4IM3A

Structure of tank-binding kinase 1
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
659
structure length
605
Chain Sequence
GSMQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNRPVDVQMREFEVLKKLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGMNHLRENGIVHRNIKPGNIMRVIGEDGQSVYKLTDFGATVDLWSIGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITGKPSGAISGVQKAENGPIDWSGDMPVSCSLSRGLQVLLTPVLANILEADQEKCWGFDQFFAETSDILHRMVIHVFSLQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQELIYEGRRLVLEPGRLAQHFPKTTEENPIFVVSREPLNTIGLIYEKISLPKVHPRYDLDGDASMAKAITGVVCYACRIASTLLLYQELMRKGIRWLIELIKDDYNETVHKKTEVVITLDFCIRNIEKTVKVAAELGEISDIHTKLLRLSSSQGTIETSLQDIDSRLSPGGSLADAWAHQEGTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLAYNEEQIHKFDKQKLYYHATKAMTHFTDECVKKYEAFLNKSEEWIRKMLHLRKQLLSLTNQCFDIEEEVSKYQEYTNELQET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase TBK1
publication title Structure of Tank-Binding Kinase 1
rcsb
source organism Homo sapiens
total genus 194
structure length 605
sequence length 659
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-01-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF18394 TBK1_CCD1 TANK-binding kinase 1 coiled-coil domain 1
A PF18396 TBK1_ULD TANK binding kinase 1 ubiquitin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4im3A02
1.20.1270.420 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4im3A04
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4im3A03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4im3A01
5AP6A 2MSED 2UW8A 2B0QA 4LRKA 1U54B 2WOTA 3I4BA 1H1SA 4DTAA 2W4KA 1KOAA 3TIZA 2PSQA 5ETFA 5CEOA 1IAJA 1QPDA 2VO7A 3CTQA 5ANGA 2DAFA 4RJ3A 4FKWA 4M8TA 4TYJA 4Y73A 3GGFA 5J8IA 3POOA 3R71A 2X7GA 1REJA 4O6EA 4FJZA 2YLMA 1DI9A 4G3GA 4O0UA 3AGLA 3VTVA 4O38A 1Q3DA 3NOBA 2KTFA 3KVWA 2G4SA 4TYGA 2GPHA 2VWWA 4J7BA 5T3QA 3KL8A 3ML9A 2J0JA 4L42A 2P4IA 5JQ5A 3LCKA 3LCSA 2UUEA 5E92A 4EYMA 1R4MI 4F0IA 4TXCA 5KKRC 5ETIA 2ZV2A 1WFYA 2Z0EB 4KAOA 2MX2A 5EHYA 2W1FA 4GT5A 2CDZA 2C30A 3KUDB 4DFZE 3LVPA 5KCVA 4UWBA 4WG3A 4E1ZA 4WA9A 4P7EA 3QC4A 4AUQC 1O9UA 1W84A 2PE9A 1WE6A 4JG7A 4RFMA 3IVFA 2X2KA 3VRYA 5HBHA 5F4NA 2YCFA 4JG8A 4JVGA 4MCVA 5J95A 1PXPA 1RAXA 2HAKA 3LJ0A 2DHZA 4X3FB 2BROA 3R1YA 4ANSA 2K6DB 2WQOA 4WNKA 2IO1B 3NW6A 4PS8A 5D7VA 3ZO5B 4GVAA 4AW5A 1OL7A 4R3RA 2CNVA 3LFSA 4C3RA 2YM5A 3H3CA 3M63B 4EFOA 3UF8A 3R8LA 3HV7A 2HIWA 3PVGA 5HCZA 4ZJJA 2JIVA 2KC1A 4UZDA 3V5PA 3ANRA 3APDA 3LM0A 5LCJA 3SRVB 2O6VB 4PNKA 3UO6A 1H0WA 4OR5A 3IG3A 4CYEA 1J8CA 3K5VA 4DFYA 4Y8DA 4IAFA 3RNIA 4FZ7A 4GUEA 5JZNA 3NW7A 3ZCLA 3NCZA 2PUIA 2X7FA 3AMYA 4C2VA 1Q8TA 4C4JA 5IUGA 3ALNA 5AUYA 2XJ1A 3CD8A 1CKPA 3M11A 4BFMA 3UQGA 3PGEA 1V5TA 3MVJA 2GQRA 3A99A 3MFUA 1H25A 4RG0A 3BV3A 2KWCA 5BUJA 1PHKA 4GV1A 5CZIA 4BGQA 3N30A 3FAAA 4EHEA 3U8WA 4OTPA 3R01A 5KZ0A 5LXHA 4QP8A 3SLSA 4BKYA 4KS7A 4BDHA 4BWKA 4WKQA 1PXOA 3HRBA 5HVJA 5FBNC 5CU3A 4TW9A 4X2NA 3IDCA 4BF2A 3VAPA 5JN2A 5IF1A 3ZUVA 3N4TA 5K4JA 4DHZE 4YNOA 1IR3A 2YWPA 2B9HA 5D6JB 2A2AA 4HCUA 4ZS0A 2RF9A 2DYLA 1W98A 3CSTA 3ENMA 2LUEA 2GNHA 2MCNB 1V5OA 4P7IA 5E1EA 4RMZA 2UZDA 1H08A 3KU2A 4KS8A 2G2HA 5HX8A 3VQUA 4ZZMA 5D2MB 2VX3A 3QHTA 3QXOA 1V2YA 5J1WA 2CMWA 4U0IA 4AZSA 2OXXA 4JQ7A 4D1SA 4W9EA 2J0IA 3S3IA 4HCNB 2B4SB 3LZBA 1R4NI 3ORZA 1IRKA 2R3MA 5L6OA 5HLNA 3TL8A 4WQOB 1BMKA 3G0EA 1UWHA 4E93A 2J0MB 3QIJA 4QYHA 5AAGA 4E26A 5DR9A 3UZPA 5D41A 5EQEA 3BIZA 1H4LA 3BYUA 5LXIB 4JIAA 3KCFA 3E3BX 4BBEA 3CSFA 2N9EB 5CWZA 5DA3A 4FSWA 1OPKA 1ERKA 2J51A 5FG8A 3RTPA 2B9IA 5D1JA 1CKIA 3Q32A 3QZGA 3KK8A 5ANDA 5CNNA 4RVLA 3W2RA 3A9JA 4H58A 3T3UA 1VJYA 3QKKA 4I5MA 4LGHA 3PJ1A 1WF9A 3Q52A 4BWXA 3SA0A 3EQDA 2N4FA 1CKJA 5AP1A 3NUUA 4ICVA 4ZTQA 5C8KA 2QQ7A 4FC0A 4DH1A 4RIXB 3BLRA 5CTPA 2BF8B 5CVFA 5D9HA 4AWJA 4I41A 4QMVA 4G3DA 3LFBA 2W06A 4A9UA 3F69A 4HDQA 3W2CA 4UXQA 3NNVA 2X4ZA 4YTCA 3SC1A 5L4QA 3UIPB 4LM5A 2V22A 4NTSA 1J7IA 4FNWA 1M7QA 2PYWA 5CEQA 3DTWA 4MD9E 5KBRA 1UKHA 5M08A 1YXUA 4C59A 3OLMD 5BVOA 4XLIA 3PLSA 4GVJA 2BFYA 3H30A 2KX0A 3CLYA 2WO6A 4RX7A 5GINE 2X8DA 3KYDD 4JXFA 3ORPA 4YJSA 5CXHA 1Y6AA 3F9NA 4V0GB 5AV2A 3FZOA 4M68A 1M94A 2L7RA 4C4HA 1FOTA 3I1AA 1H24A 2FUHB 4O81A 4DHFA 2DENB 4EK6A 3B8RA 4APPA 2F2CB 2J6MA 3AULA 4X0MA 3IW6A 2H6DA 4DF3A 2BIYA 4H1JA 5AR3A 5HE2A 2ZZPB 1UZXB 4D2RA 4E6DA 3FLWA 3AC4A 3FHRA 5KMNA 2HZ0A 4ZY6A 5HTCA 4O7VA 4EH7A 4TNDA 2X0GA 5JGAA 4IC7B 4XCUA 2GMXA 4HGSA 4JDJA 2LGDA 1GJOA 3D2IA 5AUVA 3G2FA 2V5QA 3D7ZA 3G90X 4J53A 2YIYA 4KNBA 3P78A 4U7ZA 3TZ8A 4MWIA 2VGOA 1U59A 3RYTA 1HCLA 5A4TA 2H34A 2YAAA 3EHVA 3CIKA 4GU6A 3FQEA 5M4CA 3MI9A 2VWVA 5BVWA 2IJMA 3I3TB 4FV2A 4ANLA 2V1YA 5T6KA 3U6HA 3BV2A 2PVHA 4X6RA 4J99A 5CHFA 2IVUA 1RQQA 3RAKA 3BQCA 5HBEA 3BLQA 3VBQA 2O65A 3A8XA 4K8AA 4F9YA 3Q4CA 4PMPA 1QCFA 3LFNA 3G6GA 2QHMA 3ZTCA 4LUDA 4CFMA 4EOLA 1SVGA 1OMWA 5FGKA 3VJOA 4HPMB 4NM0A 5DMZA 2LVOA 2WTKC 4UYNA 3ZTXA 2IZRA 4AT4A 1Q8ZA 5EOBA 1HE8A 3U6IA 4Z16A 3DQWA 4MSQB 1E1VA 2JLDA 3TBLD 4YHTA 4QMQA 4IUMB 5CASA 2HXLA 2BKKA 2W0JA 2X9FA 5BPYA 1PF8A 2C3IB 3FY2A 3ZOSA 3MFSA 2NBWB 5A3XA 1WZ3A 1FVVA 4F7ZA 4R3CA 3M1SA 5H8GA 4BTFA 5JFSA 2K6QA 4TT7A 2GNIA 3QL8A 3N51A 3HP5A 3ITZA 3D5WA 2WMXA 4Q5EA 4O22A 4OTIA 2Y4IB 4ZYNA 3RWQA 1XH7A 3VTUA 2JUOA 2VD5A 5E9EA 2A0CX 3L9NA 2QHOA 2H96A 4CNHA 3DQVA 2JT4B 1XD3B 3VH4B 4QMNA 4BZOA 2I0VA 3JUHA 2CR5A 2NRYA 2O5KA 3FLZA 4W9CA 4E7WA 2GNJA 4F0FA 4MBLA 4O0SA 4D2TA 2MW5A 2XIZA 3GOEA 4GIHA 3R7UA 4ZSLA 3AC2A 1UU7A 4TL0A 4MH0E 3V01A 3ZDUA 1WI0A 2JY6A 4RJ5A 3CJGA 2G01A 2BILB 2Z59B 4TQ0A 3ZNID 3VFKA 4DHJB 3TJPA 1A9UA 2XNEA 2I7QA 3L9MA 1GOLA 2YM4A 3Q3FA 3CP9A 3DQXA 3BPRA 4LFIA 3UQFA 3TMPB 4U43A 1LUFA 1GZ8A 3QRKA 5HO8A 2WQBA 2JKMA 1PKGA 2GBMA 4FKRA 2YIWA 2HJ8A 3BQRA 1VR2A 5D7GA 3HAMA 3K9PB 4FEXA 4GJ3A 4TRLA 4YPDA 4E4MA 5G1XA 3BCEA 2KN5A 1YHVA 1V49A 1UVRA 2UW6A 1U46A 1Z57A 3VQHA 3VUHA 4BYIA 4HLEA 3VF9A 2XIRA 4A06A 2JIIA 5CU0A 4GJ2A 2RFSA 4F6WA 4PTCA 3SHQA 3ZRFA 2C3LA 3OUNB 2A27A 4FSMA 3VHEA 1H0VA 3R30A 3S0OA 2JD5A 3UNJA 4XG7A 3CJFA 3HDMA 2Z02A 5KBQA 4Q5HA 1NW1A 3MESA 5IEYA 4EONA 3C0RB 3R73A 3C5IA 4LYNA 3DB8A 2JZZA 3TZ9A 3GENA 4K1BA 4YZNA 2WQEA 2BZKB 1L8TA 3ZU7A 5DRBA 4X3JA 5CEMA 5AR5A 4O96A 1GC6A 4ACGA 3KF4A 4J52A 1A5RA 4I22A 4JBPA 3OG7A 4D5KA 3V51A 3NLBA 3HMPA 4C37A 4BR3A 4RX5A 4LQMA 4FEVA 2BUJA 1WGGA 5J1VA 1YIWA 2W1HA 4I20A 2BKRB 3KGAA 1ZAOA 2VO6A 4KIKB 2IVVA 4IAYA 4I4FA 3U7DA 4RT7A 4DFXE 5LQFA 2J0KA 3PLVA 3VS0A 1WBNA 5CHWA 4EHZA 5C26A 1EO6A 5LVOA 5IQFA 3UIBA 4ICUA 5EM6A 3RNYA 3K2LA 3TDVA 4APCA 1SVHA 1XH8A 1LM8B 3N32A 4F63A 5EFQA 2PE6B 3E8EA 2G15A 2FA2A 2WELA 3QQKA 1NVQA 2UVXA 3RGFA 4O7SA 3EN6A 3EQGA 2RGFA 4AT3A 4FKJA 5C1ZA 3DXNA 3PLUA 2EXCX 2WMWA 5KMLA 5A54A 3RI1A 2ZVNA 3TJCA 2H8HA 5EQYA 1BLXA 5E6OA 4Q9SA 2V0DA 4YLKA 3R7OA 3IS5A 2YIQA 4B95A 3KK9A 1NVSA 3RKBA 4RWKA 2GFSA 4OBQA 1LFDA 2K1FA 1Q62A 4F99A 3PUPA 3MWUA 4LDTD 3TWJA 3IGGA 4TN6A 3FKNA 3ZXTA 4ZAUA 4I0TA 4BIEA 4M13A 1SNUA 3VBVA 3DVGY 1OB3A 1XQZA 4HVDA 2HXQA 1GZOA 4D55A 1XH9A 4CQEA 3ZM9A 4PDYA 4DTKA 4HOKA 4MK0A 3OXZA 2ZYBA 4K1RB 3TT0A 5HORA 4L53A 4AGWA 2O64A 5TR5A 1WBPA 5EDQA 5KZIA 3QXPA 3VF8A 5HG9A 3OEZA 4HYSA 1WRDB 2KTRB 3QCXA 1OPJA 4MGYE 1XKKA 4CLJA 2PPQA 2FYSA 4ZJVA 1LPUA 3WYXA 3BGQA 2P2HA 3NAXA 2VGPA 4AAAA 5KHOA 1GIJA 1OKWA 1VZOA 1V81A 3Q4ZA 2LRWA 2BYEA 3ZFYA 3ZDIA 3CC6A 2BDFA 1UNLA 4FKVA 5L6PA 2C6KA 4JS8A 1Q8WA 2XK5A 3KEXA 2JPHA 4RWIA 4CFFA 3E5AA 1XH6A 2KXJA 2WFYA 4BGHA 2BRMA 2OF2A 2YZLA 2XIXA 5LXMA 4EQUA 1WX9A 4K7SA 1FVTA 5TF9A 4BWPA 2Q83A 1WFCA 4AT5A 2UYZB 2FIDA 2VX0A 4GK2A 2QOIA 1WH3A 2PTKA 4WUNA 4GG5A 3TZMA 4NJ6A 5AIKA 3HEGA 2WMSA 4IZ5A 3S2PA 3R9OA 5HNGA 3RCDA 2IZTA 3C9WA 5FBOA 4YJRA 5CEKA 2OFUA 4IM0A 1YJ1A 3BYVA 5JKGA 3RHXA 5C4LA 4FIIA 1D3ZA 3QYWA 3M62B 4K0YA 2DQ7X 3PXZA 4KABA 4AP4C 3AXWA 2YCQA 4C62A 3R9DA 4L43A 2V3SA 2GTMA 2B52A 3PWDA 4AE6A 3FI8A 3ZRMA 3HIZA 4WT6A 2ITPA 3DKGA 4UMRA 3ZONA 3R0TA 3EQPA 4L8MA 4AZFA 3VH3B 2F4JA 3R83A 2OU7A 4MGZE 3X23A 5DE2A 4A07A 2KFJA 2DZIA 1OQYA 2ZJWA 3VUWA 1CMXB 2N9XA 3BU3A 5HLWA 5AEKB 4MD8E 4C33A 4HWIB 3I6WA 5E8WA 4Q9ZA 4QYYA 4V04A 1WJUA 4MSMB 2CGXA 3IW5A 1MRUA 3OJ3A 3C13A 1JWHA 5CX3A 2QI8A 1TQMA 4BC6A 3O96A 2IY0B 2AWTA 3RAHA 4FTCA 3BI6A 4TV3A 4IVDA 3WILA 4JBOA 3F66A 3OCGA 4AN2A 3R02A 3C4CA 2RFNA 2OIBA 3E8NA 3TKUA 1GC7A 4PTEA 4DCAA 3BKBA 3UVQA 1FPUA 2IG7A 4G3XB 2I0HA 4H39A 2VRXA 5LARA 4FKPA 2LVQA 3PRZA 4W4XA 2EVAA 4N70A 4RX9A 5F9EA 2HWPA 2KFKB 2MBEA 1V0OA 4U79A 5IISA 4PS7A 4KIOA 3BHTA 4NSTA 1A48A 3R8PA 5L6WL 2DZKA 5BO4B 4EWQA 4S30A 5BMMA 2LWPA 3ROCA 3QUDA 4GT3A 4QMMA 3D94A 4G3CA 1WBVA 2WQNA 3OCBA 4WJNA 4JDIA 3FZRA 2IN6A 2CNUA 1TBEA 4TKNA 4YZMA 2AEHA 4DC2A 4ZZNA 4A4OA 4RIYB 2CHZA 5KMIA 3QQGA 2CLQA 4YZDA 3HAVA 4YP8A 3NEWA 1Y8YA 4D1XA 3WYYA 1W8CA 4XRLA 1H26A 2KMAA 4AGCA 1IPGA 2C7HA 3MSSA 4TWNA 4L3LA 5IA4A 4AA0A 3ZO2A 3PXFA 3I0OA 4MNEA 3N4UA 1YHSA 1XJDA 4GRBA 3RPOA 4TWPA 2ITQA 4XV9A 3PSBA 4B6WA 1K8RB 4C4FA 4D1ZA 4ERWA 3LJ3A 5CF8A 3AC8A 3BWJA 4F6SA 1V80A 1VEBA 2OXDA 2KQ7A 2C5XA 4AA4A 4I6FA 4ZS4A 5CU6A 3F2AA 3KW5B 2WMVA 2XK7A 5IA7A 3K9OB 3LJ2A 3QC9A 4YHJA 4PDSA 2WMUA 5D11A 5JEBA 3NYVA 5AMNA 2OKRA 5M09A 4HYHA 3I0QA 4IVAA 4HJOA 1YWRA 3QALE 3SW7A 3LMIA 3S1HA 4ZSAA 3E88A 3Q04A 1WXAA 3EB0A 4M69A 5DR2A 1K3AA 4EHVA 4DEGA 4MJSA 4BBMA 5BX0A 1SNXA 3G6HA 2C7MB 4FTUA 4L68A 1BL7A 2QD9A 3KXGA 4PX6A 2B55A 2Z7LA 2C5LC 3PRMB 5K9IA 2HE7A 2C60A 4CO7A 3SAYA 2VV9A 1YHWA 4I6NB 2UW5A 4BDFA 3JS2A 1ZLTA 3FDNA 4BDCA 2WTIA 3UOJA 2ZPNA 1OITA 3BHVA 2BZIB 5C8MA 4NJ7A 3PXYA 4EJ7A 3BRBA 5GZAA 2W05A 4ZY4A 1Y8GA 4IWDA 3IDPA 3H4JA 3HLLA 1X8BA 3F5UA 3R1NA 4FADA 4F9CA 2BYFA 3IOKA 4QQ5A 4XLVA 4YNEA 3B08A 5CYIA 1Q41A 5JFVA 4FGBA 1V9JA 4MYGA 3BINA 4QMSA 4CLIA 4B0GA 4XP3A 2PMIA 4USDA 3GEQA 4E6AA 2G9XA 5FTGA 4RZVA 4DH5A 4TPTA 1WR6E 5K0XA 2IZUA 2R3JA 3SOCA 2HYYA 3Q3JA 3FC1X 2R3RA 4ALUA 3OROA 4FKSA 5CSHA 3IG7A 2F7XE 5CT0A 5ETCA 1ZMWA 2E9NA 3BU6A 4WSQA 3P79A 3ZMMA 2DYOA 2W4OA 5DYJA 4J95A 2PVJA 1REKA 4QMOA 2AC5A 2W1CA 4TUUA 3VUYA 2DYBA 2DYMA 4V05A 2MP2A 5K3YA 4EH8A 3ECIA 5H3QA 2GNLA 1MUOA 1OIYA 5E7RA 2OW3A 3QTWA 2R3NA 2NS5A 1KV1A 5BQ0A 4YZ9A 3QCSA 1OPLA 2W9ZB 4DINA 5LCKA 3R63A 3FJQE 4F1SA 4IWPA 2CCIA 1HOWA 3SQQA 1UNHA 5J17A 4PP9A 5DGZA 3P08A 2JBPA 5AV3A 4JNWA 3IO7A 5AUWA 3TKHA 2ZV8A 3AOXA 4KRCA 5IAAC 4IB3A 2QR7A 3TNPC 4M0ZA 4FEWA 1TQIA 3ODZX 4CHKA 3Q6WA 3UZRA 1BUHA 3TEIA 2ZVAA 3DAKA 3G51A 3SDLC 3R21A 2YCRA 4FF8A 5BMSA 4NFMA 3I5ZA 3HKOA 4IZYA 3UNZA 4EKLA 4FT5A 4EWHA 5ANEA 5FEEA 3I81A 2F49A 4U8ZA 4G9RA 3KYCD 5IA1A 2XCHA 1I44A 3PE2A 3K3IA 3QGYA 3LFDA 3L8PA 4IAKA 3L08A 4MBJA 4DG2E 2MBHA 1B6CB 3V62A 4X57B 1WVWA 4P4CA 5CAUA 4BRXA 2HTHA 1R1WA 4OTRA 1CM8A 1M2RA 4URKA 4RA4A 2F9GA 4ZLYA 4XUFA 3WAOA 3RK7A 4IAIA 4MD7E 4IMYA 3R8VA 2C6DA 3BE2A 4I6QA 3ZEPA 3QX4A 4YJTA 3KRXA 3N3KB 1XH5A 3MH3A 4LGGA 3PVUA 3R2YA 4AOFA 3NPCA 4HVIA 1I35A 4O7RA 2YACA 4YSMA 5B2KA 3QQUA 3UIXA 3PRPB 4G17A 5HI2A 3VVHA 3ORMA 3RCZA 2NPTA 3R9HA 4N9F4 3IKAA 3K5UA 2B9FA 5DT0A 2NCNA 4BL1A 4F1MA 2WPAA 4DGLC 4USFA 5FWKK 4X3FC 2LGCA 1DS5A 4L01A 4R77A 2UVZA 3HK0A 4HPTE 4E71A 5I9UA 2BR1A 3PT2B 2VU3A 3G0FA 4UWCA 3GB2A 3EECA 4KIQA 3W2SA 1WBTA 5FTOA 5L2WA 4MXAA 3NIZA 4JG6A 2PZIA 5DCNA 4JBQA 3VRZA 2KX3A 3OOGA 1RW8A 4WNPA 4BCPA 3MBLA 2XIKA 1TKIA 3O7LB 3ERKA 2I1JA 1MP8A 2VWXA 1GZKA 5HIEA 2XBAA 1M14A 3MIYA 3SXRA 2XKDA 3F3UA 1YXSA 3KN6A 2ZNVB 3EWHA 5M44A 5E8UA 3U51A 5LMKA 2GNFA 5HD7A 2J7TA 3FYKX 2CGUA 4GN1A 2ZM1A 4J1RA 3BELA 2VWUA 5HESA 5LVMA 3RK9A 1OGWA 3DNDA 4M67A 4O7WA 5GJDA 1Z5MA 2IZSA 2WIHA 5FXSA 4RC2A 4A3OA 3NUNA 3OEFX 3T9LA 3QRIA 3BGPA 2RPQA 1ZMVA 2LJ5A 3QK0A 3UOKA 1YDSE 4LV8A 3IBEA 4EI4A 3P4KA 4PV0A 4ITHA 3S4QA 3QF9A 2JKOA 3ALBA 4QTCA 1E7VA 1SGHA 3DAEA 5E91A 2NPQA 3OBJA 2R0IA 2XEYA 3ORXA 4IHPA 4FIFA 4WRSA 3QUPA 1YW2A 3FI3A 1ZOGA 4TQ1A 4CD0A 1QPJA 3O0GA 3UVRA 2XB7A 2OIQA 4CTBA 4DITA 4I3ZA 1JKLA 3F82A 3TUCA 4BICA 4NIFB 4JDHA 3PSDA 3VN9A 4QP3A 4FIEA 5JSMA 2BRGA 3OT3A 3MS9A 4D2SA 4WBOA 2ASQA 4NYEA 1T45A 5HEZA 4M66A 5M57A 2UZWE 2EMTA 3PIZA 1H8CA 4QMPA 2YERA 2Y4PA 5HHWA 1UH6A 3ZUNA 5CSVA 3ZHPC 5EYDA 4EOKA 5IG1A 2QOCA 3EYHA 2YLEA 4QPSA 4PYZA 3F6XA 1ZZ2A 3L54A 4YUQA 5KUPA 1IG1A 2QLQA 2WEIA 3UTOA 2XVDA 4D2WA 3MPMA 4D4RA 3JYUA 1IAHA 1SZMA 3F7WA 3TM0A 3PA4A 4S32A 4FV3A 3QTIA 2OJJA 3BBWA 3MY0A 2FCSA 5IPJA 2VTLA 1G5SA 1FBNA 5EH0A 5HBJA 3W2PA 4F7LA 2KDEB 4ID7A 3PS6A 5C03A 3DVNV 4AFJA 5KO1A 5AUXA 3EQFA 4YO6A 4BB4A 2X8IA 5EQPA 5E1SA 3MJ1A 4FK6A 2LI5A 3W8QA 2CSNA 2D11A 5CF6A 1P3QU 3GCSA 3LXLA 3DVNU 4IBMA 2ERKA 4KBCA 5AEPA 4WBBB 2O2VB 4PL4A 3OW4A 4RM8A 3K54A 4A20A 4GSBA 2YN8A 3POZA 4EJNA 3QRTA 1V6EA 3P86A 3R7VA 3ATSA 3D7TA 3V5JA 3H0ZA 3C4WA 4JQEA 2BTSA 5AP5A 1QPEA 5KMMA 2C6MA 5DLSA 3DVGX 3IPHA 3DJ7A 3IK3A 2HW6A 4BOZB 2CN8A 2RD0A 4PDPA 5C9CA 4HZRA 1OKYA 4O2PA 3DFCB 3V60A 4RLKA 3C1XA 4FUYA 1P5EA 4L52A 3MB6A 2GS7A 2HZNA 4H3QA 1ZOHA 1KJTA 4ZMFA 5JGBA 4A9TA 5FDXA 4O84A 4BIDA 5DBXA 3E93A 3Q9ZA 4G50A 1ZKHA 4EZLA 4FKGA 3VUMA 2FAZA 5IMEA 2ZMDA 1JRUA 4HYUA 3LCOA 4FK3A 4JX7A 1BX6A 4QQCA 4JAIA 4BTMA 5HKHA 4EEVA 3DK3A 4NKSA 4QMLA 4CVAA 4TYHB 5LWNA 3LJ1A 2VTRA 2Y0AA 4DDID 3I60A 4I21A 4XG3A 2C1BA 4NCTA 2YM6A 5CF4A 4U42A 2K25A 3UVPA 3UE4A 4RMAA 4M8MA 5DG5A 2EB3A 4BKSD 2PMNX 1W83A 3NYXA 5L2SA 5M4IA 4GCJA 4OVVA 4KD1A 4ANUA 3TG1A 5LWMA 4W8DA 3T9IA 3A1QB 4D28A 2GBKA 2HY81 4MJSB 2PVRA 4OVUA 4FOBA 1JSVA 1URWA 3DDCB 1GJZA 3CEKA 3ZRKA 1H00A 4J98A 4TYIA 5GZ9A 4KKEA 5IQAA 3AT3A 4MXOA 2E2BA 3PZHA 2R3IA 3BU5A 2WEVA 3VC4A 5CAVA 1GUAB 4W9IA 3H10A 3M2WA 2Z2WA 3E7VA 3KY2A 3L0WB 4ANMA 1FMOE 2UW0A 4YC6A 2O6VD 3WF6A 2GS6A 2KULA 1RRBA 3H7SA 2IW8A 5C23A 2YA9A 4UMPA 2AUHA 3U55A 3CTJA 3EQRA 2G2IA 4AOIA 3SXSA 4DH8A 3V6EB 4EQCA 3GFWA 3FC2A 4ZP5A 3QD0A 1BKXA 2VO0A 4F70A 4C4IA 2PMOX 4NQLB 4WHZA 4ANQA 4WAAA 3WZJA 4PY1A 4ZLZA 4GKIA 3ZEWA 4CQGA 3UBDA 2XNGA 4MAOA 3KXHA 3KXZA 4GDKA 3MA3A 4BTJA 3WE8A 3DS6A 1E8ZA 3UMWA 1PXNA 5AV1A 4NAWA 2CU1A 2R7BA 1A06A 4G6LA 4D9UA 4QP2A 3DBLI 4BCGA 1WCCA 3V8SA 1WX8A 1T46A 1QL6A 1WX7A 2XJ0A 4JDKA 4LL5A 4WO5A 4FIHA 4FEUA 3UQAA 3TDWA 2LD9A 3ZLZA 3KN5A 3H7PB 4QT1A 2Y4IC 3R28A 2ETRA 2B53A 2UZVA 2ITNA 5CF5A 3COKA 3NYOA 2ACXA 1KWPA 3O8UA 3CS9A 2CNQA 4QNYA 3A9KA 1WXSA 2M0XA 4G5JA 3HNGA 3HM6X 4LL0A 3RZWC 4EH3A 4DGMA 4NM7A 3QQLA 5E8VA 2WNTA 3HV5A 3AGMA 1ZARA 3BHHA 3SX9A 1OI9A 5G2NA 4ITJA 3CQEA 2RFEA 5AUZA 3B2TA 3ZVVA 1UELA 3EN9A 4QD6A 2E9PA 3DNEA 4RIWA 3R7EA 3FI4A 1XWSA 5DN3A 3ZUTA 2XUUA 5FTQA 2PUPA 5LOHA 2JWZA 5IUIA 4IDVA 3OWPA 2V7AA 4BN1A 3LFCA 3T8MA 2YVCA 5DVRA 2WB8A 1F3MC 2B3AA 1TZ1A 3U9CA 3RD2A 1PYEA 3LLTA 4FNYA 4QMXA 4IM3A 5IDPA 3QZIA 2QO2A 3PTGA 4GT4A 3MB7A 4AG8A 2FCNA 4ZRIA 2G4DB 1BT0A 5IA2A 4R5YA 1PMNA 3UOLA 3BYOA 4DEEA 3NAYA 2M1MA 4OT5A 1Y57A 2WQMA 4PF4A 4FYOA 5AJQA 4G2FA 2Y5BB 3LIJA 5FP5A 4RJ6A 5EW9A 2EWAA 1WY8A 3MJWA 4AGDA 4XH6A 4K6ZA 3OMVA 3O23A 1YRPA 3A7GA 2PEAA 3I79A 4I94A 4MX9A 3UJGA 3IW4A 4FLHA 3DKCA 3W1SC 3KXXA 1O6LA 3UNKA 4R1VA 4EEWA 2HOGA 4C61A 1UU3A 1OIQA 4MQ2A 4CCUA 4MXZA 4YJVA 5ANKA 3GU8A 3CTHA 3KKVA 3RBWA 4XRJA 1E5WA 2DS1A 3A7HA 1Y6BA 4KZCA 3EH9A 4EBVA 4KKHA 1LP4A 1JQHA 4EOQA 3DU8A 1KE7A 5EW3A 5ACBC 3FZPA 3WANA 4JR3A 3V5QA 3LXKA 4HK2A 4A3PA 3KA0A 3F2NA 4LI5A 3FMMA 3LFFA 4FVQA 4JX3A 3ZO4A 1J3HA 4WUAA 2WTCA 5J7HA 4XX5A 4MF1A 5E8TA 3QQHA 3QKLA 4IZ7A 4XNEA 4O1PA 5KE0A 5JMSA 2WMAA 3ORIA 1U4AA 3QHRA 3JYAA 3VUKA 1FXTB 4FSTA 2CS4A 5A4EA 3VDZA 4KDLB 5L95C 2R4BA 1NI2A 3PVBA 2IO2B 5A4CA 2YLFA 4PDOA 4LOOA 4O91A 4EZ3A 3WF7A 2ZAZA 1K9AA 5J18A 4I24A 3NUSA 5AZGA 3EZRA 2Z7QA 2W7XA 4QYFA 4ANBA 3W1FA 2J5EA 4DLIA 4YJOA 4FT3A 4LCDE 5GJGA 4E4XA 4S2ZA 4E5AX 2REIA 3WA0A 4J8NA 4I6PA 3DB6A 5DWRA 1WAKA 2XS0A 2ZM3A 1ISNA 5DPSA 2XNPA 5EW8A 1WVYA 2R64A 2EU9A 3F7ZA 4AXAA 4M0YA 3PVWA 2VTMA 3PJCA 2VWYA 3C0GA 3EC8A 3PE1A 3NDMA 2AC3A 4OAVB 5FR6A 4QYGA 3EKNA 3GQIA 2Q0BA 1UBIA 3MPTA 4C3FA 2JDRA 2X8EA 4FTNA 2IPXA 5F1ZA 2YDIA 4CYIA 2CJMA 5HNBA 2M4NA 5IH6A 3UGBB 3LMGA 3FL4A 3PJ2A 4M14A 4D0XA 3RT3B 2XM9A 4S34A 2IO6A 4Z55A 5AA9A 3PIYA 4EKUA 4MF0A 3ULIA 2ESMA 1KOTA 3UQBA 2NO3A 2LVPA 5HKMA 2QU5A 3HRCA 3MVHA 4FTIA 4R7HA 3DDQA 1KOBA 2UZEA 4XEYA 4ASZA 1NA7A 3N9XA 3PPJA 4YJUA 4XG8A 4DTBA 5GJFA 2OF4A 4FTLA 3RM6A 1RE8A 5I3OA 3GC8A 4TTHB 4L45A 4DBXA 1K2PA 4RWLA 4K18A 1P4OA 2KQSA 5E8ZA 5HG8A 3GNIB 1J1BA 2MBBB 1PKDA 1YOLA 3HDNA 4QTAA 3K3JA 3I7BA 2MWSB 4ACDA 2FNJB 2GDOA 4ANVA 2HCKA 3U9NA 2RL5A 4GSWA 4FV5A 4LJPB 2KK8A 4C34A 4EZ7A 5FRIA 3R2BA 4DEBA 2FSTX 2YM7A 4TYEA 2C1AA 1KE5A 5L2TA 5D7AA 3G15A 2BDWA 5LJJA 3RALA 3VUTA 1OBGA 3DCVA 4BCQA 3W18A 2KNBA 1WIAA 4W4VA 4FE2A 4DHJD 1AGWA 1JVPP 1YXVA 4O82A 4IIRA 1ZYSA 4MVFA 4AUAA 2VNYA 2REXA 1QZEA 2RSVA 3EN5A 1KM7A 3UIOB 3P7AA 2B1PA 3DBHI 4U41A 2WMBA 5CANA 2OIDA 3JSVB 2N1WA 3NWWA 1MRVA 5D94A 2PVLA 1V1KA 4XBRA 3B8QA 3NY5A 3DOGA 1WMHB 3ZH8A 5EM5A 4U81A 1ZOEA 4I92A 1U54A 3VBWA 2KWUB 4KIPA 4GMVA 4IX6A 4QQJA 4HGLA 3ODYX 1XQQA 2PVFA 3PIXA 4EH4A 2RKUA 5FD2A 2WTVA 4R8QA 3KC3A 5CSPA 3FSKA 1P98A 3DKOA 4ZTRA 4G1WA 4QMZA 3TACA 4UMTA 3QZFA 1FGKA 3U6JA 4NTTA 5KHQA 2VZ6A 3KRRA 2BZJA 1ZYCA 2WDTB 4GYIA 3LHJA 2A1AB 3MPAA 2DX5B 2YIXA 3Q4TA 3HV4A 5AAFA 3NUAA 3R7GA 2C5YA 4CT1A 4PUZA 5M06A 3GOKA 3PP0A 3FZ1A 4NJ3A 5EG3A 2R3HA 3VHKA 4YTHA 4OGRA 3ZDMC 4XX9A 3L8VA 1V86A 4FICA 3QTRA 1C1YB 2I1KA 2PULA 5AV0A 4BKSA 3RJCA 2KC2A 4M15A 3ZLWA 4GIIA 1WE7A 1TQPA 3WE4A 4G6NA 3NHEB 3GZNI 4X3FA 3E7OA 5JRQA 4KDIC 2NVUI 3ZBXA 1FINA 4FEQA 2HZ4A 1RDQE 4L3PA 1S9JA 4BKZA 3IQ7A 3U4WA 4CKIA 3CE3A 4JI9A 1JPAA 4LG4A 2ZDUA 4IX5A 5AP4A 2PJHA 4D2PA 3NX8A 1PY5A 2Y6OA 4W8EA 3QZHA 2VUWA 4KB8A 4U3ZA 2FCMA 3NZ0A 4XC2A 3UP7A 4IWOA 2KLCA 4YBJA 2HELA 2ZDTA 2OZAB 4LUEA 2X4FA 2ETMA 3SRVA 5CAQA 4X2JA 2O6VA 4OTQA 4A7CA 3FLQA 4F9WA 3NNWA 2GNGA 3TXOA 5CU2A 3QQJA 3TV7A 3JY0A 5CZHA 4BBNF 5GHVA 4YLJA 4E4LA 2ZB1A 5EDRA 5I3RA 4Z7HA 3LKMA 4ORKA 2ZM4A 3LQ8A 3NZUA 1XBAA 3SOAA 3R1SA 3I6UA 4GUBA 4L3JA 3TNQB 1F5QA 3BHUA 3UOHA 2RG6A 1BYGA 5AR7A 3Q9XA 2XRWA 3NMUF 2XKFA 4MTAA 4FG9A 4KINA 3A7IA 2QURA 5I5ZA 3ML8A 5BUIA 4HCPB 5GMVA 3SG9A 4CGAA 1GZNA 3HUBA 5L2IA 4W9XA 5HE1A 4IVBA 4CZTA 3QRUA 1WM3A 5H8BA 2R3OA 3FI2A 3VBTA 2PZYA 2J0LA 3ZXZA 1OUYA 3HMNA 4HVSA 4YJNA 3SVVA 3GCVA 2BPMA 3CPCA 4JQ8A 4FV6A 4J96A 3RK5A 4B6LA 1FMKA 1OKVA 2LXCA 2YM8A 4JLCA 3Q2MA 1UA2A 2MBOA 3OFMA 4NZWB 3E8DA 4B99A 5J7BA 3DPDA 4RM9A 2GBNA 4DFBA 4GFOA 4I1ZA 4EL9A 2QO9A 4BY9E 1GNGA 4BIBA 4FZ6A 3DCGA 4NM5A 3AD5A 3BHYA 2ITYA 5GIPE 3EYGA 3EHAA 4F8CB 4FULA 3AT2A 2WMRA 2J0MA 2UZLA 2OXYA 3Q9WA 3Q4UA 4BYJA 4NPNA 4XZ4A 2GHLA 5AR8A 3VS6A 3ZW3A 2YHVA 3WI6A 4H3PA 4ANWA 4AWIA 3KXMA 4DT8A 3PWYA 3JR1A 3O17A 3EL8A 3R9NA 3EKKA 4E3CA 4FOCA 3SV0A 1TVOA 4EC9A 3NCGA 5HE3A 3MY5A 4FVPA 2J7QB 3GQLA 3PG1A 3TIXA 4ZZOA 5A6OA 1KV2A 5B0XA 4F7NA 1ZYLA 3DBEA 4FNXA 2BAJA 2J90A 2IWIA 1XR1A 4YZCA 3DTCA 4C02A 4CSVA 2W5BA 5HE0A 3NNXA 1NXKA 3FKLA 3ZNZB 5LMKC 3VAWA 4GDLB 3D4QA 4H05A 1OEYJ 2E9VA 4IB1A 2Y6MA 4GFGA 4IEBA 2VNWA 3U30A 3OY3A 2KJ6A 4JAJA 5FQDC 2RIOA 4UBAA 4WG5A 4FKIA 2K8HA 4RIXA 1UBQA 2C6EA 1CDKA 3MTLA 3VULA 4NUSA 5HTBA 4PP7A 5JH6A 4FKLA 2PUUA 5BVFA 2FCQA 2CHXA 3QBNA 3L16A 4U6RA 3HP2A 4N6YA 5CEIA 3RVGA 4FSNA 2MLBA 3KFAA 4QTBA 3GC9A 3LW0A 1KE9A 5A6NA 1UU8A 3OXTA 3ZYAA 4AP7A 3D5XA 4XBUA 3CGOA 2XEWA 3D5VA 4YJPA 2I0EA 5IQEA 2XK6A 5D10A 3RWPA 1CTPE 4NK9A 3AG9A 5GIOE 3JVZX 4HVGA 4V0GA 3ZLSA 3OXIA 3LE6A 4C58A 2M17A 3R7IA 4AJYB 3T9TA 1S1QB 4HJKA 4D4YA 2VTOA 3EJ1A 3IFWB 1Q5WB 3ELJA 3U54A 2IW6A 3JY9A 4PS3A 4OAUC 2BRBA 3NGAA 4K11A 3TNIA 4CEGA 2R9SA 4ZJIA 4IC7A 3QD3A 1IYFA 4BCIA 5J9LA 4U97A 4Y85A 2VO3A 2V7OA 1YKRA 3GVUA 3CQWA 1HCKA 4EOYA 2GCDA 1RFAA 2CPKE 4CKRA 3D2KA 3C4EA 2HK5A 4C38A 3C4ZA 3V6SA 1TTNA 3PJ8A 4XHKB 3VQIA 1LR4A 3GU7A 3DBQA 2PU8A 1C3TA 4D58A 2BHEA 4FUXA 3FEGA 2B54A 5TE0A 4Y46A 4CRSA 3Q96A 1RLFA 2YDJA 2PVNA 3Q6UA 5I9VA 4GW8A 4IAZA 5M4FA 3FMEA 1R0EA 2OK1A 5HVKA 5J5SA 3D5UA 4XMOA 2Z0DB 2YJRA 1WR1A 5BYLA 1GIIA 2OO8X 4FV8A 1M17A 5E4HA 4GXBA 4ARKA 4W9HA 1KE6A 3L17A 5A9UA 3V04A 3L1SA 3L10B 5IQGA 3D15A 3W2OA 4CFXA 2W1DA 5TO8A 1T0YA 4BI1A 1SM2A 3FZSA 5IMXA 3C7QA 2ZPYA 1OBDA 2XH5A 5HZNA 4RFYA 4FIJA 4EOSA 2X81A 5KMJA 5M55A 1Q97A 3WIGA 4YC8A 1WGHA 3EQCA 3VNTA 2JDVA 2LGXA 4HPUE 4IANA 3SGCA 4K9YA 2W4JA 2BCJA 4CG9A 4QO9A 4CT2A 2QKWB 4XP0A 3QRJA 2E9OA 3ZLYA 4O2ZA 1EF1A 4RIOA 3LFQA 3P5KA 2ZNVC 3GC7A 2VTTA 3HV6A 4JL9A 4C7TA 4ZSGA 4NCTC 3QARA 3VWAA 4L9IA 3PZEA 3V3VA 4CMUA 4D0WA 2L76A 3VVWB 2JDOA 2KTYA 4O7ZA 3VIDA 2FVDA 1ZW7A 5AX9A 3TUBA 2WD1A 2C5VA 1OL1A 4FKTA 1DAWA 4W4YA 1NDDA 4W9GA 2X39A 2EKEC 3D14A 3P7CA 2D07B 1BL6A 3PXRA 3DJ6A 4IDTA 5DOSA 3OWLA 3P9JA 5L83A 5E8YA 2XIYA 5FEQA 2JKQA 3PXKA 2FSMX 3KF7A 5LVLA 4IB5A 2XK4A 3OC1A 1GY3A 4B8MA 5JZEB 4U5JA 3QCAA 3UGCA 5H2UA 4FKOA 4G3EA 4BCMA 3F3TA 2RG5A 3UQCA 2GQGA 2XK3A 2UW9A 5K4IA 2BDJA 4NT4A 3EQHA 3CF6E 4ACMA 4XYFA 4OTHA 1VCBA 2KJRA 5JQ8A 3R3MA 5D12A 4JT3A 3A9JB 4MELA 4EUTA 3TUDA 3HA6A 1ND4A 3F5PA 3MJ2A 4YC3A 4XV3A 4AFEA 3R6XA 2KWVB 3W1SA 4N4SA 3VUXA 1P4FA 2LASA 2O3PA 4D2VA 4KKGA 2EMSA 4PRJA 4C3PA 4KVGB 3GI3A 4G16A 3TL5A 5FP6A 2BFXA 4LRJA 5AADA 1SIFA 2VX1A 4U40A 5CSXA 4F4PA 3RMFA 5LMBA 1PMUA 3FY0A 3QWZB 3H9RA 4XOYA 4NL0A 4IFGA 4K33A 3A33B 4GOCA 5EKOA 4E5WA 3IGOA 3R7RA 3HL7A 2BIKB 4FTOA 2BGFA 4DT9A 5IQDA 3QQ8B 2JRIB 3M42A 4BHZA 2R3LA 3OWKA 4PPBA 3W8LA 4A9YA 5J79A 3VS4A 3E63A 2O2UA 5CTRC 3H0YA 1WBSA 5A14A 1YX6B 2FH9A 4FSRA 4GU9A 4TWCA 3FYJX 2WIPA 3ROYA 5LVNA 3VBYA 1ZYJA 4YURA 4O27B 5ITAA 4QRCA 5I9WA 4BDBA 1JAMA 3V5LA 1STCE 2J2IB 3QD4A 3ZBFA 3HRFA 3ZO1A 4HGEA 4KIKA 4M0WB 3ONSA 3IECA 2JC6A 4KSQA 5HG5A 4AOJA 1OL2A 3C0IA 3PJ3A 2X6DA 4FTJA 3W10A 4CMOA 4RBLA 4UALA 4DEHA 2LGYA 4YR8A 4BZNA 1E9HA 2F57A 1AD5A 3EFJA 5CQUA 4NFNA 3F3VA 2JF5A 1UD7A 3GCPA 4EQMA 1J19A 1SE9A 2C7NB 3U8ZA 5FM3A 2C69A 4DWFA 3R00A 2OH0E 4CRLA 1PXKA 4HDOA 5ETAA 2PHKA 4FT9A 5I4NA 4YGAA 5C27A 4JIOU 2G2FA 1EF5A 3TV4A 1Q24A 2UZNA 2PZRA 3OAWA 3PY0A 3DBCA 2QOHA 1QMZA 1LEZA 3UYSA 3DZQA 4QMWA 2FO0A 3VXWA 4O7YA 3OUKA 3R8ZA 3PY1A 2JITA 5FEDA 4DFNA 1O6KA 4AQCA 3A61A 2Z7RA 3AD4A 4C8BA 2QOQA 3EQBA 4LGDA 4QP7A 4O0VA 2QNJA 3QYZA 3ZDTA 4IX4A 4L46A 3DFAA 2GTNA 3U87A 4R5SA 5JT2A 2X1NA 4MH7A 3E87A 4TNBA 3DAJA 3Q3BA 5M53A 5F94A 1YOMA 3T3VA 4ANXA 1B39A 3HGKA 3ORNA 3NYNA 4WWNA 3O7LD 3DK6A 2KTRA 2N9PC 3B2WA 5G55A 2OJRA 2P3GX 3CBLA 2RR9A 3ZRLA 4IQ6A 3LLAA 2ZCCA 4O0TA 1H1PA 1M7NA 3PY3A 1YQJA 2C4GA 5I0BA 1WGRA 4CTCA 3G5DA 5HO7A 1OM1A 4ACCA 5IQIA 1OL6A 4Q2AA 2WX0A 4AF3A 2OJ9A 2UZBA 4C4EA 3NVMB 4DYMA 2VWBA 3JXWA 2O0UA 2R7IA 2IYDB 5EI6A 2CKPA 3LQ5A 4FNZA 4RSSA 4CFVA 4FL3A 2IZVB 2KZRA 5B7VA 2ZOQA 3QTUA 2P0CA 3FBVA 3R7YA 4AE9A 4AN9A 4IX3A 2W96B 4JIKA 4FSQA 4HW7A 3QWKA 4ASDA 4MNFA 2WAJA 4AW1A 1WZYA 3CKWA 4PPAA 1H28A 4I6BA 3ZFXA 3PLAE 4D9TA 3LCTA 3DLSA 1IA9A 4NY0A 3BZ3A 4C0TA 4K2RA 2IY1B 3T8OA 4DCEA 1XBCA 4CYJA 3W33A 3O8PA 1PXIA 3ZNHB 2ITUA 5CS6A 4YLLA 2UV2A 5DRDA 3I5NA 4MXXA 4NQKE 3F88A 4LMNA 4L7FA 3EZVA 4MXCA 5HCYA 4QTEA 1Y8RC 1YI4A 5TT7A 5JZJA 1LQBA 4N57A 2PZ5A 4FG7A 2OJIA 4A4XA 4W9KA 2OICA 2O63A 2D3GA 4H3BA 4IJPA 5HNIX 3FE3A 4FT0A 3WF8A 3SKCA 3MA6A 3LAUA 2UW7A 5DR6A 2V4LA 3EQIA 3GFEA 3FMDA 4RFZA 3BEGA 4MKCA 3IOPA 3UDBA 5CI7A 4ZY5A 2BTRA 4UY9A 2BWFA 3F5XA 3GCUA 2M8SA 5H9BA 3VS3A 3AD6A 3OHTA 2B7AA 3A4RA 2BAQA 4BZDA 2YITA 5FXRA 3MVMA 2PY3A 4DDGD 4DAWA 2JEDA 4EZ5A 4BDKA 2W99B 3RPVA 2VAGA 4EOOA 2QONA 3G9NA 2EXMA 5CENA 3Q2JA 3DBDA 4FZDB 3JVRA 4KUJA 3SHEA 3FPQA 2G3QB 4ERKA 4ZTSA 5HIDA 3W55A 2OLCA 4MGIE 2O8YA 3COHA 2X2MA 4PMMA 4BCHA 4IFCA 5IA3A 4OLIA 4BGGA 4PPCA 2BRNA 5FXQA 2WTJA 3HMIA 2F7EE 2OZOA 2KFKA 3RP9A 2CGVA 4F08A 2JDSA 4A9SA 4GU2A 2ONLC 4PWNA 3L8SA 4ASWC 1Q3WA 3CMMB 4I0RA 3MGYA 3D0EA 3RINA 3TIYA 3EL7A 4EYJA 3QTQA 2QODA 4GL9A 1M2QA 1F9JA 5H8EA 3QX2A 3NSZA 4QQTA 2IBIB 5CY3A 4YTIA 4DEDA 2BALA 4CZYB 3H6NA 2JVCA 2L0TA 3S00A 2F2UA 3ZSIA 4RIYA 3PPKA 4KSLC 4TKSA 3CD3A 1H01A 4F0GA 4GK3A 3NRMA 3ANQA 2VTIA 3QTZA 3OT8A 4M7IA 3EFKA 3UO4A 3LFEA 4EUUA 4ZTNA 1JOWB 4Z9LA 5CEPA 3QD2B 2F7ZE 3NUXA 3GCQA 1FQ1B 4XG9A 3BYSA 1I42A 4BVUA 4LOQA 4BI0A 4FG8A 4ZTHA 2WKMA 2VTHA 3D9VA 3R7QA 3ID6C 4GFMA 4PYUA 4BFRA 3ZZEA 2CHLA 4AGUA 2CKQA 3QLFA 4L00A 5E90A 3VS2A 3O2MA 2XNNA 3MDYA 2N1VA 2FUMA 2CCHA 2KHWB 4CV9A 4IG7B 1PMVA 3PRFA 2GU8A 4G11A 5EDSA 4OTWA 3PREA 2KO3A 5BVEA 1E90A 4UV0A 3AMBA 1Z5SB 1SYKA 3CY2A 3CQUA 4EORA 4Y72A 1WXVA 3F61A 2GS2A 5G6VA 4F1OA 3EOCA 2Z8CA 4UMQA 5FDPA 2X7OA 3ORKA 3R9RA 5CALA 4W4WA 1YDRE 4IH8A 4YPSA 1P0RA 3JPVA 2AYPA 4WWPA 4OBOA 2NBVB 2V55A 4ZSEA 3VW6A 4YU2A 4PNIA 5KNJA 4QP6A 2A4LA 3C0HA 5CVGA 4F9BA 5F20A 5ANIA 2JRHA 3DBFA 3QCYA 4FTQA 4B9KA 4O7TA 3DZOA 2ZVOA 2IW9A 5K5XA 4BDEA 2PMLX 3V6RA 4M84A 1Z2MA 4EH9A 1NVRA 3MFTA 5IDNA 2ETKA 3HZTA 2XK5B 1OIRA 1W7HA 2NBUA 3KMWA 2SRCA 3WARA 4F65A 2KMCA 2BWES 2CHWA 3AC5A 4DFUA 3AT4A 1U4DA 4AZWA 3VS5A 4YBKA 3CCNA 4C35A 2YAKA 4F7SA 3ZM4A 4FTAA 5HGIA 2ZEQA 2GHMA 4OTDA 2K8BA 5J2RA 1MQ4A 1ZGUB 4WNMA 4GKHA 5EHLA 4P2KA 4DGGA 3RM7A 4EK3A 4FL2A 4PL5A 4DGNA 3MH0A 2CKHB 3TJDA 1BI8A 2W1IA 2NRUA 4L6QA 3WF9A 1S9IA 3ENEA 4M8NA 2YABA 4L7SA 2X9EA 5ACKA 3P7BA 3FMKA 5C01A 4FZAB 5AZFA 1UNGA 3WBLA 4X7QA 2W5AA 3FUPA 2KDIA 2ZB0A 1YVJA 3ETAA 4XS2A 5I9XA 4BBFA 5CHVC 4J8MA 3RULA 2VWIA 3OP5A 4EK5A 3PYYA 1WVXA 4UYAA 5J5TA 4I0SA 4FGRA 3HVCA 3QU0A 3NVKI 3A60A 3TZ7A 3WF5A 1E1XA 4BDJA 2X2LA 4FV1A 1PJKA 4HPLB 2XKCA 5LVPA 2MA9B 4O0RA 3OTVA 2MQJA 4Y5QA 1UWJA 2Y9QA 4XP2A 4WOVA 2WMTA 4E5BA 1OL5A 5KKRB 2JXXA 3UINB 5BUEA 2WU7A 4EKKA 4X21A 3UPZA 3DXPA 1JKTA 4YMJA 1OEYA 2LRUA 2DUVA 2BVAA 3ZNGC 3ALOA 4AOTA 3QC8B 2ZJDA 4UEUA 3NW5A 5DFPA 3PSCA 4WJQA 5AFVA 4F9AA 3FSFA 2UWQA 2C9WB 2YIRA 1BI7A 2QOKA 3O65B 4XJ0A 5J9YA 1DI8A 4A4LA 3EN4A 3UG1A 4JR7A 5HLPA 3KULA 1Y91A 3TCAA 2R0UA 2YM3A 4QTDA 3MH1A 2Y8OA 3HUCA 3QAQA 3OW3A 2QOOA 2X6EA 3TCPA 4BCNA 5CQWA 3ACKA 1PQSA 1NT2A 4RQKA 2NNWB 4P5ZA 4X2KA 4G9CA 3F5GA 5IH4A 1O6YA 3M95A 4USEA 1YXTA 5BVDA 1Q8UA 1L7YA 5DT4A 2PE0A 4YTFA 2PL0A 4CMTA 2Z7SA 4QYEA 4OTGA 3FXWA 1KLVA 2W9NA 3S95A 4N6ZA 1H8FA 3R1QA 3UO5A 4V01A 2C0TA 1P14A 3ENHA 4FA2A 2AL3A 3NNUA 1IEPA 4L67A 3C50A 2D2QA 1YXXA 4ANNA 2C6IA 1R0PA 3RPYA 1E7UA 2KDFB 5JHAA 5AM7A 3EFUA 1MG8A 2FGIA 2YFXA 4WD5A 4OUCA 4JGHB 5IEXA 4DN5A 3OJ4B 3HM3A 4C36A 4FTTA 4F6UA 3S2AA 4Y83A 3DLZA 3VW8A 1WJNA 4JJRA 4R7BA 3NIEA 4TZRA 4DBNA 5EM7A 2Z60A 2C6LA 3OBGA 4K81A 3QQFA 4MNEB 5DPRA 2MBQA 5DH3A 5DI1A 4DE4A 2QO7A 3MVLA 1PMEA 2VTPA 3MIAA 5LLIA 1AARA 2YWVA 5E8XA 4FIGA 5TR6A 2R3FA 5KX8A 3RHKA 4ANOA 3FXXA 3F3ZA 3CSVA 4IXPA 4I5CA 3MFRA 3BEAA 4FT7A 4I93A 2J5FA 4R7IA 5EI8A 4MDKE 2DZMA 3UG2A 4TY1A 2ITXA 3MHSD 4DEIA 4BHNA 2K8CA 5L8JA 2BMCA 5EK7A 1H07A 4JRVA 4FZFB 4P90A 4WSYA 4RC4A 3MYGA 4E6CA 4W9LA 3MY1A 4O0WA 3GU5A 2JBOA 4P5QA 3ORLA 5EDPA 4JOAA 4ZDVA 5JGDA 3C4FA 4QP4A 4E20A 3PSEB 2HY0A 3OY1A 4M69B 4NKAA 5J9ZA 5A46A 5M07A 2QCSA 3V5TA 1EH4A 2QOBA 4FV0A 1XHAA 1WBWA 4RJ7A 4CCBA 4IWQA 4FV9A 4K77A 3Q5ZA 1WZ0A 1P2AA 5HU3A 1X1MA 3RPSA 5M4UA 3SG8A 5HX6A 5DIAA 3BBTB 5HICA 4X2FA 3BE9A 1G8SA 3L8XA 4FTKA 4F64A 3D32A 4NIFA 5AR4A 3L9LA 2GHGA 3RZFA 3IHPC 2QVSE 2QOFA 2YJSA 1YWVA 5IKWA 4FJYA 4GB9A 3VTWA 2VTAA 4FBJB 3E3PA 3Q53A 4OW8A 1R39A 3PP1A 3WAMA 4FI1A 1M2PA 2L00B 2BHHA 4XV1A 3GOPA 2G45B 5J87A 5K5NA 4QP1A 5B2LA 3GU4A 4RX8A 4PMSA 1VYZA 3REPA 5IA5A 4AN3A 3OZ6A 1YD8U 4LRMA 2XJ2A 4J6IA 5FUTA 4S33A 4U3YA 4YL8A 5K0KA 4I6LB 3KXNA 2A4ZA 1F0QA 3CR0A 2PPHA 2OOBB 4AJWA 5DEYA 3QTSA 3AXCA 1XO2B 2GMIC 1JBPE 3B1LX 3QAME 3KQ7A 4EK8A 4DBGA 4F1TA 1E8WA 2ZMCA 1IA8A 3GU6A 3APFA 3BWFA 5HVYA 3A4PA 3RZBA 4FR4A 2MP2B 4OTFA 2JFMA 4FHJA 3TN8A 4AZVA 2R2QA 2J9MA 3OS3A 3CKXA 1PYXA 2R5TA 2XF0A 2O2VA 4BBNC 4AACA 2ZCBA 1Q99A 3ZS5A 1XH4A 5AA8A 4ASXA 1OKZA 4WJPA 4DFLA 4RZWA 4MGKE 3IONA 3EFLA 2WXVA 4G31A 3RAIA 2KJHB 2R3PA 4GYGA 2UVYA 2QHNA 2DAJA 3FV8A 3WIMA 5AP3A 3OOMA 2W9FB 2JGZA 2EB2A 3PVLA 3UIUA 4UXLA 4WNOA 2XCKA 1ZZLA 2JIUA 2EXEA 3A4OX 4FTRA 2I1MA 1PXLA 4R3PA 2H9VA 2HWOA 1ATPE 4O7LA 4NJDA 5DPTA 3FKOA 4HZSA 3G9LX 2HD5B 2C0IA 4HYIA 5I9YA 4EH6A 1QPCA 4C4GA 3FL5A 4UB7A 4IADA 1Z9XA 4O0XA 4PL3A 2FB8A 3V8TA 5C4KA 4TYHA 2PZPA 1JNKA 1R3CA 5EYCA 3KRLA 4Y5HA 3PXQA 2OJFE 4RPVA 3GT8A 3R8UA 3VJNA 3PPZA 1OECA 3ZIMA 4DG0E 3FMNA 1YOJA 3SW4A 1ZRZA 4EBWA 3OD6X 4BDGA 4X6QC 4ASEA 4UZHA 5AV4A 2I0YA 3X0WA 2NPTB 3PHXB 2WTKB 2OH4A 4UWYA 3A1QA 3COMA 5BVNA 3GXLA 3TNWA 3ACJA 5HCXA 4LDTB 4AX8A 2C5OA 2LZ6A 3WAPA 4XG6A 2WOUA 3VS1A 3H9DA 4FHKA 1V0BA 2CN5A 3DGKA 4LMUA 4ALVA 2I6LA 3ORTA 3ZSGA 2W1ZA 5CAPA 2XMYA 2BKZA 3NS9A 5HD4A 4WJOA 3C5UA 1WJ4A 4FBXA 1PXJA 1URCA 3QKMA 1Q5KA 4HNFA 2R2PA 4W9DA 4I6HA 1LEWA 2FSOX 4KZ0A 3KREA 3FMJA 4EOMA 1ZMUA 4IB0A 2L3ZA 4ZOGA 3WZKA 2BPSA 2C0OA 4BKTA 2XP2A 4KV2A 2UZUE 5ANJA 5GZ8A 5GNKA 5KMKA 1OIUA 1Q8YA 3DBSA 4R1YA 3QUEA 3ZC6A 4NW6A 3VO3A 3DPKA 4A9RA 3GBZA 4RQVA 3TV6A 3GUBA 5FM2A 1UV5A 1ZY4A 2R2OA 2P2IA 1Q4LA 4ITIA 2OG8A 2XZSA 3LFAA 4RJ4A 3OTUA 3KCKA 1XT9B 4AZEA 1GNUA 4EOIA 1ZWSA 1OUKA 2C3KA 2WWZA 4XV2A 1XBBA 3A7JA 4CG8A 3H9OA 4BDIA 2P55A 3FZTA 4XOZA 3COIA 3GC0A 4KBAA 1U5RA 1SMHA 4FYNA 3A4SC 2LXAA 4ENXA 2VRRB 3H7PA 2XA4A 1NY3A 1E8XA 4G0NB 3C4XA 1WBOA 4BTKA 4WWOA 4MEDA 4II3B 4DG3E 1WGDA 3GP0A 4OT6A 3U4UA 2GBJA 1YI3A 2XNBA 4R6VA 2PE2A 3W16A 5BYYA 1WGYA 4RJ8A 4IW0A 5EI2A 4EOPA 2VTNA 3QCQA 2QU6A 3ZC5A 1J1CA 2DZJA 2JAMA 2VTSA 3OWJA 3AU5A 1KUTA 2BRHA 4F09A 2YDKA 3PTFC 4KSKC 3KULB 2KDBA 4H1MA 2BZHB 3AU4A 5TOZA 5HU9A 1MQBA 4TWOA 4HCTA 4B8LA 3Q60A 4ZEGA 3DV3A 1Q1OA 3NUYA 3NZSA 3SXFA 4B7TA 4MWHA 3F3WA 1OGUA 3V61A 5EHOA 1CMKE 4FMQA 4YJQA 5DEWA 5IA0A 4RVMA 5CVHA 5E6NA 3L9PA 3D83A 5I9ZA 2UZTA 4QNAA 2QLUA 1UKIA 2PK9A 4C2WA 3AMAA 3QX1A 4RC3A 4GG7A 4MBIA 1MRYA 3ZTDA 4YZBA 5KHXA 5IQCA 5CU4A 4M3QA 1FVRA 3LDZE 2C47A 2HENA 3KB7A 1E8YA 3PRIA 3R66C 4QMUA 4ACHA 1M52A 4MXYA 3LQ3A 3HECA 2XBJA 3O71A 3V5WA 5AAEA 2CGWA 2UZOA 2ERZE 2I40A 4U44A 4FODA 3D7TB 3PV1A 3KVFB 3QWJA 4QPAA 4UMUA 4DH7A 4E6QA 5C1QB 1OTRB 5EOLA 2E9UA 2G1TA 1SVEA 2ONLA 4BDAA 1JSUA 2RSUA 2ITWA 3N4VA 5IUHA 3UYTA 3IW7A 3O8TA 1JLUE 4HXDA 3PPAA 5DPWA 2V62A 1YDTE 5A4LA 4ALWA 3HHMA 3A62A 3IDBA 4FJVB 3V8WA 4XG4A 4NEUA 3E8CA 3UC4A 3RUIB 2QKRA 5AUTA 3NR9A 2C3JA 1WYWB 5AIRA 3UODA 1WXMA 2KLGA 4Y95A 3UIMA 2PVYA 4HGTA 5CAOA 1TGZB 2R3GA 4BCFA 4O0YA 4II2B 4EZKA 2KANA 3SD5A 2VTJA 3JVSA 2ITZA 1G6JA 3C51A 4B9DA 3PHWB 4CKJA 4O86A 3DJ5A 2IVSA 4GIVA 1IASA 2ITOA 5AWMA 3KVXA 3VS7A 4MHAA 2WU6A 3QA0A 3HYHA 4O6LA 4BCJA 4KRDA 5EKNA 1H1RA 2A19B 3NUPA 3Q9YA 3JW0X 2NP8A 4NU1A 2OI4X 3FWQA 3MW1A 1Q61A 3W1YA 1WMKA 2VTQA 2ZV7A 4FSZA 2VWZA 3ZUUA 3LXNA 4EH5A 3E92A 3B0AA 4QPMA 3KUZA 2R3KA 1JKSA 3DDPA 2EUFB 2QOLA 3FLNC 3H1UA 4GK4A 4DA5A 4KA3A 3AQVA 3SU8X 2XYNA 4K7WA 2WGJA 3P23A 1APME 2UW3A 1H27A 4E4NA 2C68A 2KOXA 2HZIA 4EHGA 4MQ1A 2NR2A 2IVTA 2XKEA 5AP0A 5HOAA 5AZHA 4ZRJA 4O21A 3HX4A 3MV5A 2YEXA 4BDDA 2XK8A 4ZSJA 3I7CA 3O50A 4FN2A 3O51A 3OF0A 2LAVA 3DOWA 2PUNA 1KE8A 4I5HA 3P1AA 4IZAA 4G3FA 1S3SG 3FLSA 3SD0A 4FVRA 3Q5IA 5AUUA 4BKJA 3KUCB 1G8AA 4CXAA 3ZLXA 2GQSA 5DHJA 3FMLA 3TKIA 2BAKA 3R8MA 4ZK5A 5HTIA 3KRWA 4IE9A 1RJBA 4IM2A 4F7JA 3EMGA 3R22A 4GDKB 2OFVA 3MH2A 4YSJA 3MTFA 4NAWB 4FSYA 4PMTA 4ZIMA 3PFQA 3P2BA 4CFWA 4ZTLA 3ZRCA 1WM2A 3CY3A 4O83A 3MN3A 3A8WA 3APCA 3THBA 2ITVA 3II5A 2PVKA 2L05A 1R78A 5JFXA 2C6OA 1P9DU 2WTDA 5L2QA 3WZUA 4C57A 3R04A 2K39A 1YWNA 3QFVA 3A9KB 3KRJA 3DK7A 4YO4A 4BVUC 1L3RE 1EUVB 5JHBA 5FLFA 4DK5A 3MTNB 1LXDA 3UPXA 4U80A 3PG3A 4GEOA 3QJZA 1ZXEA 1DM2A 2YZAA 4I4EA 5E6PA 4BI2A 3BY4B 2VN9A 4BCOA 5KHWA 4AU8A 4LV5A 3KH0A 3QA8A 4BKGA 3RCJA 4RIWB 4EH2A 4GS6A 3VUDA 4ZMEA 4HVHA 3ZO3A 4S31A 4DH3A 5EYMA 2FSLX 5BNJA 3DKFA 2QG7A 4IVCA 5DPVA 2JKKA 2RGPA 3FLYA 2P33A 2IO3B 3PA3A 2WZJA 1NBFC 1YQBA 1KSWA 3JSVA 5JH5C 4AW0A 1GIHA 2ITTA 4GH2A 4O1OA 5HQ0A 4LJOB 1G3NA 2OBJA 1WMHA 4EK4A 3H9FA 5CLPA 1ZY5A 1U5QA 3FMHA 4M12A 3AC1A 1PXMA 4U9AA 4U45A 2XK9A 4AA5A 4DGOA 3QTXA 2C6TA 4FV4A 3IW8A 4O7NA 2ZV9A 3E64A 2AL6A 1H1QA 3ULZA 2BYVE 5HG7A 2L8JA 1CSNA 4HVBA 3V6CB 3WIKA 1W0XC 4QOXA 3LM5A 3LCDA 2N7DA 3BYMA 1JSTA 5EYKA 5JRSA 5EM8A 3QLGA 3UZTA 4HCVA 4AZTA 4JRNA 4J97A 3ZZWA 4ONAA 2Y7JA 4K7UA 2W1GA 2OJGA 4RGJA 2R3QA 3EFWA 1JKKA 5L8KA 5AM6A 2XRUA 4DEAA 3BGZA 4WIHA 4LOPA 2KVRA 4DXAB 5CX9A 3VHTC 1AQ1A 1UU9A 4NH1A 4BCKA 4G34A 2JFLA 1L2NA 2PE1A 1GG3A 2UW4A 2B9JA 4WG4A 2QR8A 4CFUA 4FKUA 2MRPA 5L3AA 2XYUA 2Q0NA 1I09A 2A5UA 4RA5A 4AS0A 3CPBA 4PQNA 1B38A 2YISA 1J91A 4JBVA 2CKEA 3OCTA 4IC8A 1H1WA 2OSCA 5T68A 5KMOA 1PRYA 4G6OA 2W1EA 2D10A 4MM3A 4FA6A 4XG2A 1YX5B 1V0PA 3HV3A 4RLLA 4M97A 4WRGA 2CLXA 1OVEA 1UGMA 1J0GA 4W9JA 4ZLOA 3CGFA 4D4VA 3PZDA 4L44A 3EIDA 4N0SA 4EOJA 4PTGA 2IO0B 1P1AA 5CNOA 4RVTA 3VUGA 5IH5A 4YHFA 4QMTA 2WHBA 3DT1A 5M51A 1ZYDA 2JZ3B 3AI5A 2XNOA 2OZAA 3LOKA 3HMMA 4UN0C 2FIFA 2KKCA 3LPBA 1VYWA 4E74A 5E8SA 3NS8A 5M56A 4CFNA 3PDTA 4KWPA 4NWMA 5F95A 2OGVA 3L13A 1IP9A 2CKOA 4I5PA 3F2RA 3FQHA 5CI6A 3UP2A 2XNMA 3W32A 2JAVA 3DXQA 1GAGA 3VBXA 1DAYA 5CSWA 3DBRI 3TNHA 5BYZA 4FX3A 3LXPA 5DNRA 4MEMA 3HA8A 4KSPA 3EN7A 4EC8A 3OCSA 4X2GA 4E8AA 3DY7A 2J4ZA 4FKQA 4QP9A 4I23A 2W17A 4G5PA 4IAAA 3WZEA 2GFCA 3A2CA 4GGQA 3LMHA 4R78A 3WOWA 2YCSA 4BOSC 4H36A 2QG5A 3P0MA 2AYOB 5JK3A 4DHZB 3QHWA 5AR2A 4FV7A 4CZUA 3FXZA 4ENYA 3BLHA 3TTJA 4ZRKA 4W9WA 4FL1A 3VUIA 3G33A 3DA6A 3WZDA 4AW2A 4QMYA 3BX5A 3ZSHA 4RVKA 2WYQA 3KMMA 4B4LA 3KMUA 3PA5A 3RPRA 3TI1A 5IZFA 5BVKA 2L0FA 4DLJA 4NNJB 2JDTA 2BKFA 2WTWA 4J71A 3ZKJC 2DWBA 2XEZA 3UC3A 2WX1A 4D5HA 1PW2A 2J50A 4W9FA 4ZXTA 3OVVA 5L8LA 5DT3A 3FHIA 3FQSA 3E62A 5AP2A 3ET7A 2GBRA 4FSUA 4ZTMA 4UX9A 2PVMA 3M3JA 2XM8A 4II5A 1YI6A 3ATTA 2GOWA 4E73A 4Z7GA 3UMXA 2GSFA 5HIBA 3W2QA 4JQWC 2WMQA 1VD2A 3HMOA 4HNIA 2PWLA 4NW5A 2N7EA 5A4QA 3CXWA 2HW7A 2OWBA 4D4SA 3SDJA 1OZ1A 2W5HA 4GMYA 5IQBA 4Z3VA 4FTMA 5C8NA 4RRVA 3FPMA 3A7FA 4EZJA 5HO6A 2C5NA 5ICPA 4RWJA 5B2MA 3QGWA 5ANOA 5CXZA 1W82A 1Q0WB 2RFDA 5LMAA 2XBBC 4NM3A 4KBKA 1H4RA 4GDLA 1J7UA 5IU2A 3WALA 3RAWA 4IJ9A 4OBPA 1FGIA 1J7LA 3AC3A 5IQHA 3ZFMA 5CT7A 1WJ6A 5TKDA 3TTIA 5AX3A 2KD0A 2QC6A 5AP7A 5JFWA 4CV8A 4IACA 5IEVA
chains in the Genus database with same CATH superfamily
5AP6A 2MSED 3LYYA 2UW8A 2B0QA 4LRKA 1U54B 2WOTA 3I4BA 1H1SA 4DTAA 2W4KA 1KOAA 3TIZA 2PSQA 5ETFA 5CEOA 1IAJA 1QPDA 2VO7A 2D5GA 3CTQA 5ANGA 2DAFA 3AEGB 4AZ5A 4RJ3A 3U52E 4FKWA 2JU6X 2ZXQA 4M8TA 4TYJA 4R5GA 4Y73A 3GGFA 5J8IA 3POOA 3R71A 2X7GA 3HVZA 1REJA 2XAOA 4O6EA 4FJZA 2YLMA 1DI9A 4G3GA 4O0UA 3AGLA 3VTVA 4O38A 1Q3DA 3NOBA 3MC8A 2KTFA 3KVWA 2G4SA 4TYGA 2GPHA 2VWWA 4J7BA 5T3QA 3KL8A 3ML9A 2J0JA 4L42A 2P4IA 5JQ5A 3LCKA 3LCSA 4ZRQA 2UUEA 5E92A 4EYMA 1R4MI 3DHIC 4F0IA 4TXCA 1I7HA 5KKRC 5ETIA 2ZV2A 1WFYA 2Z0EB 4KAOA 2BS3B 2MX2A 5EHYA 2W1FA 1VR9A 1GAQB 3NVZA 1X03A 4GT5A 2CDZA 2C30A 3KUDB 4DFZE 4WWMA 3LVPA 5KCVA 4UWBA 4WG3A 4E1ZA 4WA9A 3GE3C 4P7EA 4J3OD 3QC4A 4AUQC 1O9UA 1W84A 2PE9A 1WE6A 4JG7A 4RFMA 3O3MB 3IVFA 2X2KA 3VRYA 5HBHA 3RMKC 5F4NA 2YCFA 4JG8A 4JVGA 4MCVA 5J95A 3P4RB 1PXPA 1RAXA 2HAKA 3LJ0A 2DHZA 4X3FB 2BROA 3C19A 3R1YA 4ANSA 2K6DB 4C80A 2WQOA 4WNKA 2IO1B 1T6BX 3NW6A 2MJDA 4PS8A 5D7VA 1O7DC 3ZO5B 4GVAA 4AW5A 1OL7A 4R3RA 2CNVA 3LFSA 1TS4A 4C3RA 2YM5A 5FKAC 1GPXA 3H3CA 3M63B 4EFOA 1LO5D 3UF8A 3R8LA 3HV7A 2HIWA 3PVGA 5HCZA 4KGTA 4ZJJA 2JIVA 2KC1A 2X5CA 4UZDA 1TYGB 4AKVA 3V5PA 3ANRA 3APDA 3LM0A 1SXTA 5LCJA 3SRVB 2O6VB 4PNKA 3UO6A 1H0WA 4OR5A 3IG3A 4EZXA 4CYEA 1J8CA 3BL9A 3K5VA 4DFYA 4Y8DA 4IAFA 3RNIA 4FZ7A 3GB1A 4GUEA 5JZNA 1X04A 3NW7A 3ZCLA 1YJJA 3NCZA 4WURA 1YN4A 2PUIA 2X7FA 3AMYA 4C2VA 1Q8TA 4C4JA 5IUGA 3ALNA 5AUYA 2XJ1A 3CD8A 2O0I1 1CKPA 2F7PA 3M11A 2QSDA 4BFMA 3UQGA 3PGEA 1V5TA 1HZ6A 3MVJA 2GQRA 3A99A 3UDSA 3MFUA 1H25A 4RG0A 3BV3A 2KWCA 3AEBB 5BUJA 1PHKA 4GV1A 5CZIA 4BGQA 3N30A 2W55A 3FAAA 4EHEA 3U8WA 2EFKA 3Q84A 4OTPA 3R01A 5KZ0A 5LXHA 4QP8A 3SLSA 4BKYA 4KS7A 3P4QB 4BDHA 4BWKA 4WKQA 1PXOA 3HRBA 5HVJA 1GOZA 2F1BA 5FBNC 5CU3A 4TW9A 4X2NA 3IDCA 4BF2A 1OA1A 3VAPA 5JN2A 5IF1A 3ZUVA 2QKWA 3N4TA 5K4JA 4DHZE 5G5HA 4YNOA 1IR3A 2YWPA 2B9HA 5D6JB 2A2AA 4HCUA 3RPFC 4ZS0A 2RF9A 2DYLA 1W98A 3CSTA 3ENMA 2LUEA 2GNHA 2MCNB 1V5OA 4P7IA 5E1EA 4RMZA 2BW2A 2UZDA 3DX3A 3ER8C 1H08A 3KU2A 4KS8A 2G2HA 5HX8A 4BAXA 3VQUA 4ZZMA 2ONQA 5D2MB 2VX3A 3QHTA 3QXOA 1V2YA 4YSZB 5J1WA 2CMWA 4U0IA 4AZSA 3NRZA 3BL7A 2OXXA 4JQ7A 4D1SA 4W9EA 2J0IA 3S3IA 4HCNB 2B4SB 3LZBA 1R4NI 3ORZA 1IRKA 2RAKA 2R3MA 5L6OA 5HLNA 3TL8A 4WQOB 1BMKA 3G0EA 1UWHA 4E93A 2J0MB 3QIJA 4QYHA 5AAGA 1QQRA 4E26A 1ACCA 4PT5A 5DR9A 3UZPA 5D41A 3N1ZC 4B9QA 5EQEA 3BZDB 3BIZA 4A9AA 1H4LA 3BYUA 5LXIB 4JIAA 3KCFA 3E3BX 4BBEA 3CSFA 2N9EB 5CWZA 5DA3A 4FSWA 1OPKA 1ERKA 2J51A 5FG8A 3RTPA 2B9IA 5D1JA 1CKIA 3Q32A 3M3WA 3QZGA 3KK8A 1XLNA 4TSSA 5ANDA 2DWQA 4JWEA 5CNNA 4RVLA 3W2RA 3ACOA 4EZOA 1SEBD 3A9JA 3ZYYX 1WYGA 4H58A 3T3UA 1VJYA 3QKKA 4I5MA 4LGHA 4LNIA 3PJ1A 1WF9A 3Q52A 4BWXA 2XAMA 3SA0A 3EQDA 2N4FA 1CKJA 2JX5A 2QIEB 5AP1A 3NUUA 1EU3A 4ICVA 4ZTQA 5C8KA 2QQ7A 4FC0A 3UITA 4DH1A 4RIXB 3BLRA 3W0NA 5CTPA 2PTLA 2BF8B 5CVFA 5D9HA 4AWJA 5HFYA 4I41A 4QMVA 4G3DA 3LFBA 4WIPA 2W06A 4A9UA 3F69A 4HDQA 1ZXHA 3W2CA 2YL9A 3P42A 4UXQA 3NNVA 2X4ZA 4YTCA 3SC1A 5L4QA 3UIPB 4LM5A 2YI8A 2V22A 4NTSA 1J7IA 1ST4A 4FNWA 1ZDXA 1M7QA 2PYWA 1HEZE 4FZOA 5CEQA 3DTWA 4MD9E 5KBRA 1UKHA 5M08A 1YXUA 4C59A 3OLMD 4OZBA 5BVOA 4XLIA 3PLSA 4GVJA 2BFYA 3H30A 2KX0A 3CLYA 2WO6A 4RX7A 5GINE 2X8DA 3KYDD 4JXFA 3ORPA 4YJSA 5CXHA 1Y6AA 3F9NA 4V0GB 5AV2A 3FZOA 4M68A 1M94A 2L7RA 4C4HA 2AQ3B 1FOTA 3I1AA 1H24A 2FUHB 4O81A 2RDGA 4DHFA 1OGYA 2DENB 4EK6A 3B8RA 4APPA 2F2CB 1DYQA 2J6MA 3AULA 4X0MA 4NSWA 3IW6A 2H6DA 4DF3A 2BIYA 4H1JA 4M0WA 5AR3A 5HE2A 2ZZPB 1UZXB 4D2RA 4E6DA 3FLWA 3AC4A 3FHRA 5KMNA 2HZ0A 4ZY6A 5HTCA 4O7VA 4EH7A 4TNDA 2X0GA 2BQQA 5JGAA 4IC7B 4XCUA 2GMXA 4HGSA 4JDJA 2LGDA 1GJOA 2VH1A 3D2IA 5AUVA 3G2FA 2QDFA 2V5QA 3D7ZA 3G90X 4J53A 2YIYA 4KNBA 3P78A 5AUIA 4U7ZA 1N62A 3TZ8A 4MWIA 2VGOA 1U59A 5EE9A 3RYTA 1HCLA 5A4TA 2H34A 1YQ4B 2YAAA 3EHVA 3CIKA 4GU6A 3FQEA 1XMLA 1PGAA 5M4CA 3MI9A 2VWVA 5BVWA 2IJMA 3I3TB 4FV2A 4ANLA 2V1YA 5T6KA 3U6HA 3BV2A 2PVHA 4X6RA 4J99A 5CHFA 2IVUA 1RQQA 3RAKA 3BQCA 5HBEA 3BLQA 2XANA 4OVZA 3VBQA 2O65A 3A8XA 2J52A 4K8AA 4F9YA 3Q4CA 4PMPA 1QCFA 3LFNA 3G6GA 2QHMA 3ZTCA 4LUDA 4CFMA 4EOLA 1SVGA 3KAVA 3D4YA 1OMWA 5FGKA 4WPCA 3VJOA 4HPMB 4NM0A 5DMZA 2LVOA 2WTKC 4UYNA 3ZTXA 2NCZA 2IZRA 4AT4A 1Q8ZA 2KQ4X 2X38A 5EOBA 1HE8A 3U6IA 1I4LA 4Z16A 5BV3A 3DQWA 4MSQB 1WDZA 1E1VA 3HAJA 2JLDA 3TBLD 4YHTA 3EJPA 4QMQA 4IUMB 5CASA 2HXLA 2BKKA 2F7QA 2W0JA 2X9FA 5BPYA 1PF8A 2C3IB 3FY2A 3ZOSA 3MFSA 2NBWB 5A3XA 1WZ3A 1FVVA 4F7ZA 4R3CA 3M1SA 5H8GA 4BTFA 1SF0A 3KWLA 5JFSA 2K6QA 4TT7A 2GNIA 3QL8A 3N51A 3HP5A 2L32A 3ITZA 3D5WA 2WMXA 4Q5EA 4O22A 4OTIA 2Y4IB 4ZYNA 2M56B 3RWQA 1XH7A 3VTUA 2JUOA 2VD5A 2CJNA 5E9EA 1OFFA 2A0CX 3L9NA 1Q10A 2QHOA 2H96A 4CNHA 3DQVA 2JT4B 1XD3B 3VH4B 4QMNA 4BZOA 2I0VA 3JUHA 2CR5A 2NRYA 1N60A 2O5KA 3FLZA 4W9CA 4E7WA 3PZ7A 2GNJA 4F0FA 4MBLA 4O0SA 4C00A 4D2TA 2MW5A 2XIZA 3GOEA 4GIHA 3NVVA 1ET9A 3R7UA 4ZSLA 2QJLA 5FK9C 3AC2A 1UU7A 4TL0A 4MH0E 3V01A 3ZDUA 1WI0A 3DHHC 2JY6A 4RJ5A 3CJGA 2G01A 2BILB 2Z59B 4TQ0A 3ZNID 3VFKA 4DHJB 3TJPA 1A9UA 2XNEA 1TS5A 2I7QA 3L9MA 1KFYB 4RF0A 1HZ5A 1GOLA 2YM4A 3KAWA 3Q3FA 4HRSA 3CP9A 1HTYA 3DQXA 3BPRA 4LFIA 3UQFA 3TMPB 4U43A 1LUFA 1GZ8A 3QRKA 5HO8A 2WQBA 2JKMA 1PKGA 2GBMA 4FKRA 2YIWA 2HJ8A 3BQRA 1VR2A 5D7GA 3HAMA 2WQYB 3K9PB 2QILA 4FEXA 4GJ3A 4TRLA 4YPDA 2X3WA 4E4MA 5G1XA 3BCEA 3IT6B 2KN5A 1YHVA 1V49A 1UVRA 2UW6A 1K51A 1DOXA 1U46A 1Z57A 3VQHA 3VUHA 4BYIA 2PW9A 4HLEA 3VF9A 2XIRA 4A06A 2JIIA 5CU0A 4GJ2A 4YTMB 2RFSA 4F6WA 4PTCA 3SHQA 3ZRFA 2C3LA 3OUNB 2A27A 4FSMA 3VHEA 1H0VA 3R30A 3S0OA 2JD5A 4M02A 1A70A 3AE8B 3UNJA 4XG7A 3CJFA 3CZSA 3HDMA 2Z02A 5KBQA 4Q5HA 2PVGC 4EE2A 1NW1A 3MESA 5IEYA 2K5PA 4EONA 1HQRD 1ZPSA 1VDVA 3C0RB 3R73A 3C5IA 4O1NA 4LYNA 3DB8A 2JZZA 1BXTA 3TZ9A 3W9CB 3GENA 4K1BA 4YZNA 2WQEA 2BZKB 1L8TA 3ZU7A 5DRBA 1C4PA 4X3JA 4A6QA 5CEMA 5AR5A 4O96A 1GC6A 4ACGA 3KF4A 2L83A 4J52A 1A5RA 4I22A 4AZHA 4JBPA 3OG7A 1Y2OA 4D5KA 3V51A 3NLBA 3HMPA 4C37A 4BR3A 4RX5A 4LQMA 4FEVA 1JRPA 2BUJA 1WGGA 5J1VA 1YIWA 3HAIA 2W1HA 2WXNA 4I20A 2BKRB 3KGAA 1ZAOA 2VO6A 4KIKB 2IVVA 4IAYA 4I4FA 1V8CA 2ZW1A 3U7DA 4RT7A 4DFXE 5LQFA 4XDDA 2J0KA 3PLVA 3VS0A 1WBNA 5CHWA 4EHZA 5C26A 1EO6A 5LVOA 5IQFA 3UIBA 2LJIA 4YT0B 3EJUA 4ICUA 5EM6A 3RNYA 3K2LA 3TDVA 2Z8LA 4APCA 1SVHA 1XH8A 2QCZA 1LM8B 3N32A 3W0RA 4F63A 5EFQA 2PE6B 3E8EA 2G15A 2FA2A 2WELA 1JALA 3QQKA 1NVQA 2BVCA 2UVXA 3RGFA 3D2FA 4O7SA 3EN6A 3EQGA 2RGFA 4AT3A 4FKJA 5C1ZA 3DXNA 1TKYA 3PLUA 2EXCX 3OK8A 2WMWA 3R8BA 5KMLA 5A54A 3RI1A 2DLBA 2ZVNA 3TJCA 3TEZA 2H8HA 5EQYA 3NVWA 2D4CA 1BLXA 5E6OA 4Q9SA 2V0DA 4YLKA 3R7OA 3IS5A 2YIQA 4B95A 3KK9A 2FUG1 1NVSA 3RKBA 4RWKA 1T0SC 2GFSA 4OBQA 1LFDA 2YEPB 3EJRA 2K1FA 1Q62A 4F99A 3PUPA 3MWUA 4LDTD 4EZTA 3TWJA 3IGGA 3RNFC 4TN6A 3FKNA 3ZXTA 4ZAUA 4I0TA 1FO4A 4BIEA 4M13A 2OHFA 1SNUA 3W2DA 3VBVA 3DVGY 1OB3A 1XQZA 4HVDA 2HXQA 1GZOA 4D55A 1XH9A 1HTQA 3Q3MC 4CQEA 3P5JC 1PUTA 3ZM9A 4PDYA 4DTKA 4HOKA 4MK0A 3OXZA 2ZYBA 4K1RB 3TT0A 5HORA 4L53A 4AGWA 2O64A 3SYVA 5TR5A 1WBPA 5EDQA 5KZIA 2OW6A 3QXPA 3VF8A 5HG9A 3OEZA 3U7ZA 4HYSA 1WRDB 2KTRB 3FKYA 3QCXA 1OPJA 4MGYE 1XKKA 4CLJA 2PPQA 2FYSA 4ZJVA 1LPUA 3WYXA 3BGQA 2P2HA 3NAXA 4WH4A 2VGPA 4AAAA 2GI9A 1KRHA 5KHOA 1GIJA 1OKWA 1VZOA 1V81A 3Q4ZA 2LRWA 2BYEA 3ZFYA 3ZDIA 3CC6A 2W3RA 2BDFA 1UNLA 4FKVA 1V1PB 4GLSC 5L6PA 2C6KA 4JS8A 1Q8WA 2XK5A 3KEXA 3Q0KA 2JPHA 4RWIA 4CFFA 3E5AA 1XH6A 2KXJA 3AEDB 2WFYA 4BGHA 5I4DA 2BRMA 2OF2A 2YZLA 2XIXA 5LXMA 4EQUA 1WX9A 4K7SA 1FVTA 5TF9A 4BWPA 2Q83A 4AZIA 2YIBA 1WFCA 4AT5A 2UYZB 2FIDA 2VX0A 4GK2A 2QOIA 1WH3A 2PTKA 2OO2A 4JMQA 4WUNA 4GG5A 3TZMA 4NJ6A 5AIKA 4C7ZA 3HEGA 1C76A 2WMSA 4IZ5A 3S2PA 3R9OA 5HNGA 3RCDA 2IZTA 3C9WA 5FBOA 4YJRA 3U2SC 5CEKA 2OFUA 4IM0A 1YJ1A 3BYVA 5JKGA 3RHXA 5C4LA 4FIIA 1D3ZA 3QYWA 3M62B 4K0YA 2DQ7X 2G1EA 3PXZA 4KABA 4AP4C 3AXWA 2YCQA 4C62A 3B51X 3R9DA 4L43A 2V3SA 2VZKD 2GTMA 2B52A 3PWDA 4AE6A 3FI8A 3ZRMA 3HIZA 4WT6A 2ITPA 3DKGA 4UMRA 3ZONA 2KDMA 3R0TA 3EQPA 4L8MA 4AZFA 1IBXA 3VH3B 2F4JA 3R83A 2OU7A 4MGZE 3X23A 5DE2A 4A07A 2KFJA 2DZIA 1OQY