4IM3A

Structure of tank-binding kinase 1
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
659
structure length
605
Chain Sequence
GSMQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNRPVDVQMREFEVLKKLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGMNHLRENGIVHRNIKPGNIMRVIGEDGQSVYKLTDFGATVDLWSIGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITGKPSGAISGVQKAENGPIDWSGDMPVSCSLSRGLQVLLTPVLANILEADQEKCWGFDQFFAETSDILHRMVIHVFSLQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQELIYEGRRLVLEPGRLAQHFPKTTEENPIFVVSREPLNTIGLIYEKISLPKVHPRYDLDGDASMAKAITGVVCYACRIASTLLLYQELMRKGIRWLIELIKDDYNETVHKKTEVVITLDFCIRNIEKTVKVAAELGEISDIHTKLLRLSSSQGTIETSLQDIDSRLSPGGSLADAWAHQEGTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLAYNEEQIHKFDKQKLYYHATKAMTHFTDECVKKYEAFLNKSEEWIRKMLHLRKQLLSLTNQCFDIEEEVSKYQEYTNELQET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Tank-Binding Kinase 1
rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase TBK1
total genus 194
structure length 605
sequence length 659
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-01-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF18394 TBK1_CCD1 TANK-binding kinase 1 coiled-coil domain 1
A PF18396 TBK1_ULD TANK binding kinase 1 ubiquitin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4im3A02
1.20.1270.420 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4im3A04
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4im3A03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4im3A01
4BKYA 1UU9A 4YJRA 2XNOA 5DEYA 4G50A 5A6NA 4O86A 1P1AA 3CPCA 3CS9A 3PP1A 4KBAA 3FY0A 3PY0A 3IFWB 4DWFA 1OBDA 2ZOQA 3R2BA 4Q9SA 2KFKA 4L53A 4MSQB 1CM8A 2FSLX 2E9VA 2IO6A 4FICA 5J9YA 4PMMA 2G45B 3AI5A 4RWIA 2O5KA 2CKEA 1W84A 3TNQB 2H6DA 2DWBA 5CHFA 5M07A 4RIXA 1UELA 4UXLA 5CS6A 1L2NA 3LFAA 2C5VA 2XYNA 3QRTA 2HENA 4FKSA 5J1WA 4P90A 4URKA 4JR7A 2YABA 2G4DB 3OHTA 5D7VA 1Q8WA 3NW7A 1JKTA 4USEA 2QOKA 5JK3A 2QC6A 5L4QA 4F6SA 3QCQA 4DGGA 3WIMA 4X0MA 3NZUA 3TV7A 2X4ZA 2DYOA 4DT8A 4U8ZA 5AMNA 1PXNA 2HY0A 3UVPA 1H25A 4FIHA 3O71A 4LUDA 4BYIA 4GT4A 5HVYA 3R7GA 5KKRC 4YGAA 2FCSA 4TTHB 3U30A 3FKOA 2I6LA 3QALE 4AF3A 4QQJA 2W7XA 3FPMA 4YPSA 5EYCA 5L6PA 5F1ZA 2XNMA 2BZJA 3CGFA 2G9XA 2IZRA 1EH4A 4E26A 4RIXB 1GY3A 4IAZA 4FE2A 3AC8A 2R7IA 1BYGA 2F7ZE 3SC1A 2XJ0A 4EQUA 2C0OA 3ECIA 3UC4A 5CY3A 4OW8A 1P3QU 3PXKA 3EKNA 2DYBA 3HUCA 3DBQA 2C5YA 2R3NA 3WF8A 2ETKA 4FIEA 4HZRA 2QO2A 4RVMA 4I6QA 4UALA 1YQJA 4O22A 3PPZA 4YC8A 5T68A 3W55A 4ALVA 4AT5A 2OZAA 3A7FA 5KKRB 1ZYJA 3LE6A 5K5XA 3H4JA 2LVOA 5KHOA 4BR3A 5DFPA 4BCKA 2MP2A 3L9MA 3KMMA 2VWZA 2JWZA 3ML8A 2Y4IC 3LLTA 5E8SA 2RPQA 5HLPA 2LJ5A 3COMA 2R3FA 3QD0A 5D6JB 2VUWA 3R3MA 3O51A 4ZRKA 4QMOA 4BBFA 1V0BA 4V0GB 3ZUTA 3BGQA 2JITA 2NPTA 4BI2A 1M7NA 4G1WA 1UGMA 3QHWA 3VQIA 3UNKA 3CQWA 4GEOA 1YXUA 4JR3A 3KY2A 2GQGA 4U44A 4BN1A 4ANMA 2YLEA 1H1WA 2WFYA 3GI3A 2N9PC 4FKQA 2QU5A 2WMAA 3R1QA 1JBPE 4FNYA 4B4LA 3KYDD 2CCHA 3L10B 3FUPA 4E6QA 2KJRA 1WBWA 2WYQA 4D55A 3UZRA 1H1SA 1V80A 4FG8A 3NRMA 4I20A 3UZPA 4J96A 4UMQA 4DN5A 1GIIA 2CHXA 4GJ2A 2PE0A 4EC9A 3IW8A 1KV1A 4GV1A 2M8SA 4YBJA 3RALA 1YI3A 4IANA 1W7HA 2WQOA 3EQFA 5CU2A 3EFJA 4NIFB 3HMPA 4WJPA 3CLYA 3PA5A 5C8NA 1OTRB 5DH3A 3Q3FA 2WQNA 4HXDA 5C23A 4FKVA 3BQRA 3ZTDA 1X8BA 3MPAA 4KUJA 2B54A 2IW6A 4B6WA 4ERWA 4HVBA 2CNUA 5IQHA 4IACA 3F3VA 3EZRA 3H0YA 5C8MA 4Y95A 1T0YA 3A7HA 4AWJA 1OITA 5L8LA 2GHLA 1FMKA 5CXHA 4FR4A 4HPTE 5EDPA 4O0TA 4NM7A 4CZUA 5CAUA 4QTAA 4A3OA 4IX6A 4JBVA 3R8ZA 4OTDA 4PTEA 4MK0A 4V01A 2JAMA 2XUUA 3DQWA 4G5PA 4AW1A 5M4CA 4FV5A 3UG1A 2HY81 4RWKA 3V60A 2ONLC 2UW3A 4BGHA 5CF6A 3QAQA 4X3FC 4BRXA 4P2KA 4E5WA 3TM0A 2Y6MA 3QYZA 4MNFA 4F9AA 5HLNA 2OFVA 3WAOA 4EWHA 2FO0A 4HJKA 3DK7A 2MQJA 4O81A 4IB5A 5FQDC 2IYDB 4AXAA 2YZLA 5AR8A 4FKGA 3VIDA 4MQ1A 2KK8A 5C4KA 3QRJA 5A4LA 1XR1A 1KWPA 4FV6A 3B2WA 4N0SA 4XOZA 5EI2A 2DHZA 3ZNZB 5EOLA 3U4UA 3PP0A 2UZWE 2VRXA 4QO9A 5D7GA 2WWZA 3OWLA 4CMOA 3KMWA 4D2RA 2OO8X 2N9XA 2MP2B 2LZ6A 4WT6A 3UBDA 4DHZE 2F7XE 5BQ0A 2GNLA 3BKBA 4EZKA 2A27A 5CAPA 2ZEQA 4FNXA 4ASDA 2YDIA 5LMBA 2ASQA 2IZTA 2OZAB 3I7CA 5DA3A 5FM2A 4IADA 2GTMA 3EQGA 5A3XA 3UOHA 4F1OA 1VJYA 2OWBA 4AP4C 4O7TA 2OI4X 4MH0E 1S1QB 3V61A 1Q97A 4BB4A 2H96A 2KWVB 1STCE 2BAJA 2VTTA 3N9XA 4GU9A 4X2KA 4DTBA 4E4NA 4FZDB 1BX6A 3BI6A 3KMUA 5AV4A 4NQLB 1WZYA 2Z0DB 3QX4A 4N4SA 4D0WA 3ZRKA 1U4AA 1FVTA 1BUHA 4NFMA 4IB0A 5K4IA 2YACA 4JDJA 2UWQA 4MGZE 4HDQA 4W9EA 3FL4A 4FBXA 5HZNA 2KO3A 5J9LA 1IAHA 2WO6A 4ANVA 4CV8A 4FBJB 3QCYA 2JKMA 4AW2A 4OTQA 1FVRA 1WZ3A 2MBHA 3TUBA 4QP6A 4W4VA 5CQUA 2K1FA 2PPQA 2QU6A 4NW5A 2V22A 4QYYA 5EHOA 3MVJA 3O2MA 4ZEGA 3DCGA 4BYJA 2C7MB 3C4XA 4BHZA 4RIWB 4W9DA 2KXJA 2L8JA 3PZDA 3NMUF 2MBOA 1REJA 3UMXA 4X6QC 5E8ZA 2R3HA 4M0WB 4ANWA 3FHIA 3SOCA 2IO2B 4IFCA 4M15A 3ORIA 4DLIA 5J5TA 3QTXA 4ZLOA 3L9LA 4L7FA 4MGKE 5C26A 4CV9A 1Q1OA 3DBDA 3F7ZA 1V5TA 3TMPB 5EK7A 3W1SA 3V6EB 1QPDA 3LFEA 2FYSA 4NZWB 3A60A 5HICA 2QOOA 2J5EA 2KHWB 4O6EA 2ITPA 3QQJA 5HCXA 4AZWA 2L0TA 4BDEA 3A8WA 5HHWA 2JIUA 5EOBA 4BDCA 3U6JA 5JHBA 4NK9A 3F2NA 3EN6A 5CHVC 1KE9A 1CKJA 1QL6A 3CMMB 2J7QB 4DFUA 4FSUA 2WTKB 4DGLC 3NZSA 2QHNA 3CIKA 4AGCA 4XV3A 4C8BA 5J5SA 4JIOU 3Q52A 4WO5A 3GU6A 2LRWA 4QMZA 3DKFA 3DB8A 3RVGA 3TZ9A 4C3PA 5HG7A 4F64A 3OCGA 1R4NI 3ENEA 2OJFE 1BKXA 2W17A 1BL7A 3QYWA 4TYIA 4AZVA 2O65A 5LVNA 3VS2A 1MG8A 3R8LA 4BWXA 3SOAA 1P2AA 2NVUI 3F5GA 1WFYA 3DXPA 4AG8A 2PULA 4W9HA 1QPJA 5DWRA 3VW6A 4KABA 5LCKA 3BGZA 4E20A 3PHWB 5KZ0A 3E7OA 2W9ZB 4MJSA 3Q5IA 4Q2AA 4LG4A 4RIWA 5E90A 2C3LA 3MPTA 4M67A 4B8LA 4EJNA 4IVCA 2MRPA 2HZ0A 4FTTA 3D32A 4AX8A 2WEIA 3GP0A 3SGCA 1GZKA 3DJ5A 4ACHA 4II3B 5M51A 2FIDA 4NH1A 3NYOA 4G2FA 2WXVA 2PHKA 2R0UA 3QTWA 4F08A 5ANKA 3ZBXA 3L13A 4IDVA 2R3RA 3EQBA 5HO8A 2AC3A 2BKKA 3PDTA 3O8PA 4R3RA 4XX9A 2ITUA 2RR9A 4BCMA 4GMYA 3JUHA 2IY1B 1OECA 1G6JA 4YHFA 1MRYA 3LXLA 3KXGA 4D28A 5I3RA 4WJNA 4WUAA 4IWPA 5HG9A 4IDTA 2N1WA 4FV8A 3MFSA 5BVWA 1ND4A 4YLLA 4HVGA 3ZMMA 1OL1A 3WA0A 4LJOB 3KVXA 4IWDA 4WSYA 1PXIA 2I1KA 3TJDA 3OROA 5JRQA 5FEDA 2WMRA 3EQDA 4BF2A 2C9WB 1WBVA 3E3BX 5CEIA 5JGBA 3DBSA 4UX9A 4M8MA 2FGIA 4KWPA 4BDGA 3Q96A 3GZNI 3VHTC 5FTQA 3MS9A 3H30A 1C1YB 4FGRA 3NNUA 1XT9B 4ARKA 1WJNA 4ZZNA 2VO7A 4MD8E 3U55A 3Q9ZA 4C38A 1HCLA 2VO3A 2FUHB 4CHKA 3ZSIA 2R3QA 5D12A 4GCJA 4ACDA 4I93A 3RAKA 2L3ZA 2XK3A 4TW9A 1YHWA 2FUMA 3FMLA 3OW3A 2KNBA 3QGWA 2PE6B 4F1TA 5IKWA 4L52A 1Y8YA 2JAVA 1B39A 3C4FA 4XG7A 4CTBA 5GJGA 3VTVA 2HJ8A 3QLGA 4B8MA 2ZNVC 2UV2A 4AGDA 3UQCA 4XRLA 4KS8A 2OH4A 2FNJB 3HECA 3W18A 3L17A 3DNDA 4FODA 3U8ZA 3TZ8A 3QZIA 3NCGA 3PTFC 4LRJA 2D2QA 5IZFA 4QP4A 2PZRA 4GH2A 3APCA 5L8JA 4XBRA 2W1HA 3CF6E 2GQRA 2WMTA 3C51A 4F7LA 3QC4A 4K0YA 3OT3A 4Q9ZA 5AV2A 2YA9A 3NYXA 4BCQA 5LMKC 3EECA 5FXQA 1E1VA 2JRIB 2BALA 4IJ9A 4XYFA 5IQDA 3VBXA 3M11A 2J50A 3QQKA 4UWBA 5CI6A 2I0HA 3HX4A 2KJ6A 1RLFA 3B0AA 2R3JA 3BHTA 4O83A 4PTCA 3Q2MA 2PPHA 2EXCX 1IR3A 4PRJA 2AL3A 3K3IA 1M2QA 3Q9YA 4BZOA 5M55A 3QCSA 5KUPA 1E8YA 1WE6A 3AQVA 1Q24A 3OWJA 4Q5EA 1YRPA 1WXSA 2X0GA 3V6CB 4TWOA 1Q99A 5E8YA 4O0SA 3VS5A 3OXZA 4FKOA 2X1NA 4HCVA 1UU7A 3MFTA 4JNWA 1NI2A 4OLIA 1JKLA 2XK7A 2KDFB 2RGPA 3OLMD 3MY5A 3EN4A 3PVBA 3ZDUA 4PP7A 1VYWA 2XM8A 4R78A 3K9PB 4MXZA 3EN5A 3AXCA 4RC3A 2HOGA 5CTRC 3QA0A 2PVLA 3ZHPC 2J2IB 3LMGA 5AX9A 3TIYA 4F4PA 4B95A 2NBWB 1GC7A 5ETAA 3L8PA 4WG4A 3EC8A 3AC5A 2I1MA 4H3BA 1RQQA 4IXPA 3LDZE 3A9KA 5HQ0A 2V55A 4AP7A 2J7TA 5AA8A 4DHJB 1AGWA 2OXXA 5L2SA 4DYMA 4U81A 2H8HA 4BDJA 4QD6A 2LVQA 5GIOE 2IVSA 3PZHA 4EEVA 1P4FA 4J8NA 1SGHA 1UWJA 1WMKA 1WXMA 3S95A 2WX1A 3C0IA 1UVRA 5AFVA 3H1UA 4QP2A 3GUBA 3LAUA 4RA5A 2ZCCA 2QVSE 4O96A 5I9UA 1Q8UA 2NRYA 3QCAA 3ZO2A 5ICPA 5I5ZA 3G5DA 4PMPA 1YXTA 4IM3A 4D2VA 3KRLA 3F2RA 3JYAA 5EM6A 4XJ0A 3DZOA 4FI1A 4FKJA 3FHRA 5KMKA 3OP5A 3DAJA 3WZEA 3APDA 4OBQA 4OR5A 3WF9A 2OFUA 4QYFA 1Y57A 4GT3A 3ODYX 1WAKA 2XF0A 3D7TB 3LIJA 3RPSA 4QNAA 4CKIA 4L9IA 5HLWA 4C4IA 2CKHB 3FKLA 2OG8A 2WGJA 1OL7A 4HCUA 3ZXTA 3A9KB 2OXDA 1PYXA 4PDSA 3N4VA 3COIA 2O64A 3QD4A 4TWNA 5TO8A 2WTWA 2KFKB 3B1LX 4CYIA 3JW0X 2X2LA 4RJ6A 3M63B 5JFXA 4TV3A 4AWIA 4GYIA 2AYOB 4V04A 1J7UA 5DPVA 2MBQA 2BAQA 3RWQA 3FYJX 4RG0A 4EBVA 4CCUA 1OBGA 2CU1A 1GZOA 2BUJA 4HGLA 2P3GX 3UYTA 4YZ9A 4BIBA 2JGZA 4JQEA 4HPLB 3QU0A 1SVHA 3RJCA 1LUFA 2X7FA 2XKEA 3P78A 1XBAA 2P33A 3NW6A 4BICA 4CRLA 2G4SA 4QPMA 1PYEA 3V5PA 2NPQA 1T46A 2BROA 4FSTA 1UWHA 3GU7A 4IB1A 3VAPA 2K8CA 2JT4B 3WALA 4DCAA 4FL3A 3Q60A 2B4SB 4X3FB 4AZSA 1TVOA 4FSRA 1ZXEA 2XEZA 3LFCA 1BLXA 2C1BA 2UW0A 2V5QA 4K9YA 4L46A 4XEYA 5C27A 1J7LA 2H9VA 5I3OA 2BZHB 3PJ1A 2CCIA 1FXTB 2KC2A 2VV9A 1XQZA 2B9JA 3MBLA 4BKJA 4UMUA 3FMDA 1P98A 4ICVA 4HLEA 4YR8A 1SYKA 4R7HA 5AP6A 5A9UA 2C30A 2KTFA 1U5QA 2REIA 4I6FA 4ORKA 2PMNX 1MQBA 3FI4A 4YHJA 4EEWA 3NIEA 1Q8ZA 3A4OX 3QK0A 1BL6A 3ZTCA 2DYMA 3BU5A 4IMYA 5LVLA 1XD3B 1LM8B 4I5CA 5CU6A 3VUHA 1S9IA 3M2WA 2JUOA 2KDBA 3ZRCA 1OKZA 4R3PA 3TI1A 4PWNA 2EUFB 4QTBA 2YJSA 3WYXA 3BRBA 4ENXA 1QPCA 1EF5A 2B3AA 2CHLA 5A54A 5GINE 1WFCA 4HZSA 3UQGA 3GC0A 4BKSD 1YI6A 2C6LA 5I9WA 5LVOA 3O23A 4XG6A 3VXWA 1E1XA 4LGDA 4WSQA 2ITZA 1OQYA 2AEHA 2KMAA 5IUIA 3GNIB 4NM3A 4W9CA 3PG3A 4CLJA 4TKNA 2W96B 4YO4A 3C4WA 4GS6A 3NYNA 2D3GA 3G2FA 4RA4A 2MWSB 3FBVA 4O7YA 1YXSA 4MF1A 2PVMA 4FVRA 5HIBA 1FBNA 3A7IA 4G31A 3PXRA 2DX5B 4O7SA 5AP2A 1KOTA 2UZBA 2XIRA 1MP8A 3PA4A 2P0CA 2W5BA 3WE4A 4WHZA 4MTAA 4KDIC 4MCVA 3W10A 4F8CB 4ITIA 4A4LA 2ZAZA 3CY3A 3B8RA 3UGCA 2GS6A 2JF5A 3K5VA 3MJ1A 1L3RE 3D2IA 3V5LA 4ANSA 4FT0A 4YNEA 5E8UA 4CMUA 4U3ZA 2X81A 3IW4A 5CF8A 5IQEA 3BYVA 4KSPA 4ZLZA 2Y8OA 5K4JA 2R3KA 3FPQA 4E73A 1I42A 1NT2A 3DAEA 2X9EA 1YHVA 1YOMA 3L8VA 2O6VA 4XV2A 4FTNA 3VBTA 4FTUA 4G6NA 4MHAA 2JKOA 4M7IA 1SE9A 3UPXA 5BVNA 3PJ8A 3GGFA 3D5VA 4C36A 3H9FA 4EOIA 4FTJA 3R73A 4IEBA 4IQ6A 4MD7E 2KWUB 3VUMA 4AW5A 3AC4A 4RVKA 4QP9A 3ZLWA 4EZ3A 3LXKA 3DQVA 2OGVA 2QOCA 4UMRA 5KNJA 2C3IB 2UZLA 2CPKE 3VJNA 4ZXTA 1V0PA 2BCJA 3DBEA 3KK9A 3QZGA 4PNIA 3R7YA 4CYJA 3POZA 2EVAA 2B9IA 4E93A 3L0WB 4W9WA 3TCAA 3MH3A 3R63A 3FL5A 2XMYA 3CQEA 3K54A 4Y85A 1UNHA 2K25A 3PSEB 4FV4A 1Q41A 2XBBC 5HI2A 3VAWA 4BIDA 3GOKA 2I0VA 2WTIA 4QMLA 5DT3A 4C4GA 4F0GA 2A4ZA 3NOBA 4FX3A 1IP9A 3ZLYA 2JKKA 4JBPA 4D2TA 5HIEA 4ICUA 4XNEA 2QNJA 1E8XA 4W8DA 3W1FA 2LI5A 5IU2A 2A0CX 4RX7A 3VWAA 2UZDA 4UV0A 1T45A 1I35A 4O0VA 2XKDA 2KLGA 3U6IA 1ZLTA 5E8WA 3PRZA 3FLWA 2ZPNA 4GYGA 5I9ZA 4AOIA 3NUAA 5HU9A 3AC2A 3R7EA 4ANLA 4Y73A 3VRZA 4BOSC 2QOIA 4K81A 5HNBA 4EOQA 2Z7LA 4B6LA 1Q62A 3A62A 3N51A 3AC3A 2UZTA 3MGYA 4J71A 3WZDA 4XC2A 1SMHA 3S4QA 2ERKA 3ERKA 3LJ0A 1OIYA 3UIBA 4KAOA 3NCZA 5A4TA 1I09A 5BVOA 4YC3A 5IDPA 1V9JA 1Q3WA 1UU3A 5ETCA 3E93A 1NA7A 4JJRA 1VR2A 3QUPA 2GPHA 4KKEA 4NJDA 4BCNA 3R9DA 3POOA 4JQ8A 1C3TA 2JDOA 5CSWA 1F9JA 2UZUE 3EN7A 2CGWA 4FIFA 4I3ZA 3CY2A 2ZNVB 1LXDA 2A2AA 3GC9A 4OT6A 4I21A 2BDWA 4RGJA 4GW8A 4DXAB 2ONLA 4ID7A 3VUGA 3FWQA 5IMEA 2ITTA 4X3FA 1R1WA 2UVYA 5DPWA 3QC8B 3RP9A 3CP9A 4CRSA 4C61A 3GCUA 2IJMA 4R6VA 5AEKB 2IW9A 3OCSA 4I5PA 1PW2A 2PUIA 4G3XB 2J6MA 3FLSA 5DBXA 3DKOA 2C4GA 4JDKA 5EFQA 4JAIA 5AUXA 1SM2A 3ZO4A 4F9WA 2OOBB 4E71A 1ZMVA 2MBEA 3NPCA 4ZSGA 5DMZA 3RULA 4CG9A 3NNWA 3VS1A 1PXOA 4MGIE 2OLCA 1DS5A 3IW7A 4BCFA 2IY0B 2OF2A 2XVDA 5BUIA 3R83A 3DZQA 2CMWA 2PVFA 5DE2A 2VX1A 3AD6A 3LJ1A 4FVPA 5CF4A 1R3CA 4G0NB 3PLAE 3FMJA 2B9HA 1U59A 3PXZA 3LFQA 4YJPA 3LCOA 3VHKA 2WMXA 4TN6A 5TR6A 5FM3A 2E9OA 4GIIA 3OCBA 1B6CB 3BCEA 4WBOA 2XIKA 4CMTA 2XH5A 4IX5A 3EQCA 1OUKA 3GB2A 3C5UA 2VWUA 2C0IA 5FD2A 4EK8A 4HYHA 5EHYA 3GEQA 2J51A 3CSTA 2ERZE 2YITA 4J95A 1KE6A 4IAKA 4TXCA 4WOVA 4RFYA 1YXXA 2C6MA 3QARA 4HDOA 1KM7A 3NWWA 3TKHA 3BELA 2PTKA 2QQ7A 4ZTLA 4RIYA 3BIZA 4A4OA 4L68A 2ZDUA 5I0BA 1E8ZA 2KTRB 4C2WA 3HA8A 3N3KB 1H27A 4C58A 2UW4A 2VTPA 3UP7A 3DDQA 4G34A 3JPVA 1JRUA 2VTLA 1TTNA 3EIDA 1J1BA 3JY0A 4IM2A 4JL9A 1DM2A 3AD5A 4K8AA 4WNMA 4ASZA 5D2MB 2YM6A 4PMSA 5DR9A 4F09A 1K3AA 1ZOEA 2GBMA 2CLXA 2WOTA 1PF8A 2VTSA 2XJ1A 3GCPA 2CGUA 3HM3A 3NS8A 4OAUC 3S1HA 1YI4A 3NUPA 3R9RA 1WR1A 1ZY4A 3QA8A 3RK9A 4ZS0A 4ENYA 2NBUA 5DYJA 3SX9A 3EMGA 1GUAB 5H9BA 3AGMA 5AP7A 4GFGA 4QPAA 3I4BA 3R7UA 3GCSA 4FJYA 4B9KA 4L01A 2YHVA 2XB7A 5AUVA 3UOKA 5LQFA 3SXSA 1YVJA 4FZ6A 2PVJA 3I6WA 2IO1B 4FG7A 4W9JA 1XBCA 3WZJA 1HOWA 4DGNA 3HV3A 2JIIA 3CJGA 2OSCA 4IVBA 4K2RA 1OKVA 4GDLA 2YWVA 2PZ5A 3QCXA 3P7CA 4XRJA 1PQSA 4DGOA 4JX3A 1KV2A 4FNZA 3WF7A 2WTKC 2QKWB 4XG8A 2KANA 2YIWA 2QLQA 3ULZA 1PHKA 1TQPA 4LM5A 1YD8U 3KW5B 2X8IA 4FKWA 2W1GA 3ROYA 3OTUA 4RJ5A 2GTNA 4GFMA 3NGAA 3RCZA 4XMOA 2HYYA 5JRSA 5IUHA 4I6BA 4MEMA 3MTFA 1FOTA 2UW6A 4QP7A 3ZC6A 1FINA 1U5RA 4ANXA 2G1TA 3MDYA 4APCA 4EOOA 5BMSA 3P0MA 3P5KA 4BBEA 3DXNA 4ONAA 2IN6A 3R6XA 4WRGA 3C5IA 3VH4B 4YC6A 4TQ0A 4J99A 2D11A 1GJZA 4I4FA 3VTUA 2V7OA 4F9YA 2OJRA 4HYSA 5BPYA 3D9VA 1GZNA 3P1AA 2UW8A 1MQ4A 3I0QA 5CSVA 1YDRE 3O50A 4PS8A 4RSSA 2OICA 5JFVA 3QJZA 2Z02A 2HK5A 2ZCBA 4JIKA 4W9FA 3KL8A 3BBTB 4E6AA 5A14A 3BINA 3H6NA 4KV2A 1Q4LA 3Q4CA 4XG2A 4PS3A 4R5SA 3L8XA 4BKGA 3TNIA 3JVSA 4A3PA 5K0KA 5DG5A 2BYEA 3FY2A 2J0IA 3HYHA 2O6VB 1JNKA 2QCSA 2HTHA 2JY6A 4AN3A 5E1EA 2BTSA 2KLCA 3KULA 4RMZA 4DHZB 1JKKA 2X2KA 3PLSA 2KQ7A 2W1FA 4FV3A 3R8UA 4YSJA 3QGYA 2ITYA 4DH8A 3KCFA 4KINA 3ZNID 3JY9A 3BX5A 4K18A 4AT4A 1K9AA 4CFXA 4O1OA 4TYHA 4C3FA 2W9FB 4A9RA 2OW3A 1WMHA 4MXAA 3GC7A 4FSWA 5HE2A 2MLBA 4NQKE 2JDVA 5HTBA 3LMHA 4U43A 3FMNA 4XZ4A 4CCBA 1YDSE 4NT4A 5L8KA 4D1XA 2XK9A 3GFWA 2J4ZA 4EOJA 3K2LA 2YWPA 3U54A 2BGFA 3CTJA 2YISA 3I7BA 2C5OA 5FGKA 4EYJA 3QWKA 2PZIA 4AZTA 3VS4A 4K33A 1VD2A 5L83A 1A9UA 5C8KA 3C50A 2VTHA 3D4QA 4S31A 2EB3A 4QMXA 4WA9A 3QUEA 4LGGA 4FV1A 2C6DA 4MSMB 3TNWA 2EXEA 5G55A 3C1XA 2RG5A 5C1ZA 4APPA 4CKJA 2PVHA 5IA0A 3LFBA 3P7AA 1ZW7A 4BL1A 2F9GA 3OTVA 3GC8A 5F9EA 2KKCA 4LDTD 1NBFC 4QQ5A 2B52A 1JSVA 2YCQA 4FKIA 4IJPA 4WNPA 3FZSA 5KHWA 3QX2A 4KIPA 2BRHA 4D2SA 4DEAA 4OVUA 3LFNA 4ERKA 5L6OA 4EZ5A 2QONA 4O0UA 2ETRA 3H10A 2SRCA 2X7OA 3UDBA 4BGQA 4CFNA 5IH5A 2UZVA 1UKIA 3QZFA 2GDOA 2R3LA 3QD3A 2GHGA 4BWKA 3PY1A 3HDMA 2WTJA 4GSBA 3D5UA 2RL5A 1V5OA 5IPJA 1ZRZA 3AULA 1NXKA 3MFRA 3O17A 5DHJA 1Z9XA 4U97A 4CFUA 5E9EA 3G0EA 3RI1A 4OTWA 5LMAA 3R8PA 3WOWA 3OT8A 3BE9A 4KB8A 5HE3A 4LCDE 4RMAA 4BDHA 4JLCA 4EK6A 4IAFA 4N6ZA 5CASA 4X2GA 4KDLB 3AG9A 3N32A 5J87A 1I44A 2K8HA 2P2HA 3F2AA 1J1CA 1TBEA 3PRMB 5HD4A 4LDTB 3UZTA 4IE9A 3DU8A 4FMQA 1VZOA 1WX7A 3DBRI 2GCDA 3V62A 2J5FA 2DYLA 3UTOA 3GOPA 3QC9A 3UNJA 3O7LB 4H36A 3F9NA 2V7AA 4CFVA 4CO7A 4GB9A 4LI5A 3W1YA 1U54B 3C9WA 2X39A 3K3JA 4H1JA 3ZXZA 1X1MA 3G9NA 5AR4A 2UZEA 4BCPA 5ANGA 3AU4A 1YWRA 4C4FA 4OBPA 4NCTC 5JHAA 3QQGA 3OWKA 4U0IA 5I9VA 5FUTA 4BDIA 5D41A 3SA0A 1K8RB 2R9SA 4HK2A 3CKWA 3VS0A 1O6LA 3AC1A 4PL3A 3FI2A 4HWIB 4RJ4A 5BVEA 2CS4A 2O2UA 1TKIA 2O3PA 4AW0A 4F65A 3V01A 2YLFA 3FSKA 2BPMA 2WZJA 2XP2A 4GUBA 5CTPA 1H0WA 2E9NA 4MXYA 2WMBA 4YURA 5HX6A 5AA9A 3Q32A 3W2CA 5M4FA 2CHZA 2LGDA 1R39A 2E9UA 4MH7A 3MIYA 3QTQA 2C7HA 4EOLA 4E4XA 4II2B 2MA9B 4EK3A 5AIRA 3SRVA 4BI0A 4TYJA 5HIDA 3AXWA 4A9YA 5M56A 2LWPA 4X6RA 1R0PA 3AT4A 3AMAA 1UBQA 2L7RA 4GG7A 2IBIB 3CD8A 3AT3A 3U51A 1ZKHA 4IUMB 1IAJA 4ANQA 3EZVA 4QMPA 3Q53A 4C33A 3TIXA 5DRDA 4A4XA 1JVPP 4KVGB 3MB7A 4JXFA 2VTNA 4JOAA 3KH0A 3EFLA 3BYUA 5AWMA 4D9UA 5I9XA 1ZY5A 4RZWA 1UBIA 2QODA 4EHZA 5CSPA 1NVRA 3CTHA 2EWAA 3QLFA 3EFUA 4AUQC 4YLKA 4A06A 2FSTX 2UW5A 2JPHA 2PE2A 4YNOA 5FWKK 2DAFA 1JWHA 2M0XA 3DOWA 3SKCA 2JZ3B 4IC7A 5DEWA 3Q2JA 2WMWA 2JBOA 2VO0A 4FTKA 4PS7A 4FADA 4D4RA 1ZWSA 2JDTA 3VN9A 4RX8A 3ZZWA 5HORA 4FZ7A 4NCTA 5GIPE 3PJ2A 3LZBA 3TZMA 4MAOA 2PUPA 2BR1A 5FEQA 2BRMA 2C5NA 4D0XA 4EH2A 2QHOA 5J7HA 3R7QA 2F2UA 1IA9A 4FK3A 2YAKA 4AT3A 1ZARA 3VF8A 3LJ3A 1OKYA 3W2SA 1OEYA 2J90A 3UYSA 4NEUA 3HMIA 4ZOGA 1WBOA 2JKQA 4L45A 3U87A 1J19A 4BKTA 4OTFA 2J0MA 4HCTA 2QHMA 5JQ8A 2OH0E 3MHSD 3PGEA 5LOHA 3ML9A 2C7NB 3QQ8B 3SG9A 3TDVA 4XLIA 2A1AB 4OTHA 2ZV8A 1LP4A 4ALWA 1OPKA 2YERA 4ZSEA 5M06A 2REXA 3DS6A 1AARA 4YTIA 2J0KA 4AA4A 3E87A 4O1PA 3VC4A 2DZMA 2WQBA 1IPGA 3FSFA 1ZMUA 4FULA 2VWIA 1H1PA 3MJ2A 4KA3A 4B9DA 2Y5BB 2BHHA 2WTDA 3FMEA 4FKLA 3Q9XA 4FV9A 3SHQA 4HNFA 3QKKA 4ASXA 2HWOA 3EQHA 3TV4A 5CEPA 3C13A 4MXXA 1OKWA 4H58A 4R5YA 5CWZA 5BYYA 2F7EE 3BYOA 3DBLI 1M2RA 1XH9A 3TNHA 5AADA 1BT0A 1KE7A 1FGIA 5HE0A 4YJNA 3K5UA 5FBOA 4GU2A 4FIJA 4O0YA 4E5AX 4UB7A 1NVSA 4K7WA 4D2WA 3CJFA 3VO3A 4GRBA 4LL5A 2N7EA 4Y5QA 2WHBA 3NZ0A 4IC8A 3UINB 4X2FA 4YU2A 2QKRA 3D14A 1VEBA 4YJUA 4D2PA 4C57A 4TQ1A 4FT3A 4WWPA 3L9PA 4P5ZA 1WXAA 1H1RA 2IVVA 3TEIA 5DR2A 3T9IA 3V6SA 4DHJD 4NW6A 4ASWC 1E5WA 3L54A 4F9CA 5LWNA 2M1MA 1JOWB 4EOPA 2CHWA 2BFYA 3O65B 4AE6A 3HV4A 4E6CA 3H7PB 3MVLA 2WPAA 5E91A 2B53A 2YM7A 1WF9A 3RT3B 2WMVA 5IA1A 4OAVB 2NPTB 2EKEC 3FZTA 5CAQA 4EH9A 3RUIB 4P7IA 3T8OA 2C68A 3RCDA 3DQXA 4QT1A 4FUYA 1OI9A 4DCEA 2XNBA 3BE2A 4K1RB 4D5HA 2ZB1A 3C4ZA 1WX8A 4HCNB 3DAKA 3HGKA 4CZTA 4FJVB 4PV0A 2YLMA 2FAZA 2KN5A 4XP2A 2IZVB 1D3ZA 2PE1A 5K3YA 2RGFA 3A4SC 2XKFA 3CQUA 5LXIB 4W9GA 4MELA 2HCKA 4TZRA 1WM3A 3R04A 3FQEA 5FTOA 3P86A 4WNOA 5AP0A 3VW8A 2OJ9A 5CQWA 4NJ6A 3RAHA 3NUYA 1L7YA 2NO3A 1WX9A 4C0TA 4BCGA 4DEEA 5I4NA 5ANOA 3SQQA 1YX5B 2GMIC 2WX0A 5IA7A 5BVFA 2YVCA 3I5ZA 3RHKA 4FN2A 3QUDA 4IBMA 3EHVA 3EQIA 2KC1A 4FF8A 5BO4B 2ZM3A 4HVDA 4O7WA 3KC3A 2RFDA 3VNTA 5E6PA 4O7LA 4UWCA 5C1QB 4E8AA 1WBTA 2XCKA 3R00A 4HPMB 2LGCA 2NBVB 4IIRA 2GS2A 3ZLXA 3DVNV 2GSFA 5M57A 1E7UA 3A4RA 5IQGA 2G15A 2Y4PA 4K6ZA 4I5MA 1CKIA 4BVUC 3UMWA 1WZ0A 3EQRA 4OTRA 4MDKE 3W1SC 5J2RA 3HAMA 2YEXA 4ZTQA 3MN3A 2OJJA 2PVKA 2XNGA 3NAXA 1V1KA 3SHEA 3A7JA 4CGAA 2OJIA 3CC6A 3ALOA 3GQLA 3AD4A 4TNBA 5LXMA 3QWJA 3O8UA 4D1SA 4I6LB 5LARA 3GCVA 3MH2A 3R02A 2X6EA 4GJ3A 1H26A 5HO7A 4EKUA 5EQYA 2WD1A 4QMVA 3B8QA 2V1YA 2ZJWA 2KDEB 3SDJA 4RM9A 3QQLA 2A19B 3IONA 3AMYA 3MH0A 5IUGA 1IYFA 3GU5A 4KSQA 2P2IA 3DGKA 3OUKA 4MKCA 2OJGA 3NSZA 4NWMA 4GUEA 5ACKA 4M14A 3VS6A 5AAEA 4CKRA 1DAYA 4IVDA 4O27B 4WWOA 4E74A 2Q0BA 4ZTMA 4KSKC 2QO9A 1U46A 2WELA 2WMSA 3ZUNA 2JIVA 1QZEA 1M52A 2Z2WA 3LQ5A 5HNGA 4KSLC 4N9F4 4EZJA 4I24A 4U41A 4UY9A 4BDBA 2Y6OA 4I4EA 5AUYA 1LEZA 1WBNA 4FA6A 1O9UA 4ZTNA 3QTIA 3JSVA 4DDID 5IA2A 3G9LX 4J1RA 4Y5HA 3W8LA 2XRWA 3MY1A 3QHTA 4D4SA 3DJ7A 4BCHA 3AT2A 2QOBA 3LCDA 3P79A 3ZZEA 1NDDA 3ZEPA 2DS1A 4DFLA 3ZDTA 2YJRA 2Z7SA 3VDZA 1A5RA 4FUXA 5KE0A 5KX8A 1EUVB 5L95C 5JKGA 4C37A 2BWFA 4NYEA 3T3UA 5JEBA 3AU5A 3EYHA 2L0FA 4EK5A 2Q0NA 3PVGA 5TT7A 2GBJA 4DAWA 3NUSA 3FAAA 5F20A 4XX5A 3HRCA 3RZBA 4BZDA 3ZOSA 2PL0A 2YM3A 1PMVA 4IZ7A 1H08A 3G6GA 2ZM4A 3CE3A 4RPVA 4M66A 5BYLA 2B0QA 4FIIA 4U79A 2YAAA 4PUZA 2C6KA 1V0OA 2WQEA 3BWJA 4TRLA 4YJTA 5T6KA 4ZY6A 2PMLX 3FC2A 5EW3A 3JVZX 2PK9A 4EH4A 1FPUA 2BWES 3A61A 4QOXA 1F0QA 2AC5A 1IRKA 4DG2E 2VTRA 2M17A 2R3MA 3CCNA 4JQ7A 5AZFA 1H07A 3LXPA 3FXWA 4Z55A 4YLJA 4CYEA 4YSMA 4NFNA 1Q5KA 4KNBA 5CVFA 2BKFA 2GMXA 2BRGA 3KXHA 1PMUA 2IWIA 5AUTA 3MW1A 5D7AA 3SV0A 3UIPB 4FV2A 2K6QA 3QBNA 5K0XA 2BAKA 5AR5A 2FIFA 2VTJA 2LUEA 5BX0A 3NS9A 4S32A 1TQMA 1OZ1A 4AOFA 4GVJA 3P08A 5HCZA 3C7QA 1GOLA 4YHTA 1H1QA 3HV6A 2HZIA 3QZHA 3VHEA 3SD0A 1YW2A 5DI1A 5F95A 1W82A 2C0TA 4FTLA 4Y46A 2W5HA 1ZZ2A 4JAJA 4QMMA 5J17A 1ISNA 4O84A 1XH6A 4LUEA 5CEKA 1Y8GA 2R2PA 4WNKA 4WG5A 3NYVA 5EG3A 3DK6A 1ZGUB 2IW8A 3ZONA 3ZM9A 2QLUA 2X7GA 4L3LA 3SG8A 3VBWA 4FNWA 4XG4A 2PE9A 5EW9A 4S30A 5AUWA 2L00B 3ONSA 4QP3A 5EKNA 2Z7RA 3MH1A 3QXPA 2HZNA 4GFOA 3VBYA 1XO2B 1YQBA 3ZTXA 4ANUA 3RHXA 4ZRIA 2VGPA 3LFSA 4ACCA 2RFEA 2JRHA 3NUXA 4IB3A 1DI9A 2FB8A 3BLHA 3H9RA 4L00A 4ASEA 4W4WA 4FTCA 4NM5A 1WIAA 1AD5A 2CDZA 5AP3A 4A9UA 4E3CA 4NY0A 1UH6A 4R7BA 2YDKA 3Q9WA 4EKLA 4ZTHA 3ZSGA 5G6VA 5CNOA 3HL7A 3KF7A 5CYIA 5D1JA 3E64A 2GNIA 4ZJVA 1UKHA 4Z7GA 5TR5A 2VO6A 4MBIA 2QOQA 4JDHA 5J95A 4F0FA 5FDXA 4CZYB 3ZLZA 1H0VA 2IPXA 3F6XA 3ACJA 4Z3VA 4USFA 3IPHA 3T3VA 3I0OA 3R01A 4FSQA 2H34A 4G3FA 4O0XA 4ZP5A 2E2BA 4PL4A 5FRIA 2L05A 5IQCA 2C60A 5C01A 1F5QA 2RFSA 3DPDA 3OG7A 4R1VA 3ZO3A 4JI9A 4AS0A 3ZNHB 2F57A 4ZMFA 5F94A 4L3JA 3E3PA 3SU8X 2R3GA 4YTHA 5JGAA 4KIOA 4G9CA 4GIHA 1XKKA 1S3SG 4HVHA 4MYGA 1OB3A 2B55A 4NU1A 2XIZA 3CSFA 3MTLA 3FI8A 2ZYBA 4RJ8A 4I1ZA 3EJ1A 4PDPA 2ITWA 4AOJA 1GZ8A 4RX9A 1JKSA 4UYAA 3E7VA 2FVDA 2VTAA 4U45A 4NL0A 2X4FA 4GK2A 4M84A 3WBLA 4YZNA 2G2IA 3ULIA 3NVKI 4FTAA 1TZ1A 3HAVA 2MX2A 4FEWA 3H9OA 4CQGA 2QOLA 3PVLA 4L67A 4Y72A 2PY3A 4FKTA 4ZZOA 2UUEA 1P0RA 3DBHI 2QR7A 4DE4A 4ZLYA 2R2OA 3KRWA 3ZYAA 3DV3A 5TOZA 3ZNGC 2R0IA 3PSDA 3PFQA 4X21A 4ZYNA 4I22A 5HBEA 3ZO1A 5IG1A 5H8BA 5CXZA 1KJTA 3RZWC 4QTCA 1Q61A 5E8TA 4DTKA 3ENHA 2RIOA 3KRXA 3PTGA 5EW8A 3SXFA 4BDAA 2UZNA 4MXOA 3UIMA 4D4YA 3ORMA 3W2RA 4AFEA 5A46A 3EN9A 2UVXA 2AUHA 4EJ7A 3KUZA 4E1ZA 4I6NB 2JFLA 4QP1A 1PY5A 3EH9A 3FYKX 4YO6A 3U8WA 1TGZB 3E8NA 2J0MB 3PSCA 1M2PA 2ZPYA 4YUQA 3DKGA 2BVAA 3LM0A 2F2CB 2UVZA 5TE0A 3LKMA 3RK7A 5AP5A 3KQ7A 4JRNA 4RVTA 5E8VA 3OOGA 3MVHA 4RQVA 4LRMA 2YM4A 2KD0A 3OJ4B 2VD5A 2VWBA 4RZVA 1UV5A 5IDNA 1YOJA 3II5A 5CX3A 3UVQA 4IWOA 2GBRA 1GJOA 3V8TA 4IM0A 1LPUA 5D11A 1AQ1A 3D0EA 3MFUA 4QNYA 3FXXA 3FMMA 4BTFA 4X57B 4C02A 1A06A 5CVHA 2OIDA 4I6HA 5CZIA 1QPEA 1J91A 1UNLA 1XH4A 3QQUA 4FEQA 4R8QA 5G1XA 3E8DA 3GVUA 4MF0A 3VULA 1RRBA 3BY4B 3VUYA 3A99A 4AJYB 3D15A 2CSNA 3LW0A 4PDYA 2VAGA 2XCHA 4G3CA 4CFFA 3W33A 3ID6C 5CLPA 2UZOA 4AZEA 3VVWB 1PXMA 4W8EA 4BIEA 1Q8TA 5DRBA 2VTIA 4PQNA 2W4JA 4CLIA 4F63A 5EH0A 1ZMWA 4OGRA 5HCYA 3S00A 2DENB 3DLSA 5IQFA 4LOQA 4NNJB 5IF1A 3FQSA 3TBLD 2I0EA 3E5AA 5HG5A 3DB6A 4X3JA 4YZCA 4HNIA 4BVUA 4EQCA 4DEIA 3RYTA 1IEPA 1P14A 3KF4A 4L3PA 4J7BA 4F0IA 5M53A 1WGDA 5ANEA 3UO5A 3COKA 4RBLA 2V62A 2LGYA 2XKCA 3A9JB 2BZKB 3OBGA 4LOPA 3KK8A 3OF0A 1ZZLA 2WAJA 4M69A 5HKMA 3VS3A 4AACA 5DT4A 4BTMA 4GN1A 3TIZA 3W16A 3TNPC 5AUUA 4YJSA 5F4NA 4W9KA 3IGOA 3BBWA 1H28A 3C4CA 1APME 4FLHA 3WAPA 4BKZA 2MW5A 4FHKA 4DDGD 4FKRA 4XG3A 1W98A 4MEDA 5EHLA 5JT2A 5CT7A 2GFSA 3CPBA 3F5XA 5ITAA 3PJ3A 4ZAUA 2GNHA 3HV5A 3FC1X 4DBGA 4YTFA 3WANA 3IVFA 4JBOA 2PU8A 3R1YA 4NUSA 1W83A 5AR2A 3OCTA 3HHMA 3V6RA 5DIAA 5FG8A 2BDFA 3EHAA 1JQHA 2G2FA 1U54A 3OC1A 4CT1A 1WGYA 1KOAA 3U9NA 2XA4A 5IA3A 3KYCD 4R77A 5HX8A 3G15A 5FTGA 4U3YA 1RDQE 1XH7A 5CU3A 1WH3A 2KWCA 1NVQA 2B7AA 3PY3A 4N6YA 1LR4A 4QYHA 2OXYA 3R7RA 4RFZA 3S2AA 5E92A 2W1DA 3PG1A 3DJ6A 3RWPA 4J53A 2VTMA 3JXWA 4KBKA 2BIYA 5BVDA 4QTEA 3DOGA 3ZS5A 4C2VA 5EM8A 3Q6UA 3P7BA 3QQHA 2AWTA 2F4JA 3NHEB 1REKA 1WXVA 4ZTRA 2HIWA 4GSWA 3Q3JA 2GNJA 3QRIA 4LMUA 2O2VA 3IQ7A 5FLFA 3DBFA 4QQTA 3PUPA 3HKOA 2DZIA 3HNGA 5EM7A 2CKOA 2WQMA 3QKLA 5JH5C 4B0GA 3A33B 5JQ5A 4OTIA 3MV5A 3RAWA 2XRUA 3P4KA 3EKKA 4HGEA 1ZYCA 2ITOA 4FK6A 3EOCA 4IHPA 5FDPA 4C4JA 2RFNA 5CX9A 2LD9A 2BTRA 5EDSA 1NW1A 2CR5A 1TQIA 2OZOA 3NUNA 4LMNA 3RZFA 4FA2A 1EO6A 4K77A 4G17A 3VRYA 3COHA 3ZEWA 4O2ZA 2IZSA 4BTKA 4DH1A 5GZ9A 3HDNA 3MVMA 3NW5A 4U7ZA 4XCUA 4NJ3A 3RM6A 3UQFA 3BHHA 3S2PA 4KBCA 4M13A 3MWUA 4BDDA 5J9ZA 5LCJA 1WE7A 2CN5A 2NRUA 4ZK5A 5DPSA 2OU7A 3NVMB 3EL8A 1FQ1B 4ZJJA 4IWQA 4D4VA 5L3AA 3DDPA 3BU3A 4DINA 5KMMA 2QD9A 3DBCA 3OFMA 3QTUA 3PLVA 2X8DA 2XIYA 4QMTA 1M14A 1P5EA 3ENMA 3VS7A 4ANBA 3KXXA 2W99B 3HMOA 4DITA 4H05A 3VVHA 4W4YA 4BCJA 3RINA 2OF4A 4F9BA 3KA0A 3QTZA 5EYMA 2HXLA 3W32A 3WZKA 5CHWA 4HGTA 4F6UA 3QL8A 4Z9LA 5EDRA 1VCBA 3I3TB 3P2BA 2BKRB 3D2KA 3FE3A 2NR2A 1XWSA 2R3PA 4UYNA 2X9FA 5CEQA 3WYYA 4GDKB 5IA5A 4K7SA 3EFKA 2K39A 3WE8A 4FIGA 1NY3A 5B7VA 2NS5A 5H2UA 4BDKA 1WVXA 3QRKA 4PPBA 3M1SA 3TJCA 2QOFA 2W4OA 3BGPA 3QIJA 4PL5A 4RM8A 2YCSA 2WIHA 3JVRA 3HZTA 4N70A 4C7TA 3VQUA 5CALA 4FHJA 2VNWA 4EBWA 3QXOA 2Y0AA 1CKPA 4FTOA 4NTTA 2WEVA 4S33A 5CT0A 4JGHB 2KMCA 1U4DA 4OUCA 4YJVA 3A8XA 2QG7A 4GK3A 4TPTA 2HWPA 3EL7A 4UN0C 2EB2A 3IBEA 4J97A 4M0ZA 3QHRA 5EI8A 4IG7B 4DEBA 1YOLA 2YZAA 3PWYA 1PMNA 1XQQA 2DZKA 4HYUA 5HEZA 5E7RA 1P4OA 3E88A 3PIZA 2GNFA 2OIBA 3OVVA 3V51A 1XBBA 2R4BA 1WVYA 2XIXA 4C34A 1OPJA 3H3CA 4I0SA 4OTGA 1PXPA 3R1SA 2W1IA 5T3QA 1R0EA 3TZ7A 4EQMA 1LFDA 5D94A 1CTPE 2PWLA 3PE2A 1V6EA 3KULB 4KRCA 5JN2A 4BFRA 3H7SA 4ITJA 1WI0A 3MY0A 2W1CA 4GK4A 4GVAA 3ZFXA 4CEGA 2RF9A 3BHYA 2Y7JA 3ZBFA 4TY1A 1WYWB 3L9NA 2CGXA 2N9EB 1EF1A 5H3QA 1QCFA 5GMVA 4CG8A 3N30A 2OK1A 5KMOA 1GIHA 3SD5A 4XP3A 1FVVA 5AUZA 3VJOA 3KXZA 4DF3A 3F61A 3HV7A 4ZSJA 4M68A 3PS6A 3GOEA 2Z7QA 3E8CA 4M3QA 3TACA 2JXXA 4II5A 4K7UA 4O7NA 4O2PA 4LYNA 4EI4A 2Z60A 3OBJA 4R1YA 4XV1A 4GT5A 4C62A 2QG5A 3NEWA 4I0TA 4CVAA 3VUKA 2VGOA 4FKUA 5AAFA 4XV9A 2BKZA 5FP6A 4HJOA 3GXLA 4X2JA 3QX1A 3Q3BA 3RTPA 3E62A 3L8SA 2PVYA 4LL0A 4IC7B 1PMEA 2IZUA 3P23A 4W4XA 1PKGA 5CVGA 3HRBA 4O0WA 4EUUA 3DPKA 3I5NA 4MX9A 5KBQA 4LJPB 1WR6E 4DFYA 4P5QA 4BDFA 2VX0A 2UW7A 3GCQA 3D5XA 3PZEA 5LWMA 3NAYA 1IASA 1HE8A 5C9CA 4U5JA 4ZS4A 4E6DA 3RNYA 2KX3A 2YIYA 4UEUA 4U80A 2IO3B 4A20A 2XBJA 4FGBA 5FBNC 3UODA 4F1SA 2WNTA 4C4HA 4EUTA 4AAAA 3JSVB 4OBOA 3PA3A 4KZCA 3MI9A 3BLQA 3OY1A 5J8IA 2B9FA 2CJMA 3QQFA 3ZCLA 3ZUVA 4ACGA 3R2YA 1PRYA 3SRVB 1CDKA 3KGAA 1E90A 2BIKB 3F66A 2HW7A 3V3VA 3ZM4A 3HEGA 3FEGA 2CLQA 5JGDA 1OPLA 2DQ7X 3TV6A 2J0LA 1M94A 1XJDA 2CGVA 1RE8A 2XS0A 3OS3A 4NKAA 2PEAA 4FVQA 3L16A 2YCRA 3MIAA 3PXFA 4A9TA 1WJ4A 2QURA 1YWNA 2N7DA 5EYKA 3PE1A 4KKGA 3KN5A 5DGZA 3IOPA 2WU6A 3HMMA 3ZH8A 3QRUA 1Y91A 4XP0A 2AYPA 2DZJA 4GXBA 2YIRA 2X2MA 4M8NA 1J8CA 3F3ZA 4AOTA 4ZJIA 5FP5A 5AR3A 4QMWA 3ZUUA 1RFAA 2ZV2A 3FI3A 3UIUA 3SW7A 4HCPB 5ETIA 3O8TA 4D1ZA 4RX5A 2GNGA 3RCJA 3ZVVA 5E6NA 3PIYA 4IZAA 2UW9A 4O38A 4WKQA 4GG5A 3UNZA 5L2IA 4CD0A 4QMNA 3SVVA 5KMJA 3ATTA 5CEOA 3KXNA 2VNYA 3RMFA 4YL8A 2O6VD 5ANDA 4A9SA 4DH3A 4FSNA 3WF6A 3UPZA 3DVGY 3UGBB 2LRUA 2XZSA 4EWQA 5M4UA 3LQ8A 5C4LA 3SLSA 1Q3DA 4IX4A 1P9DU 3TXOA 2F49A 3AOXA 3VF9A 2MSED 1VYZA 3DTCA 3ANQA 3A2CA 4FT7A 5AM7A 4EH3A 4FOBA 5HVJA 4BWPA 3TN8A 4QYEA 2JVCA 4LRKA 2LXCA 3A7GA 4ZDVA 1YX6B 3LPBA 4CFMA 4TYEA 5CEMA 4OVVA 1H8CA 3IDCA 4U42A 4RWJA 3MSSA 4ZSLA 4DFZE 3LCKA 4EK4A 4WRSA 2ZV9A 3OMVA 3QD2B 2R3IA 5DVRA 2BYFA 2FH9A 2XK5A 4TT7A 2WU7A 5AAGA 3DCVA 1OGUA 4DG0E 2DAJA 2Q83A 3VBVA 3MA6A 3TKUA 2HW6A 1G8AA 4EH5A 3PRIA 3Q4TA 3PIXA 2PMIA 5AV3A 5AZHA 1Q0WB 2VWVA 4UWYA 5ANJA 4V05A 1OVEA 2I0YA 4FOCA 3ORLA 4QPSA 4DBNA 3BEAA 3LFDA 4OT5A 2JEDA 2R2QA 4EZLA 3TUCA 5KMNA 2R7BA 4I41A 5DLSA 5KBRA 2ZM1A 4IVAA 1W0XC 3APFA 5B0XA 5IH6A 4UBAA 5LMKA 2G01A 4AQCA 1IA8A 3H7PA 1WMHB 4JT3A 3FQHA 4RJ7A 2YCFA 4LQMA 4BC6A 3UIXA 4P4CA 4S34A 1XH8A 4BBMA 1Q5WB 3PJCA 4RLLA 5CNNA 2BILB 2VTOA 5BMMA 3AMBA 2I7QA 1Y6BA 4FEUA 4X2NA 1E8WA 4JIAA 2C5LC 2XM9A 5AP4A 5LVMA 4DK5A 2PMOX 3IG7A 4O6LA 5GJDA 4H3QA 2BPSA 3PHXB 3FZOA 4EONA 2R64A 3R1NA 1J7IA 3GU8A 4CSVA 5ACBC 4HGSA 3V04A 1BMKA 1O6YA 5D9HA 4YP8A 4L44A 5CU0A 4KIKB 4RLKA 3C4EA 4RIOA 5L6WL 1E7VA 3MESA 2W5AA 2XK8A 3ITZA 3ZFMA 3F7WA 2YM8A 2BF8B 4NM0A 4ALUA 1MRVA 4HOKA 3B2TA 5AIKA 3UO6A 3HM6X 3U7DA 3CTQA 2VWWA 3LVPA 5EYDA 5M4IA 5IEVA 4H1MA 4C59A 3JR1A 3W2PA 4PNKA 5EQPA 3RGFA 5HKHA 2MCNB 1YWVA 5AM6A 5C03A 1R78A 3OXIA 3OW4A 4MXCA 3O7LD 3OEZA 3X0WA 3OOMA 4XBUA 3FJQE 4PPAA 4TL0A 4ZTSA 3UOJA 4RC2A 5TKDA 4NAWB 4JRVA 3FXZA 4QMQA 3LXNA 3ZSHA 3Q5ZA 5H8GA 4BFMA 4F7NA 2V4LA 3HRFA 3TG1A 3WILA 3F88A 5KCVA 3NNVA 3LMIA 2LASA 2UYZB 4I23A 4ZY4A 1KSWA 1YIWA 2WMUA 2JC6A 3IECA 3R9HA 1F3MC 2V0DA 2XNNA 1ZOGA 3FZRA 5DR6A 3M42A 5AZGA 5IQIA 4XUFA 4Y8DA 4YJOA 3VBQA 3R7VA 1KOBA 1GNUA 2ZJDA 2K8BA 2NCNA 4WQOB 4FV0A 2WDTB 1CMKE 3ZKJC 3U4WA 3WARA 4FTMA 3ODZX 5CAVA 3MPMA 3EB0A 3DT1A 2EMSA 5HTIA 4ITHA 2LVPA 5B2MA 5JH6A 2CNQA 3FZ1A 4NSTA 5L2TA 1OUYA 4IZYA 4FSYA 3MYGA 3R7OA 3LM5A 3F3WA 3ZDIA 5LJJA 2HAKA 3D7ZA 5J1VA 3GBZA 1IG1A 3R8VA 5IA4A 3T9LA 3FLNC 2VU3A 5H8EA 2JZZA 4YMJA 2WTCA 2OKRA 1Z2MA 4IZ5A 3IHPC 1YJ1A 3PLUA 2RKUA 4MNEA 1DI8A 3QFVA 4RWLA 4CQEA 2C3JA 5M08A 4BBNC 3UO4A 4MQ2A 4CTCA 4E4MA 4G11A 4IW0A 4PYZA 4FV7A 4R7IA 3JYUA 4L6QA 1DAWA 5CANA 4YBKA 4I0RA 2CKPA 2NNWB 1WBPA 3KREA 3UVRA 2KFJA 4KD1A 3I60A 3FMHA 3IW5A 3FDNA 3OUNB 3VUTA 5EKOA 2XNEA 3KRJA 4L8MA 4FL2A 3ZLSA 1XH5A 3UQBA 2PJHA 3R7IA 3ORTA 5E6OA 4DBXA 4OTPA 4DTAA 2IVTA 3R28A 2ZVAA 3GFEA 2VZ6A 3BQCA 4J52A 5IEYA 4EHEA 2XK4A 3D94A 1URWA 1O6KA 4L42A 5HGIA 5BNJA 3PYYA 5AV1A 3M62B 1V81A 3WZUA 3N4UA 2D07B 5FEEA 2OIQA 2HE7A 4BHNA 3KUCB 1CMXB 4M8TA 4RT7A 3R66C 2PVRA 1OGWA 3OEFX 4FL1A 2C6TA 2FCQA 4FTRA 4A07A 4ANOA 3MJWA 3IK3A 5HTCA 3MB6A 2AL6A 5HO6A 2KTYA 2J9MA 4KIKA 3ALBA 3DVNU 3N4TA 1V86A 4MD9E 5HOAA 5IH4A 2WOUA 1WGRA 4JDIA 2ZVNA 4YJQA 4ANNA 4IFGA 3UF8A 4BKSA 1YKRA 2BDJA 4JX7A 4UZHA 1WVWA 5IAAC 5BYZA 2C1AA 2EXMA 4CNHA 1E9HA 4I5HA 3PVWA 2ZMDA 3BWFA 3V5WA 5LVPA 5EM5A 3R0TA 4I92A 2YN8A 2GU8A 2ITQA 2Y9QA 1WRDB 4WAAA 5KHQA 3CSVA 4Z16A 1V2YA 2XNPA 3NUUA 3AGLA 5ANIA 1PXKA 3DXQA 4G6LA 2W06A 3CXWA 2VTQA 4DEGA 3PWDA 2C6OA 2KQSA 4JG7A 4DFNA 4MVFA 4P7EA 2YDJA 2W4KA 1PKDA 3GENA 5AX3A 3UOLA 4AN9A 2KDIA 3V5QA 1UA2A 2IVUA 3OD6X 3ZRFA 2CN8A 4FYNA 4PDOA 3TT0A 4B99A 5M44A 3T9TA 2ETMA 3LFFA 4ACMA 4GKHA 3C0RB 2QO7A 3GT8A 3EQPA 4L43A 5I9YA 2Z0EB 3FMKA 4YZBA 5HD7A 3DTWA 4DLJA 1ZYLA 1A48A 2OBJA 4MNEB 3BV3A 2GOWA 3QAME 3VUDA 1LEWA 2ZDTA 2VRRB 4XG9A 4DGMA 3F82A 2XK5B 1ATPE 3F5UA 4WG3A 5AP1A 2X8EA 3E92A 3RPRA 3Q04A 3X23A 1G8SA 2PUUA 3L08A 2QI8A 4PTGA 3QWZB 4ZZMA 2RG6A 2Z8CA 3ORZA 3UJGA 3Q4UA 3QKMA 5AR7A 3E63A 5JFSA 5D10A 1GIJA 2BYVE 2J0JA 2YIQA 1OIUA 3PVUA 3PV1A 1GC6A 3KU2A 3KVFB 3H9DA 5A4EA 2R3OA 4FG9A 3KXMA 3BLRA 3PRPB 3R71A 3IGGA 4H3PA 4LOOA 3UP2A 3W2OA 4DC2A 2LGXA 2IO0B 3G6HA 4TYHB 5GZ8A 2ESMA 2XK6A 3VUIA 3OY3A 4X7QA 3I79A 4HVSA 1WBSA 4K11A 4YTCA 2GBKA 4MBLA 2K6DB 2WTVA 2HXQA 2YFXA 3RKBA 3OAWA 2Y4IB 2LAVA 3IO7A 3O96A 3DA6A 3RD2A 1HCKA 5JZNA 3HK0A 4G6OA 2HELA 3HLLA 3G0FA 4D9TA 1FGKA 4F7JA 2NP8A 4DA5A 5EI6A 3LQ3A 3EWHA 1S9JA 4GU6A 3S3IA 5TF9A 4AA0A 4FJZA 2CKQA 3BPRA 3CKXA 4FC0A 3RNIA 2GHMA 1OIQA 3FLQA 1SNXA 4D58A 4DHFA 3ET7A 3KVWA 5GHVA 3S0OA 4Y83A 4AUAA 3OWPA 4EOSA 3F5PA 3RK5A 5AEPA 1B38A 4IX3A 4KKHA 3ELJA 3RPVA 3FLZA 2ITNA 5A6OA 4PP9A 5IMXA 5LXHA 2C69A 4IAIA 4ZIMA 5E1SA 3LLAA 4GKIA 5J18A 2CNVA 1OM1A 3ZFYA 4C35A 1OL2A 5HE1A 3A4PA 3UC3A 2O63A 3WIKA 4Z7HA 4N57A 4ZRJA 4ZSAA 4HVIA 2LXAA 4E7WA 1KE5A 2R5TA 2V3SA 4XOYA 3MA3A 3LJ2A 3HIZA 4BOZB 3C0HA 4EFOA 3V5JA 1J0GA 4DH5A 4G5JA 3A1QA 3BEGA 4I94A 4TNDA 2W1ZA 4F7ZA 3CBLA 4GMVA 2ITVA 4RVLA 4AA5A 2P4IA 3FZPA 2GBNA 4QTDA 1OEYJ 4AJWA 1UD7A 3RPOA 4F70A 3UQAA 3DY7A 4HYIA 3DLZA 4AE9A 4KS7A 3TL8A 5CU4A 4TUUA 4USDA 3PPJA 4M97A 1Z5MA 3B08A 1H01A 4FSZA 4BBNF 4WJOA 1OIRA 4O21A 5DPRA 4DFBA 4V0GA 4BGGA 4FEXA 1JPAA 4FEVA 4FTQA 2ACXA 4A7CA 4DFXE 4FKPA 3UIOB 2ZB0A 3WF5A 2C5XA 3BV2A 4G3GA 3WIGA 1JSUA 4MBJA 3NR9A 3VUWA 5E8XA 3IDBA 1KUTA 2W0JA 5JZEB 4D5KA 4KIQA 2JBPA 3LCTA 3P9JA 4XHKB 4C4EA 3PXQA 4C3RA 4JG8A 3PPAA 1ERKA 1SZMA 4EHGA 4K1BA 4L7SA 4GGQA 4MWHA 4I6PA 5FXRA 3BYSA 3D83A 3KEXA 1SIFA 4GL9A 5IEXA 4GDLB 3ZRMA 4O7RA 4MJSB 1G3NA 1BI7A 4G16A 4WD5A 1CSNA 2GFCA 2C6IA 3R22A 4M12A 3NIZA 3BZ3A 4IH8A 3V5TA 5B2LA 3DNEA 4J8MA 3RM7A 3ROCA 1Q8YA 5J79A 3KFAA 3NLBA 3CR0A 4QQCA 3V8WA 3WI6A 4BCIA 4CFWA 4CT2A 1V49A 5DCNA 3ZO5B 2N1VA 3F3UA 4EKKA 2KOXA 3V8SA 4QMUA 4EOMA 4J6IA 1QMZA 3TCPA 2B1PA 4Q5HA 3BU6A 1H00A 4NTSA 3ZU7A 5KHXA 3FKNA 1WM2A 4WJQA 2JFMA 2QR8A 2X6DA 4XLVA 5KMLA 3LHJA 4AGWA 5CSXA 3DVGX 2FA2A 2BFXA 3RBWA 1OL5A 2A4LA 2JD5A 2QOHA 3HP2A 3OZ6A 5G2NA 3TWJA 4J98A 5GZAA 3F69A 2W05A 4XH6A 4RIYB 2KTRA 3KRRA 3HUBA 2VX3A 3VH3B 4O7VA 4MM3A 3D7TA 4QP8A 1YXVA 2WB8A 5CZHA 4G3DA 5LLIA 1SVEA 4PPCA 4YPDA 2FCNA 5A4QA 2GS7A 1FMOE 3Q6WA 3PREA 4NPNA 3KN6A 2KULA 3SXRA 3TUDA 4PY1A 4RFMA 3U9CA 4LV5A 4TYGA 1Z57A 1BI8A 4NKSA 2G2HA 2WKMA 4FT9A 2KZRA 2JDSA 3E8EA 5GNKA 2D10A 4PX6A 3IDPA 3DKCA 5AJQA 1WGHA 3QTSA 1JLUE 1URCA 4LGHA 3DFAA 3SW4A 2BZIB 5DNRA 1MRUA 2VWXA 4EORA 4E4LA 2PSQA 5CENA 4EC8A 3EFWA 1UU8A 1H4RA 4GDKA 3SDLC 2HD5B 3Q4ZA 4YZMA 5K9IA 2MBBB 2ZMCA 4FT5A 3ZC5A 4AN2A 4EZ7A 3ALNA 1SVGA 3G90X 4HW7A 1G5SA 5FXSA 2EMTA 2KX0A 3M95A 2KJHB 3VFKA 3HP5A 4AGUA 1MUOA 4UXQA 4CXAA 3F3TA 4PF4A 4JBQA 2L76A 3ORKA 4TWPA 3JS2A 5L2QA 3IS5A 4W9IA 3NNXA 4EHVA 3TJPA 1JAMA 3D5WA 3R30A 5CI7A 5BUEA 4BTJA 5CF5A 1GNGA 3W2QA 3ZIMA 1WJ6A 4O82A 1M7QA 4F6WA 1J3HA 2A5UA 3CGOA 3HA6A 1RW8A 2DUVA 2XEYA 4IAYA 3I1AA 3PT2B 4U9AA 2Z59B 2ZZPB 5DT0A 3PPKA 5A4CA 3WAMA 4TWCA 4O7ZA 4LV8A 3LCSA 5K5NA 4FSMA 3ETAA 5CAOA 2ZVOA 3NDMA 4FTIA 4DH7A 1R4MI 1H24A 4MWIA 3MTNB 3W8QA 3T8MA 2PZPA 3ACKA 3NY5A 5IISA 3ORNA 4BI1A 2PVNA 3TTJA 5B2KA 5JMSA 4E5BA 4R3CA 3R9OA 5JFWA 2XEWA 2RSUA 1YHSA 3CD3A 3DFCB 3PSBA 4UMPA 4JVGA 2O8YA 4RJ3A 5DOSA 4G3EA 4GOCA 5DPTA 1PXLA 3ZDMC 1WJUA 4EOKA 5J7BA 3QTRA 1WY8A 4WIHA 3ATSA 4EOYA 1RAXA 2I40A 4TKSA 2O2VB 3OXTA 1PJKA 2XYUA 1H8FA 3O0GA 3A1QB 1LQBA 1GAGA 3TTIA 4AZFA 5JSMA 3ZW3A 2C47A 4NAWA 4U40A 5HESA 3HMNA 3L1SA 4W9XA 3DK3A 4BCOA 3ORPA 1Z5SB 3K9OB 4F1MA 5HVKA 2EU9A 5FR6A 5E4HA 1UNGA 4RC4A 4EH8A 5KMIA 3BHUA 3QF9A 1H4LA 4UMTA 5M09A 2VN9A 5CSHA 5HG8A 1ZYSA 2PZYA 1Y8RC 3EYGA 5ETFA 3TL5A 4FZAB 4NIFA 4ZMEA 2FCMA 2N4FA 2PUNA 5IQBA 3G33A 3RPYA 3TDWA 3VQHA 3IW6A 3ZRLA 1WCCA 4S2ZA 4DEDA 2C6EA 3VUXA 2XJ2A 3BYMA 4WBBB 4BZNA 2I1JA 3KCKA 3UE4A 2E9PA 4O91A 4WUNA 3R21A 4XS2A 5HU3A 2XBAA 3BHVA 5GJFA 4QRCA 2O0UA 3FLYA 4UZDA 5HBJA 4BY9E 4JG6A 5BVKA 3I6UA 4FYOA 2FSMX 2BRNA 1KE8A 3GU4A 4IAAA 4EH6A 3ANRA 5JZJA 5DN3A 4AFJA 3DDCB 4MGYE 3FV8A 4GIVA 3PRFA 1L8TA 5EQEA 2W9NA 1PXJA 4B7TA 5AV0A 2IG7A 3NX8A 4QMYA 1XHAA 3G51A 3KB7A 3SAYA 4U6RA 4PYUA 2BRBA 4DG3E 4WWNA 3CEKA 1K2PA 4M0YA 1OL6A 4O0RA 5IQAA 4M69B 1SNUA 3IG3A 4JS8A 2JLDA 3A9JA 3ORXA 1UZXB 4QMSA 3M3JA 2ITXA 2YIXA 4AU8A 3I81A 2M4NA 1KLVA 1W8CA 4ZY5A 3UG2A 2P55A 3HVCA 4PMTA 3LOKA 2G3QB 1ZYDA 2PYWA 1OMWA 4DT9A 4RRVA 4FZFB 2BHEA 2FSOX 4JQWC 4QYGA 4EL9A 2WMQA 3C0GA 4W9LA 3IKAA 2W1EA 4H39A 2RD0A 2YM5A 5KZIA 3R9NA 5HNIX 3KUDB 4KZ0A 4RQKA 4F7SA 5KO1A 2GQSA 1RJBA 5EDQA 3R8MA 4F99A 1YDTE 3OJ3A 1JSTA 3REPA 3U6HA 3H0ZA 4NJ7A 2KVRA 4EH7A 3IOKA 2BMCA 1ZAOA 4LFIA 4YZDA 3KKVA 2ZV7A 2RSVA 4KRDA 4EYMA 1Y6AA 4HPUE 1M17A 3GQIA 3PXYA 2HZ4A 2JDRA 5BUJA 4DEHA 5HBHA 4G9RA 3TKIA 5L2WA 3RAIA 1GG3A 3THBA 1WGGA 1ZOHA 2VWYA 3VTWA 2WIPA 2C3KA
chains in the Genus database with same CATH superfamily
4BKYA 4YJRA 5DEYA 5A6NA 4AZHA 3KAVA 3PP1A 4DWFA 3PY0A 1OBDA 3R2BA 4MSQB 4L53A 2FSLX 3AI5A 3AE8B 4LLGM 3TNQB 3B53X 2I38A 4UXLA 5CS6A 4FKSA 2C5VA 2YABA 2G4DB 1HXYD 3NW7A 5JK3A 2QOKA 4F6SA 4X0MA 4U8ZA 5AMNA 1PXNA 1N63A 2L83A 3O71A 4LUDA 5JXVA 3AE3B 5HVYA 2FCSA 4QQJA 3G9GA 2PTLA 5F1ZA 2BZJA 1EH4A 1I4PA 4RIXB 1GY3A 2F7ZE 3SC1A 3DBQA 2R3NA 3WZDA 5J9ZA 2QO2A 4UALA 5T68A 4O22A 3PPZA 3RV0A 4AT5A 2WXFA 4US8A 5KHOA 4BCKA 3L9MA 3Q84A 3ML8A 2RPQA 5HLPA 3P4QB 3QD0A 1V0BA 3P42A 2NPTA 4WQMA 4GEOA 4U44A 2GQGA 1H1WA 4FKQA 2QU5A 3KYDD 4FNYA 4E6QA 4D55A 3UZRA 1GOZA 4S17A 5G5HA 1D5XC 4GV1A 4IANA 1W7HA 1PFDA 3PA5A 3BK1A 4HXDA 1I4XA 2LM0A 2RDBC 1X8BA 3ZTDA 5IQHA 3F3VA 5C8MA 1V97A 4QTAA 4A3OA 4JBVA 2JAMA 4AW1A 2F1AA 4AZIA 4FV5A 4RWKA 2ONLC 4X3FC 2JNSA 4P2KA 4E5WA 2Y6MA 3QYZA 5HLNA 4EWHA 4HJKA 5FQDC 5AR8A 4C4VA 4MQ1A 2KK8A 1XR1A 1KWPA 3B2WA 4N0SA 5EI2A 5EOLA 3U4UA 3SOGA 3NVYA 5D7GA 3OWLA 2N9XA 4WT6A 3SFDB 5BQ0A 2PW9A 2A27A 4TSSA 2OZAB 4F1OA 5DA3A 5A3XA 2BQQA 4O7TA 2OI4X 1Q97A 2BAJA 2VTTA 1J7BA 1BX6A 3KMUA 4IB0A 1F2RI 2UWQA 4MGZE 1IAHA 2JKMA 3CV5A 1WZ3A 4W4VA 2XAOA 2QU6A 4NW5A 5EHOA 3DCGA 4H6HA 4BHZA 2L8JA 4YTMB 3UMXA 5E8ZA 4IFCA 4M15A 3ORIA 4L7FA 5EK7A 1RYJA 2FYSA 4NZWB 5HICA 2QOOA 2J5EA 3A8WA 4BDCA 5JHBA 3I2WA 1FXIA 1MJDA 1CKJA 3NZSA 2QHNA 5J5SA 3AE7B 4WO5A 4QMZA 3RVGA 3J9CA 3QYWA 1MG8A 5LVNA 3R8LA 1P2AA 2PULA 5DWRA 3Q5IA 4Q2AA 4M67A 3BVMA 3D32A 2HZ0A 4FTTA 1ZP0B 3SGCA 4ACHA 4G2FA 3EQBA 3QWEA 3SYVA 1KF6B 5HO8A 3LVTA 4R3RA 2BTEA 3KXGA 4WJNA 5HG9A 4IDTA 4HRSA 2N1WA 4FV8A 5BVWA 3KVXA 5H92C 5JRQA 5FEDA 4BF2A 4HDQA 3E3BX 3V3XA 4FGRA 3NNUA 2WYIA 1WJNA 3U55A 2VO3A 2R3QA 3AEBB 2L3ZA 2FUMA 4YSXB 1XF5L 4F1TA 5IKWA 1Y8YA 2JAVA 4CTBA 2V4IB 3QLGA 4AGDA 2FNJB 3L17A 3HECA 3DNDA 3TZ8A 3NCGA 1RWSA 1XMMA 4QP4A 2W1HA 3I57A 4F7LA 1B9RA 4K0YA 3OT3A 2YA9A 5FXQA 2JRIB 3VBXA 3QQKA 5CI6A 3HX4A 1RLFA 3BHTA 4PTCA 3K3IA 3Q9YA 4Q5EA 2IJ0A 1YRPA 1WXSA 3V6CB 3HUIA 3VS5A 4FKOA 4RGOS 4JNWA 2XK7A 2KDFB 2QSDA 3EN4A 4R78A 3K9PB 3P63A 5CTRC 1MJGA 2PVLA 3LMGA 5AX9A 3EC8A 2BS3B 5HQ0A 4JNFA 2J7TA 2WXOA 4BDJA 5GIOE 4QD6A 2LVQA 2IVSA 1P4FA 4R5IA 4I1QA 4O96A 5I9UA 3ZO2A 3N20C 4NAMA 1GPXA 4PMPA 3EJTA 4IM3A 3KRLA 3WZEA 1SE3A 4NJ7A 3APDA 4OR5A 4QYFA 3RPSA 1WAKA 4QNAA 4C4IA 1D5ZC 2WGJA 3ZXTA 4PDSA 3N4VA 2KFKB 3JW0X 4CYIA 4TV3A 2X2LA 4AWIA 4V04A 2BAQA 4CCUA 3QU0A 1SVHA 1MVKA 1LUFA 3NW6A 1PYEA 3WALA 1UWHA 4AZSA 1TVOA 1ZXEA 2XEZA 4XEYA 2C1BA 2BZHB 1FXTB 2B9JA 3FMDA 4YR8A 4R7HA 2REIA 4I6FA 1MQBA 1Q8ZA 3A4OX 2DYMA 3RNBC 5LVLA 3AEAB 3WYXA 4ENXA 2B3AA 5LVOA 4XG6A 3VXWA 4WSQA 4NM3A 3PG3A 4CLJA 4L1BA 4YO4A 3C4WA 1QLBB 3AE9B 3PXRA 2WXPA 5AP2A 2W5BA 3WE4A 4KDIC 4F8CB 3B8RA 3K5VA 4CMUA 4YNEA 4KSPA 4ZLZA 3FPQA 2X9EA 3L8VA 3ZYYX 4FTUA 4G6NA 4M7IA 3PJ8A 1ZDXA 3GGFA 3D5VA 4C36A 4FTJA 3R73A 4IQ6A 3VUMA 4EZ3A 4UMRA 2QOCA 2CPKE 2B9IA 1UNHA 4FV4A 2BYTA 3ZLYA 2JKKA 3W1FA 2LI5A 3VWAA 2XKDA 3PRZA 3FLWA 4AOIA 3AC2A 2L32A 1DOXA 4B6LA 3N51A 2X8XX 5A4TA 3ERKA 3LJ0A 5IDPA 1UU3A 5ETCA 3QUPA 4KKEA 3POOA 2UZUE 4FIFA 4R5KA 4DXAB 5IMEA 3QC8B 5EE3A 3GCUA 2PUIA 4G3XB 2J6MA 3NPCA 3C19A 1PXOA 1DS5A 3ACOA 4BCFA 2IY0B 2CMWA 2PVFA 5DE2A 4FVPA 1R3CA 3DWMA 2VH2A 2YL5A 3OCBA 2XIKA 4CMTA 2VWUA 4H2AA 5EHYA 2J51A 2BF8B 1KE6A 4WOVA 4RFYA 1YXXA 2C6MA 4HDOA 4ZTLA 3N3KB 3HA8A 4C58A 3T4AG 1J1BA 3JY0A 4IM2A 5C3JB 4JWEA 2GBMA 1PF8A 2XJ1A 4ZS0A 4HKZE 4JWSC 3I4BA 3R7UA 4IKGA 4L01A 2YHVA 5AUVA 3UOKA 5LQFA 3SXSA 4W9JA 2PVJA 1ST4A 4DGNA 4IVBA 2YWVA 3QCXA 3DPOA 1KV2A 2KANA 4XG8A 4AZCA 3ULZA 1TQPA 1P7EA 1K53A 4GFMA 4MEMA 3MTFA 4QP7A 3ZC6A 4APCA 3P0MA 4BBEA 2INCC 4TQ0A 5MPOA 2KWDA 1GZNA 2UW8A 1MQ4A 3I0QA 3O50A 5JFVA 3H6NA 5A14A 4AZGA 4PS3A 1Q4LA 2EX3B 2O6VB 2QCSA 4RMZA 2KQ7A 3BVWA 3R8UA 4YSJA 4K18A 1K9AA 2OW3A 1WMHA 5HE2A 2MLBA 5HTBA 1N60A 5L8KA 3T3OA 3GFWA 3EJPA 2BGFA 3U54A 4EYJA 4R5GA 4AZTA 3VS4A 4K33A 5C8KA 1I4HA 4S31A 2FUG1 3C1XA 4CKJA 1ZW7A 3P7AA 4FKIA 1UWMA 4OVUA 4ATMA 3UDBA 4CFNA 1UKIA 2GDOA 2R3LA 2GHGA 5IPJA 3AULA 1W2FA 1TKGA 4CFUA 3G0EA 3WOWA 3BE9A 4KB8A 4RMAA 4BDHA 2QFFA 4X2GA 3AG9A 4ITKA 3DBLB 1I44A 2K8HA 2OZNB 3UZTA 3DU8A 4FMQA 1XO3A 3DBRI 3TEZA 3VR9B 3QC9A 3NUHB 4H36A 4CO7A 3AE4B 1U54B 3K3JA 3ZXZA 5AR4A 4BCPA 3ER8C 5JHAA 5I9VA 4BDIA 2ZW0A 3AC1A 1TKIA 2O3PA 4F65A 3FSKA 2LGDA 3MIYA 2C7HA 2MA9B 3AXWA 4X6RA 3AT3A 1IAJA 4C33A 3MB7A 3BYUA 5I9XA 4RZWA 2QODA 1NVRA 4A06A 2FSTX 2PE2A 5FWKK 3UDSA 4IC7A 3Q2JA 2WMWA 4PS7A 4NCTA 1A70A 3LZBA 2PUPA 2YAKA 1ZARA 3Q2AC 1OEYA 3H8HA 1WBOA 2JKQA 4L45A 2J0MA 3PGEA 2OH0E 3BVZA 3ML9A 2ZV8A 2YERA 4ZSEA 3DS6A 4YTIA 2J0KA 3SR6A 3VC4A 1ZMUA 4FULA 1H1PA 4FV9A 4FKLA 4ASXA 2HWOA 3EQHA 3TV4A 2KMMA 4MXXA 1I4LA 1M2RA 1BT0A 1KE7A 3K5UA 4E5AX 3AV8A 4D2WA 3TEYA 4LL5A 4Y5QA 4G6QA 3D14A 3L9PA 5DR2A 4DHJD 1E5WA 4HYBA 4ARCA 4AE6A 4E6CA 2WPAA 2YM7A 5IA1A 1L5PA 2EKEC 5CAQA 4EH9A 3RUIB 1OI9A 3DX1A 2XNBA 4D5HA 3C4ZA 1WX8A 4HCNB 3HGKA 2YLMA 2IZVB 5LXIB 2XKFA 2HCKA 1WM3A 5FTOA 3P86A 4WNOA 3RAHA 3NUYA 1L7YA 5AUIA 5I4NA 4DEEA 3RHKA 2KC1A 1QWUA 2RFDA 1WBTA 2XCKA 3R00A 4IIRA 2GSFA 2Y4PA 4K6ZA 3D4ZA 3W1SC 3MN3A 3ZJTA 1V1KA 3GQLA 4TNBA 4D1SA 4I6LB 3GCVA 3MH2A 2WD1A 2ZJWA 4C00A 3AMYA 1IYFA 4KSQA 4MKCA 5AAEA 2OJGA 2LJIA 4WWOA 1NVID 2JIVA 1QZEA 4N9F4 4BDBA 2Y6OA 1LEZA 3QTIA 3JSVA 1C9FA 4Y5HA 3P79A 3ZEPA 2DS1A 4DFLA 2N0SB 2YJRA 1TS4A 5KX8A 3P5JC 5JKGA 3AU5A 4EK5A 3PVGA 4DAWA 3NUSA 3FAAA 1PMVA 3G6GA 3CE3A 2YAAA 2LXYA 2C6KA 4YJTA 2PMLX 3FC2A 5EW3A 2PK9A 4EH4A 5AZFA 4CYEA 1H07A 2D1LA 2BRGA 3UIPB 2LUEA 4Y46A 2W5HA 4JAJA 4LUEA 3VR8B 2R2PA 4WG5A 3DK6A 1ZGUB 3ZONA 1W9MA 4HR1A 4LDTA 2X7GA 4FNWA 4XG4A 5EKNA 3MH1A 2HZNA 3ZTXA 4ANUA 4ZRIA 4IB3A 3H9RA 3MFGA 4A9UA 4NY0A 2Q13A 3ZSGA 3HL7A 3E64A 2SEBD 4Z7GA 2VO6A 3LMFA 4JDHA 5J95A 3ACJA 3IPHA 3T3VA 4G3FA 4O0XA 5FRIA 3DPDA 3ZO3A 2F57A 1ZUD2 4RGMA 2WINM 4GIHA 4MYGA 1OB3A 2B55A 2XIZA 3MTLA 4PDPA 4RX9A 4UYAA 3E7VA 4GK2A 3NVKI 2MJEA 1TZ1A 4FEWA 4EZNA 4CQGA 4L67A 4Y72A 2UUEA 3MP9A 3ZYAA 4ZYNA 4X21A 5H8BA 4QTCA 5E8TA 4DTKA 3UIMA 5A46A 3EN9A 4E1ZA 1JWSD 3U8WA 3PSCA 4OZBA 3KQ7A 4JRNA 2KD0A 3OJ4B 4LRMA 2VD5A 4IWOA 4IM0A 3Q69A 5CVHA 2OIDA 4FEQA 4R8QA 3BY4B 4MF0A 2CSNA 3LW0A 2VAGA 3ID6C 5CLPA 4W8EA 4UDXX 1STEA 4F63A 4CLIA 2DENB 1ZMWA 3PUFC 3DLSA 1QT9A 2I0EA 4X3JA 3RYTA 5ANEA 3UO5A 2LGYA 3OBGA 3VS3A 5HKMA 1D5MC 1H28A 4FLHA 2WXGA 2MW5A 4FHKA 2LHDA 5EHLA 5JT2A 3F5XA 3FC1X 4YTFA 2WXJA 4NUSA 1W83A 5AR2A 2AQ1B 3HHMA 5DIAA 5FG8A 4BOSC 1I49A 5FTGA 5HX8A 4U3YA 1NVQA 4XWTA 4N6YA 2OXYA 3S2AA 1VZ8A 3RWPA 2INPE 2BIYA 2Z0OA 4QTEA 3DOGA 5EM8A 3P7BA 4GSWA 1V1PA 5FIGA 3DBFA 3HKOA 2ZXQA 4OTIA 3RAWA 2XRUA 3EKKA 2ITOA 3EOCA 5FDPA 2CR5A 1EO6A 3UIOB 4G17A 3NW5A 4NJ3A 5LCJA 3MWUA 4BDDA 2NRUA 3NVMB 3FAHA 1FQ1B 3Q3NC 4QMTA 2W99B 4DITA 3VVHA 3Q3OC 4F9BA 3QTZA 2HXLA 3W32A 4Z9LA 2BKRB 1XWSA 2X9FA 5IA5A 4K7SA 2K39A 3WE8A 4FIGA 5H2UA 4PPBA 3TJCA 3BGPA 2WIHA 3JVRA 3HZTA 4FHJA 5CALA 3QXOA 4FTOA 4K3BA 2WEVA 5CT0A 1U4DA 4YJVA 4M0ZA 3QHRA 5EI8A 2ELBA 1YOLA 3PWYA 2BVCA 1PMNA 4HYUA 1P4OA 1XBBA 2XIXA 4I0SA 4N58A 3R1SA 2W1IA 5T3QA 1R0EA 3TZ7A 2PWLA 3MY0A 3ZFXA 4GVAA 2M56B 4KGTA 2HTME 1WYWB 3L9NA 1CK1A 1T0RC 3KXZA 3HV7A 3PS6A 2Z60A 4GT5A 4I0TA 4CVAA 4NYEA 5FP6A 4HJOA 3GXLA 1ROEA 3Q3BA 3RTPA 3E62A 2PVOD 4IC7B 1PMEA 2IZUA 3P23A 4W4XA 1PKGA 4EUUA 3I5NA 4MX9A 5KBQA 4LJPB 4DFYA 2VX0A 3DX3A 4E6DA 2IO3B 2WNTA 4AAAA 3MI9A 2B9FA 4ACGA 3F66A 2WXLA 1OPLA 1M94A 1RE8A 2PEAA 3MIAA 1WJ4A 3MC0B 3IOPA 3R2TA 3HMMA 3QRUA 4XP0A 4GXBA 2YIRA 2X2MA 4AOTA 4QMWA 3FI3A 3SW7A 3O8TA 4D1ZA 2GNGA 3ZVVA 3PIYA 4O38A 3UNZA 3F2RA 4O7NA 3UGBB 2EFKA 5C4LA 5M4UA 4IX4A 3A2CA 5HVJA 3IDCA 4RWJA 4DFZE 4FZSA 3QD2B 3BK2A 2FH9A 5AAGA 3DCVA 1OGUA 2Q83A 3TKUA 2HW6A 3AE1B 3KIOC 5AZHA 2I0YA 3LFDA 4EZLA 4IVAA 1W0XC 3APFA 2G01A 4S34A 2A98A 4RLLA 5CNNA 3AMBA 2XM9A 3IG7A 4H3QA 3FZOA 1SEBD 1ZE3D 2Y5PA 3GU8A 4CSVA 1JMLA 2Z0VA 1BMKA 4L44A 5CU0A 3C4EA 4JE3B 2YM8A 3F7WA 4HOKA 3CTQA 2VWWA 4H1MA 3R8BA 3B2FA 1R78A 3OXIA 3O7LD 3OEZA 5C2TB 3OOMA 3UOJA 2UU7A 3FXZA 3ZSHA 2WXKA 4F7NA 3HRFA 3TG1A