG3A 3PRZA 4XC2A 4EOPA 2GS2A 4AS0A 3QHWA 4L7SA 1ZYSA 2V7AA 1TTNA 4W4VA 2UYZB 3DBEA 4MM3A 5LMAA 2GBJA 4R1VA 4UMUA 4ZY5A 2GPHA 4EONA 4EZJA 3PHWB 3ZCLA 3S1HA 3SG9A 1W84A 2JUOA 4TWOA 2W06A 3G6GA 5DR9A 5FR6A 4PL5A 3C4CA 2RGPA 3DPKA 5I3RA 3MYGA 2O65A 3VRYA 5E1SA 2ZB1A 1HCKA 3VWAA 4BHZA 4FNWA 3OF0A 4OVUA 1PQSA 4M67A 5LLIA 2YWVA 1RW8A 4LJOB 3ODZX 3PJCA 1P1AA 3HV5A 2Q0BA 4WWPA 4G1WA 4FOCA 5C1ZA 3LFEA 4OTGA 3WF6A 4OT5A 2VZ6A 3KUCB 5C8KA 3NMUF 1WYWB 5JMSA 3GCVA 4AZSA 1V1KA 3V5TA 5C1QB 4F7ZA 5CAOA 2C5YA 4O96A 4C2VA 2DYLA 4AFEA 1H01A 5CU2A 3E8CA 3EL8A 2OXXA 3UOLA 2O3PA 2CJMA 4QPSA 3Q9XA 2NPQA 3KRRA 3P08A 4ANLA 2Y5BB 2RIOA 4FGRA 2KLGA 5CAQA 2A5UA 3DTCA 3UF8A 3QD0A 3HUCA 3BQRA 2C6KA 2OWBA 1WJ6A 4XG3A 1UNGA 5G55A 1ZY4A 3Q9WA 3TV6A 1YQBA 4L45A 2X2MA 4JQWC 2HWPA 5A4QA 3TCAA 4DGOA 4BBFA 3RZBA 2WD1A 3V60A 3W2PA 4C62A 3QTUA 2ZPYA 2ESMA 2UZVA 3LFBA 5JRSA 4FEUA 4NKSA 1XJDA 3ZRLA 4HGTA 4QYFA 3FI2A 3GOPA 2JY6A 4W4YA 2GHLA 3ROCA 3U7DA 4XG2A 1PMEA 3W16A 5AAFA 5TR6A 3W1FA 3L9NA 4YZMA 3M11A 3WZDA 2XEYA 4FSQA 3SXRA 2Y4IB 1NY3A 3TZ7A 4XG9A 2ZVAA 2BTRA 4FULA 1DAYA 1FVTA 4IJPA 1UU9A 2MRPA 4BCGA 3TNPC 1VD2A 4BCNA 2HXQA 4XBUA 3PXQA 5HZNA 1SE9A 4FX3A 4DEIA 3F66A 4JBVA 2IO6A 4FVRA 4G16A 3SHEA 2IVVA 4YGAA 2ITXA 4DDGD 4O7VA 4MQ2A 2FO0A 3VTWA 2R3FA 4F99A 3QQ8B 2H6DA 5H9BA 2XP2A 5G2NA 1R1WA 5AEPA 4MSMB 2FA2A 3TZ9A 2IG7A 4GU6A 1FVVA 4NPNA 3ZEPA 2F57A 3NHEB 4D2SA 4NM5A 2GBNA 3D5WA 2K8CA 2C4GA 3AULA 3GBZA 1URWA 4ITJA 4XLIA 4WHZA 1P4FA 3ZTDA 5JQ8A 2A1AB 2KJ6A 3DPDA 2XB7A 4BOSC 3CPBA 3Q52A 3PV1A 1RDQE 4CKRA 2XK7A 2VTOA 3ROYA 1U5QA 3LOKA 1H08A 3PA3A 4NQKE 5CQWA 1OL6A 3GFWA 5IQGA 4GT5A 5LJJA 4RX7A 4CXAA 2H9VA 3KRJA 2C7HA 2PPQA 4D1ZA 4WG5A 4DBNA 1WVWA 3CP9A 3VO3A 1XBAA 2YWPA 3ZSIA 2KTRA 4I41A 3VUHA 4BI2A 4DFUA 3QCYA 1FINA 4FT5A 3REPA 4D4YA 3SXFA 4NT4A 2CMWA 3QTRA 2KK8A 3MVJA 1WBOA 3HV7A 4DG2E 2RFNA 4HJKA 5J5TA 5JH5C 3WA0A 3BHHA 3U8ZA 4I6NB 1NI2A 3QF9A 2GQRA 3LCDA 4E7WA 2JXXA 2PZ5A 2XK3A 2J2IB 4BDJA 1TBEA 2YABA 4EQUA 1YVJA 2JIUA 1WMHA 3QCSA 4DTAA 3COHA 4BCOA 2NBUA 5LOHA 4CQEA 4AW1A 2YAAA 4UZDA 5HBJA 1H4LA 4LYNA 4EH7A 3LMGA 4XG7A 5AP1A 2WQBA 4WNKA 3SU8X 2AYOB 4H3PA 2PSQA 4RA4A 2KJRA 3ZSHA 5ANGA 4G3DA 2QHNA 4CEGA 5ANJA 4M84A 2EXEA 2BHHA 4FSRA 2YCSA 1H07A 2WOUA 3SDLC 5A4CA 1YDTE 1NA7A 1Y6BA 4HPTE 2KO3A 2V4LA 2XNBA 4JDJA 2VTRA 2YLEA 1WRDB 2R3GA 4CHKA 5HVKA 2NP8A 3RP9A 4G34A 3EHAA 4IWOA 4R7IA 3WI6A 2Z0EB 4CMUA 4BCQA 2EVAA 3ERKA 5LMBA 5M55A 3QWJA 3PLVA 1UNLA 2AYPA 2OJIA 5JZNA 5AR5A 4FKTA 3DBHI 4EC9A 5DA3A 2VO0A 1Q8WA 4I6LB 4FKLA 3IGOA 5IEYA 2CKEA 4L43A 5TR5A 3MB7A 4I6BA 1JVPP 2YZAA 4D9UA 1EO6A 5FG8A 4CMTA 3ENHA 1KWPA 4FSYA 4O38A 1YOJA 2MBQA 2UUEA 2VN9A 4NCTA 2YIXA 5E8ZA 2ZMCA 4ZTMA 4HPLB 3VN9A 3R9NA 4X0MA 3AI5A 3HIZA 4UWCA 3NDMA 1SM2A 3T9LA 4NL0A 3RULA 3W2RA 4O7LA 2XNOA 3VC4A 1GAGA 1UGMA 4AJYB 4ERWA 3MIAA 4XEYA 4CD0A 2KOXA 1BYGA 3R71A 4AA4A 2JDOA 3RAIA 1WBSA 2PUPA 3LJ1A 4FTIA 2GU8A 2W9ZB 3Q3FA 2ITWA 3BU5A 4IDVA 2MW5A 4DCEA 4K1BA 2VV9A 4FV8A 4LM5A 1LXDA 4NJ3A 3F5PA 4GK2A 1ZOHA 4QTAA 2HZIA 4QTBA 3E64A 4EHEA 2JVCA 3S2AA 3WE8A 3BELA 3ZW3A 1BT0A 2N7DA 3WBLA 3IOPA 3NS8A 2JDRA 2OFVA 2KC1A 4CCBA 4FZ7A 5C8MA 2LXAA 1WBPA 5JFVA 2JFLA 1NT2A 1YD8U 4F7NA 3L8PA 4BKZA 5CU4A 1Q24A 3GOKA 3R9DA 5BYYA 3UVPA 3IW7A 2KZRA 1PHKA 1XH4A 3QQJA 4AFJA 2MP2A 2VWIA 3MY1A 2MQJA 5C03A 5BVFA 4DCAA 1APME 4FI1A 3GXLA 4QMSA 4M14A 3E87A 2UW9A 2KNBA 2CGXA 5L8JA 3LCKA 2O6VB 2C60A 3HUBA 2PY3A 2NO3A 4I92A 4BCMA 1S9IA 2D07B 3BHVA 5BMSA 5KHXA 3HM3A 3R1QA 1ZXEA 3UPZA 4F1TA 4IANA 4QT1A 1YI6A 3H7PB 2GBMA 1M2QA 4NY0A 3RK5A 2GNIA 2G2IA 4YPDA 4C4HA 1U54A 1NDDA 2R3MA 4YP8A 1PF8A 4MXXA 2VTSA 3RI1A 1WZ3A 3QU0A 3FSFA 4EL9A 4GYIA 5E7RA 4RA5A 4EBVA 2PE6B 2YCRA 5HD7A 1ATPE 3NCGA 3PT2B 1DS5A 5T6KA 4CNHA 3HMMA 4CYIA 4IX4A 5F9EA 3ODYX 3RK9A 3NS9A 3IONA 3MA6A 4N4SA 5EDQA 5E1EA 4FV0A 2WMWA 2X0GA 3P7BA 4FTNA 2YACA 4GG7A 3PRIA 4QMWA 4QNAA 2J4ZA 4EYJA 2WWZA 3MV5A 5HBEA 4A9YA 5BVKA 4YBJA 3TIYA 2BPSA 2GNJA 4BCJA 5BUIA 4AZFA 3FHIA 3DBCA 2KDEB 3A62A 3QTZA 2QO7A 4RWLA 4QP4A 4LOOA 5EQEA 3MJWA 4NW6A 4MD7E 4A06A
chains in the Genus database with same CATH superfamily
1ZOYB 3QA8A 4BIDA 3OCBA 3ZYYX 5CF5A 3FLSA 3D2KA 3FXZA 3PREA 2HY81 3E93A 2ZW1A 2YERA 2UW7A 2Z02A 2VTQA 2XJ1A 2PHKA 4PX6A 2AC5A 5K5XA 2R2OA 5HG5A 3UBDA 3PSBA 4BDAA 3BUDA 4BDHA 2V3NA 3PZDA 1YKRA 4W9DA 3A60A 2C0OA 4QTDA 4KIKB 5FP6A 4QD6A 3V04A 1GZ8A 4I93A 5C26A 2UZNA 1ZWSA 4O84A 2PVHA 3ER8C 1QCFA 2HYYA 3DAKA 4RCOA 2QHMA 4W9EA 2Q12A 1SU7A 1J0GA 3SV0A 2BRGA 4MXZA 1V1OA 4CQGA 3IKAA 5L83A 3VTVA 4D1XA 2ZPNA 3KRLA 2LGXA 1WYGA 3ET7A 2M8SA 4YTCA 1Q8ZA 1NENB 4HKQA 2YN8A 2FSOX 3SVVA 1AD5A 4FF8A 1WFCA 3WAOA 3LMFA 4YMJA 2Z8CA 4WUAA 3LMIA 5EDRA 5CZIA 3EH9A 2RKUA 4YJSA 4J97A 4IWPA 3GU6A 3V5WA 4G3FA 1WXVA 3FL4A 4W9IA 4TW9A 4BCKA 2WTVA 3ORIA 5FDPA 1SF0A 4KS8A 4PPCA 1Q1OA 1JQKA 2G45B 1DYQA 3AE9B 3IBEA 3CKXA 2R3QA 4AKVA 1WI0A 3OROA 4YC3A 2C6TA 2WOTA 2DBYA 1YNTE 2ZCCA 3UE4A 5EM7A 3D9VA 3B2WA 3TYKA 1WBVA 5E8TA 5HE0A 4IM3A 4BNEA 4E20A 4R5IA 1WBWA 4IXPA 4B9QA 2NR2A 2GTMA 3TEXA 3QKLA 1KV1A 4F6SA 1B38A 3TN8A 2WXGA 1UPXA 2O2UA 4FJVB 3FZ1A 5E8YA 3HNGA 2B9HA 2JKMA 2XKFA 3AD6A 5BYRA 4ZLOA 4BCFA 3FMMA 5IA5A 2BYVE 4KBCA 4GXBA 4UXLA 2PJHA 1C3TA 3KXHA 4O7YA 2B3AA 4D1SA 5AMNA 2WXOA 4L42A 2X1NA 4YNEA 1SU6A 3PPJA 3C5IA 4HR1B 1DGJA 1TZ1A 3DX3A 2BAKA 5G6VA 4CFUA 1I7HA 4OAUC 1IR3A 4Y8DA 4IX5A 3FMNA 3IT6B 5LARA 2C1BA 1MP8A 1XWSA 4M02A 1RAXA 2BW2A 4OTHA 2E6XA 5CNOA 4IZYA 2BF8B 2N9LA 2JYTA 2JT4B 1MJGA 1PY5A 5DR6A 1Z2MA 3VF9A 2OH4A 4YJQA 1XCTL 2W96B 3KRXA 5EYDA 5DPSA 3O3MB 3I5NA 3FKNA 4M8MA 3H3CA 3VEAA 4FIFA 4TRLA 4EZQA 1BMLC 5AP7A 4O4CA 4FZSA 3KWLA 3I1AA 4MD9E 5BO4B 1A9UA 3PXRA 2VAGA 1SMHA 2OGVA 1JWSD 4K6ZA 2FBWB 3R3MA 4RJ7A 2W1EA 4RIXB 3NYXA 2OF4A 3L8SA 5EKNA 1F52A 3B1LX 4C80A 1YJ1A 3DBQA 1M2RA 5B2MA 4YSJA 3S3IA 5T8IA 5DRDA 5CEQA 5TO8A 2K22A 3D5XA 4KX6B 3BVXA 5D7AA 3H30A 4WOVA 3KVXA 5L8LA 1OA0A 4IW0A 4PDSA 4FBXA 4QTEA 2ZV9A 3VAPA 4RVTA 4O81A 4BZAA 1HE8A 1H28A 2OSCA 5IDPA 2YZLA 4RX8A 5FTGA 3SYVA 3FBVA 4ERKA 1YJJA 2NBVB 5JK3A 3UZTA 5FBNC 4WRGA 1OKWA 4AGDA 2QU5A 3I57A 5E8VA 3VS6A 5L6PA 4KIKA 4BDFA 1SE2A 1FFUA 3D83A 4V0GB 2ZZPB 3DQVA 5IO9A 2IW8A 3TZMA 3DX0A 3VS5A 3G51A 5E8UA 5CTPA 4ALWA 5J7BA 4WG4A 1U4AA 2GHMA 3BCEA 1E8WA 3N32A 2JAMA 3ZTXA 4NCTC 1CK1A 3F2AA 4DH7A 2AQXA 4H6IA 4YO4A 3BLHA 3HLLA 3U87A 3NW6A 2WYHA 5EHOA 4KDIC 4QDVA 3ZMMA 4H39A 3ORXA 3IECA 3F88A 4HWIB 3A7HA 2IGGA 3ULIA 4NQLB 3CKWA 3OS3A 4UYAA 2CN5A 3MN3A 4C02A 1N63A 2NMQA 4QMTA 2C30A 5TKYA 4O2PA 2R2QA 4XV9A 3E8DA 3F3UA 4W8EA 4JT3A 3O8TA 4A9UA 4K18A 5HCZA 3CQWA 5AUTA 3BBTB 1BI8A 2TSSA 4WJQA 3VUIA 2JIIA 1V1PA 2VTMA 5LWMA 1WR6E 2W5AA 4WIHA 1O6LA 4JNFA 2C6OA 3QE6A 4A07A 4MH8A 3R9RA 3C0IA 4MXYA 4LDTB 3ZNHB 2O64A 3OWGA 1HXKA 3T8MA 4GDKA 5T68A 2G4DB 2AQ3B 3VQHA 2KULA 2K25A 2YEPF 3HAMA 3RM7A 2WTKC 3UMXA 1EWCA 1RWSA 4BCPA 5FM3A 1YWMA 4ZTHA 2K9XA 3F6XA 4RGOS 3RALA 2WMRA 3UVQA 3ORKA 2N1VA 4MJSA 2L3ZA 4ZLZA 3QTWA 4G6OA 5LMKA 5KHOA 4HPUE 4UDUC 3NS1A 4FZ6A 4XG4A 3QX1A 1N5WA 2KANA 3BE9A 1IGCA 4HR1A 1CSNA 2F2UA 2BIYA 3BWUD 4U9AA 1RLFA 5BVNA 4IMYA 1E0ZA 2OZAA 5M4FA 3N4TA 2ITPA 2WIPA 5DNRA 5CEPA 5AP6A 2ZV2A 1IA8A 2FIDA 5JFWA 3ZEWA 3ZJUA 2JIVA 5HKMA 3DDCB 3QQFA 4DDGA 3M95A 5I0BA 4XV1A 3B08A 2GF4A 4XWWA 3NR9A 3CIRB 4IM0A 4YURA 2Z0NA 1IRKA 2YI9A 4OBPA 4X6RA 2J0JA 3EIDA 2WMQA 4FV9A 3PJ2A 3A9KB 3P1AA 3RI7C 1WVYA 3QQKA 4H05A 3L16A 1MG4A 4FT7A 4E3CA 4X3JA 1H1RA 5DPRA 2WB8A 4WT6A 5BNJA 2WDRB 4RNAA 3C0RB 4X3FA 3SXSA 2UWQA 2M19A 1TQUA 2FNJB 4JDKA 2WMSA 2A27A 3AE7B 4D0XA 1G8KA 1O7DB 4H3QA 3PXZA 1Q99A 1VYZA 4TTHB 4X7QA 3TKUA 3O51A 3I0QA 1ESFA 5IPJA 1HXYD 4R5YA 4BTJA 1UWXA 1F2RC 4O0UA 4WQMA 5AZGA 4FKIA 5IA3A 3L8VA 3B0AA 3JVZX 5CSXA 3GOEA 5IQEA 3P86A 3QRKA 5G1XA 4E6DA 3I5ZA 3HMIA 3BRBA 2W5HA 4RJ4A 4CRLA 1KSWA 1SVEA 3FDNA 4OVZA 1KOBA 3T9TA 5IZFA 3DOWA 3RCZA 5EM8A 4E71A 2D3BA 5LCJA 4IZ5A 5HO8A 5IISA 2QILA 4HYBA 1R4NB 4FKGA 3Q0KA 2FSLX 4YJVA 5BVOA 2NS5A 1FRDA 2JLDA 4FNYA 4F9AA 4NPHA 1Z5SB 1OL5A 2RR9A 3R7VA 2CNUA 2HZNA 2RG5A 1OPLA 2C3JA 3OVVA 1ZXIA 2REXA 3R00A 3PA4A 4PTCA 2F4JA 5J79A 1Y8RC 4AZTA 5FKAC 4D4RA 2ZVOA 1V8CA 4RWKA 5A9UA 1W7HA 2D4CA 2R9SA 5EOLA 1G8JA 4PTGA 4HZSA 2XKCA 3BVMA 5AUUA 4UB7A 5CAUA 3LM5A 1R39A 4O0RA 4BZNA 4HGLA 4G6NA 3DDFA 3X0WA 3ML8A 4LRKA 5H8BA 4P6VF 2MJDA 4AGUA 4EH6A 4X6QC 2WXQA 1TQIA 3FKLA 4R1YA 1OBDA 1TS3A 4N6ZA 3VKHA 2PE0A 2BVCA 3A9JA 1QL6A 3DVGX 1V0BA 4UY9A 3DVNU 1UBQA 2DYMA 3FKOA 2V22A 5H8YE 3AEDB 4IDTA 4Y46A 4QP2A 3AMAA 3AD5A 4EYMA 2C9WB 1TYGB 3LCTA 1XEEA 1PFDA 2E9OA 2J50A 2W1HA 4EZSA 2PK9A 4GIVA 1TKIA 3TCPA 4L6QA 2RPVA 3RMKC 5LXHA 1YW2A 5C5BB 4K1RB 1HZ6A 4F0GA 4EK5A 5GZ9A 2N0SB 3EKKA 1VDVA 4QMPA 1K51A 3V6RA 3KMMA 2YI8A 5IMEA 1SUFA 4H1JA 3PJ3A 2GRIA 2YL6A 4UMQA 4V04A 2ITZA 2OG8A 4D28A 4I5HA 4D2KA 5HNIX 2Y8OA 3FQSA 4RWJA 4EOJA 5KZIA 4M68A 4MDKE 1VYWA 4ZJJA 5L2IA 5J9LA 3CZSA 2HTME 4L01A 4BKTA 5FR3A 4GVJA 4IDIA 4O82A 2KJHB 3NNWA 3P7CA 5IF1A 3TZ8A 3UIBA 4DYLA 3EZVA 3BVUA 4MD8E 3TIXA 3W55A 3OAWA 3CIKA 3ZO3A 4O7SA 2MBBB 2QC6A 4CG8A 2YIWA 2BS2B 2YFXA 5A6NA 2PE2A 4R3PA 5D9HA 1WCCA 4G17A 4GEOA 2GNGA 4GGQA 1GNLA 1OUYA 3HAJA 2JEDA 3KRWA 4G3GA 1H0WA 4DEHA 1W2FA 2E9NA 2C5VA 2XN9C 3LKMA 4OHJA 2IY0B 2OJFE 3U30A 3DU8A 5HTIA 2CKPA 4FSZA 3WYYA 2ZM3A 3IDPA 1GIIA 2QOOA 4NKAA 4OLIA 4NZWB 3RAHA 5IQHA 4BBNC 1ZYCA 2Q0NA 2XK8A 3GP0A 4KUJA 3I4BA 3A1QA 3JVSA 3ZUTA 2G2HA 4KINA 5AIRA 5CVHA 1U46A 4BN1A 4AP7A 4QP3A 4C3FA 4IC7A 1R7SA 4P5ZA 2OZOA 2R0IA 3LFNA 5GJFA 4K0YA 4RT7A 4JNWA 3AKLA 1CTPE 1BL6A 3AE6B 3HKOA 2C5XA 4YJUA 5F4NA 2RL5A 4E93A 3AU5A 1W83A 2IZTA 2GOWA 4M15A 2FVDA 4AG8A 4IAZA 4PYZA 4F0IA 3EQHA 4F63A 3ZIMA 4DFXE 5B2KA 5HKHA 3VVWB 2L76A 3AE1B 3C4WA 3FQHA 4IB1A 2J5FA 5DPVA 3CD3A 4FV6A 5IKWA 4N0SA 4DTBA 4U79A 3WIGA 4EJ7A 3MFGA 3NVVA 2PVJA 4FV5A 3PXYA 4P7IA 1T45A 1AW7A 4P7EA 4KVGB 4LV7A 1M7QA 4NSTA 2DHZA 3C0HA 4E4NA 4IFGA 3O71A 3AMBA 2NVUI 4E73A 1H1PA 4C59A 1GZKA 2WEIA 4IAFA 2LUMA 1YHVA 1I4GA 2GHGA 2WXRA 3ANQA 4S31A 3MC9A 3AXWA 2OIQA 2GCDA 3IHPC 4OZAA 4C4GA 3GC9A 4HDOA 4C35A 3L54A 1MVKA 3R2BA 2ZYBA 4HCUA 2WDQB 4ZZMA 5CI6A 3NY5A 4KSKC 4WPEA 2LJIA 1IYFA 3UO5A 3DBRB 2JAVA 4LOQA 4XUFA 4RFMA 3TNWA 5ETIA 4ZS4A 2L83A 4H2AA 5HE3A 1JWUD 3TUDA 3FLWA 3ZTCA 1GUAB 4HCPB 2C6MA 4FEVA 5CANA 3RPVA 3QFVA 4RWIA 5AUVA 3H7SA 3TNQB 2W05A 3OJ3A 5KMKA 2L00B 1YI4A 3ZLWA 2EX3B 3FD9A 1TGZB 1QX1A 1RM6C 3NIEA 4G6QA 1FO4A 4HK2A 2A4LA 4D5KA 2OIDA 2YM3A 1KV2A 4ZSLA 5J17A 1VZ8A 2ITQA 3KAWA 3QTXA 1P7FA 3ZYAA 4B6LA 3O8PA 1XCQL 4AZEA 3F3ZA 4OBQA 4M69B 3KC3A 4L7FA 2H88B 1ND4A 3NUAA 2PWLA 3R8PA 1MI0A 4PUZA 2OZNB 3QK0A 4EZ5A 4I6FA 4XE0A 4C7ZA 4CG9A 3R8UA 1TKYA 3KQ4A 3P5KA 3CJFA 4GRBA 4CYEA 3D2FA 4LJPB 3VRZA 1WMKA 4FVQA 3A7GA 4FTCA 1M17A 3FY0A 3BIZA 1NVRA 2JYEA 2DX5B 2X6EA 5LMKC 1TQSA 3WIKA 5LCKA 2PL0A 4MGKE 2HDEA 3U55A 4W9WA 5DYJA 3E92A 2BUJA 3ALNA 2C0IA 3UDZA 3Q9YA 3DX1A 3T3NA 4MUQA 3C7NA 3BYYB 3HZTA 3QZGA 4YSZB 1IGDA 1V5TA 1FPUA 4AXAA 1Q5KA 3RKBA 4AXEA 1Z9XA 4LRMA 1OI9A 2YIRA 2VD5A 3ZUVA 4C4EA 4YZBA 1OGUA 4B99A 4AZBA 3HVCA 4BIEA 1WGGA 3PJ8A 5KMLA 1FEHA 1QLBB 2W3SA 1YQJA 2A0CX 1QT9A 2JZ3B 2VX0A 3C1XA 2X2KA 3NX8A 3M62B 5AP0A 3BU6A 2KX0A 4PDYA 2P2IA 1L3RE 5LQFA 4X3FC 3DJ7A 3PXFA 4KABA 1H8CA 5FIGA 2SEBD 2ZB0A 2YDKA 1JKLA 4MGZE 5IMXA 2O2VB 5JH6A 3POOA 2LGSA 2VZKD 1AQ1A 5FP5A 4AN2A 4W4XA 1FBNA 3RNAC 3LFCA 2QOFA 4BYJA 3MH3A 4R6VA 4F9CA 4IAAA 3C4FA 2OJ9A 2EKEC 3QJZA 3AEEB 2P2HA 4DEEA 5KHWA 1J7LA 4ANQA 3MPAA 4O0SA 4CFNA 4BBEA 4ICUA 1JCKB 4HJOA 3LLAA 5HVYA 3SQQA 2B9FA 1AWDA 5JRQA 5IA0A 1LO5D 2KTFA 3E63A 1N62A 2RDBC 3F3WA 4GMVA 2LGCA 4WNPA 2WP9B 2CHZA 3L10B 3AE8B 2NYAA 4E4XA 3ER9B 1OEYA 3UZRA 3F7WA 4S33A 2W4KA 4X2KA 4ZTRA 3RVGA 1FNUA 3Q9ZA 4F09A 4EZRA 4W9HA 3BHUA 3MIYA 5DT3A 1J3HA 2RSUA 3QXPA 2F7QA 4F7JA 2XNEA 4HYIA 2C3KA 2EUFB 2VTJA 3AC4A 3PYYA 1FXTB 2GI9A 1HWWA 2MJ3A 1RYJA 4FKRA 2ITYA 2W17A 3VUKA 3DPOA 4ASEA 4IX3A 2OW6A 2X6DA 4RGNA 3IQ7A 4F1OA 2C08A 3AT2A 3WF8A 3EN6A 4CCUA 4JR3A 3PP1A 2WTWA 5I9ZA 4D58A 3I6WA 1N5XA 2PZPA 4RSSA 2VTIA 4HYSA 4Z3VA 2B55A 3QXOA 4RQVA 4ZTQA 4JMQA 2H34A 4C4VB 4FKWA 3VBYA 2QSDA 2HENA 4C38A 1L0YB 1SSNA 2C3IB 2K3UA 4C3PA 1GJOA 2V3SA