4IM3A

Structure of tank-binding kinase 1
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
659
structure length
605
Chain Sequence
b'GSMQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNRPVDVQMREFEVLKKLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGMNHLRENGIVHRNIKPGNIMRVIGEDGQSVYKLTDFGATVDLWSIGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITGKPSGAISGVQKAENGPIDWSGDMPVSCSLSRGLQVLLTPVLANILEADQEKCWGFDQFFAETSDILHRMVIHVFSLQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQELIYEGRRLVLEPGRLAQHFPKTTEENPIFVVSREPLNTIGLIYEKISLPKVHPRYDLDGDASMAKAITGVVCYACRIASTLLLYQELMRKGIRWLIELIKDDYNETVHKKTEVVITLDFCIRNIEKTVKVAAELGEISDIHTKLLRLSSSQGTIETSLQDIDSRLSPGGSLADAWAHQEGTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLAYNEEQIHKFDKQKLYYHATKAMTHFTDECVKKYEAFLNKSEEWIRKMLHLRKQLLSLTNQCFDIEEEVSKYQEYTNELQET'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase TBK1
publication title Structure of Tank-Binding Kinase 1
rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 194
structure length 605
sequence length 659
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-01-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF18394 TBK1_CCD1 TANK-binding kinase 1 coiled-coil domain 1
A PF18396 TBK1_ULD TANK binding kinase 1 ubiquitin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4im3A02
1.20.1270.420 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4im3A04
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4im3A03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4im3A01
5LVPA 2JIVA 1WZ0A 4LL0A 2SRCA 4J1RA 4ANLA 2O5KA 2QNJA 3RPVA 3U30A 4BCHA 3DBEA 3A62A 4DN5A 2W4JA 3DTWA 3Q3FA 3ZLXA 3DBDA 3E8DA 4DH7A 3C9WA 3Q96A 1J1BA 2GNFA 2V4LA 3LFFA 2UZTA 1UGMA 2LUEA 3NUYA 1F5QA 3BQRA 3TJDA 4CZYB 5ANIA 4RX8A 2UV2A 3BHVA 5I9XA 3QQHA 5J2RA 5HHWA 1WXVA 3ZO2A 4I6PA 3PSBA 3ZRCA 4Z7HA 4D5KA 1VYZA 4RVMA 3LCDA 2R3KA 4IANA 2MWSB 2X7GA 5JQ5A 3ITZA 2A1AB 2XBBC 5LCJA 4EYJA 2O6VA 3ZFMA 5EDPA 3R66C 4R3PA 5AA8A 2VV9A 2R3PA 1OTRB 2GBJA 3Q52A 3RT3B 2XNGA 4IVCA 1LXDA 3FWQA 4NFNA 4BF2A 4HPTE 3KN5A 4O0XA 4U8ZA 2RFSA 4XMOA 2CKEA 4H1JA 2C3KA 2BPMA 3EFKA 4KKGA 3JY9A 4IZYA 2BHEA 3MVHA 4D4YA 4I21A 4WRSA 4M0ZA 4P7IA 4EBVA 4MHAA 3VJNA 4B0GA 5KHXA 4YHJA 2L8JA 4AT4A 5AX3A 3ZDIA 2C5LC 3D4QA 3TTIA 2LASA 4I93A 4F0IA 4ZXTA 4A9RA 1R78A 3OWLA 1LEWA 4FSWA 4GFGA 2WELA 3ALNA 5HLNA 4JIOU 3T9LA 5ITAA 4FTRA 2KDEB 1XHAA 3GU5A 1CSNA 2DZIA 3DVNU 3UNZA 3RCZA 3GENA 3VXWA 4FX3A 2MX2A 4I6LB 4E8AA 2PJHA 2CLQA 5L2WA 2OFVA 3KRXA 4H39A 4IAKA 2X1NA 3NPCA 4UWBA 3PPJA 3QC9A 3DBQA 4MSMB 4GG7A 3F69A 2BPSA 4NSTA 1OUKA 3HV6A 4XV9A 5D6JB 3ORZA 3FI8A 3OLMD 1AARA 4FV1A 1H4LA 4D2WA 4WG5A 2XIYA 4EK4A 4I5MA 4FBJB 3ACKA 3FXZA 5DIAA 1Y6BA 2IZRA 3QD3A 5H9BA 1A9UA 3E63A 2GNLA 3LCOA 3V5JA 5HE2A 3T8MA 2H8HA 3EQDA 3BI6A 3M42A 3OJ4B 4Q5HA 4GMYA 3JSVB 3ODZX 3CQWA 3OVVA 2KWUB 2D10A 4R5YA 4XZ4A 3ZSGA 2R9SA 1GG3A 4CO7A 4RJ4A 3UGCA 3QXOA 2KD0A 2IO6A 4ZYNA 2FUHB 1T46A 1YOJA 5HG8A 3ZC6A 4ASXA 2FSOX 2GNIA 4JIAA 4PPBA 2BVAA 3R1NA 4I5CA 2IO3B 3QRJA 5HCXA 3TNIA 2JGZA 3C0IA 1OQYA 5ANKA 3I81A 2R3LA 2EWAA 1D3ZA 2ITUA 5EFQA 4GK3A 2WQMA 3WZKA 3Q53A 5DE2A 3MY5A 1WI0A 5JH5C 3RPYA 1UU9A 3OW4A 3R21A 5G1XA 4E7WA 3PVUA 3MS9A 2YACA 3NCZA 1Y91A 4BGQA 5J1WA 4RWIA 3PJCA 3KA0A 4M69A 2IO1B 3QD4A 3WZDA 4O82A 4XG6A 3APDA 5E91A 2BRMA 2O64A 1WH3A 4EKKA 3QCYA 3PWDA 4IW0A 4FKSA 4BDCA 3GNIB 1UKIA 1ZMWA 1ZYSA 2R3HA 4TY1A 1DAYA 4QMXA 2IVSA 2WFYA 3EYGA 4O7NA 4BI0A 4R5SA 3V51A 3MN3A 1VR2A 4WA9A 4ZLOA 4CTCA 3QQ8B 5KMNA 2AYPA 4H3PA 3V3VA 2FAZA 4FG7A 4FC0A 1JSTA 4QMSA 2EVAA 3Q32A 3U8ZA 3KF7A 3UZTA 2C3IB 4RC4A 4NU1A 1M7NA 2ZDTA 1Q61A 4UXQA 4XUFA 4DYMA 5I9WA 4C3PA 3Q5IA 1PMVA 4DEGA 3HAVA 3R71A 4YC3A 2VO6A 2GBMA 4BCGA 2Z7LA 1I09A 3QFVA 3AT2A 4R77A 3HA8A 4FYNA 2V62A 3TDVA 4IDTA 4ZSJA 2PE9A 2PWLA 2XP2A 3MPTA 4YTIA 2Y7JA 3F7WA 2C5VA 4MXCA 2W17A 4QQCA 4O0YA 4NJ7A 1J19A 3CTJA 3ZC5A 2CDZA 3IHPC 4F0GA 4CZTA 4WWOA 1H26A 4EQUA 4C0TA 2RR9A 3SGCA 5B2MA 3UQGA 5KHWA 2BYEA 2LXCA 3PJ2A 3VVHA 3RM6A 3QKLA 1V1KA 3SHQA 3O71A 2F9GA 4HOKA 3DLSA 4IH8A 4L01A 1V0OA 1E9HA 2C6DA 3KXHA 4CRSA 1RQQA 4EH3A 4D2VA 4FTAA 1R4MI 3OD6X 4PYZA 3ZTCA 2W1HA 2GHGA 1S9IA 4ACHA 4KSQA 3I79A 2PY3A 2UYZB 4RT7A 5M55A 4PPAA 4A3PA 4QYGA 3EL8A 4X0MA 5IA0A 3UDBA 4RBLA 2BR1A 2OIDA 1XD3B 3GBZA 3LFBA 5FP5A 5K9IA 4YPDA 5DLSA 3TUDA 5AP5A 2WOUA 4RQVA 2KK8A 2YDJA 2WO6A 4O0UA 3QTRA 4YR8A 4YTHA 1R3CA 2G1TA 4KVGB 4MVFA 2NBVB 2ZV8A 4B4LA 4V0GA 2EXMA 3IQ7A 5E8WA 3T3VA 3U6IA 3PHWB 2WTDA 3SX9A 4R8QA 3EN6A 2JF5A 3CMMB 4ZSLA 4B95A 4I5PA 1YHVA 3NAXA 1WR6E 4ZTRA 3UJGA 4BB4A 4EOQA 1PRYA 4JG7A 3BGZA 2XIRA 3GEQA 5CVHA 3O65B 1WYWB 4XG7A 4ACDA 4RVLA 5EI2A 4DXAB 2N7EA 4W9IA 1JVPP 1M52A 3KQ7A 3DQWA 4NW6A 3D5UA 1PMEA 3OOGA 4RVKA 3NNWA 4DBXA 2WX1A 3LDZE 3AGLA 2PE1A 2QQ7A 4AOIA 3W8QA 4K7UA 4PMTA 5GJGA 4L7FA 4IWQA 4F6WA 4ZJVA 3NS8A 4I1ZA 3PLUA 3GCPA 4V04A 4FSRA 1XKKA 2O6VB 2AWTA 4TPTA 3EQCA 3ZEPA 5J9ZA 4EK3A 1VJYA 2EMSA 1RFAA 2ZJWA 3R7OA 4JX7A 2X6EA 3F61A 3NNUA 5HCYA 3PV1A 4DFBA 1HOWA 4PV0A 3E93A 3O8PA 3PS6A 3DV3A 4FA2A 3SV0A 3Q60A 3U87A 1E8YA 4C4GA 3Q6UA 2UUEA 4RFYA 3KW5B 1PXNA 3VC4A 4WD5A 1FVTA 3MFUA 4QP4A 5IA5A 2XB7A 4KAOA 5HX6A 3ZXTA 1YI6A 5D7AA 2R7IA 4S2ZA 3P08A 3T3UA 3ZOSA 4J96A 5CS6A 4F9YA 3AXCA 3ZUTA 3EQRA 4MAOA 5CTRC 5AUTA 2ZPYA 3F2AA 3FMKA 4NCTA 3W2CA 4GG5A 2NP8A 3HRBA 4KWPA 1V5OA 3L1SA 4KKHA 2O0UA 3VAWA 1V49A 4G9RA 4QP7A 4BCKA 4AZEA 3QTXA 2YEXA 5HO8A 3ALBA 2UW8A 5J8IA 3COHA 4K0YA 1Q0WB 1KOTA 4UMUA 5BUIA 2O8YA 3EL7A 5HD7A 1PY5A 5TKDA 3R00A 3S00A 3F2RA 3BE2A 4O27B 5LXMA 1EH4A 4ANXA 4CXAA 3DCVA 2BMCA 1BMKA 2O2VA 2JDOA 2RKUA 3VW8A 2I0VA 3VDZA 4E71A 2X8EA 3SG9A 4G11A 5AR7A 2KMCA 1V2YA 3VBTA 2OJFE 2N9EB 3N30A 3U9NA 3IFWB 1YX5B 3KGAA 5DPVA 3R8ZA 4FR4A 3G0EA 3VTUA 4JNWA 4EZ3A 3U4UA 3I3TB 3RNYA 2PHKA 4O6EA 4BKSD 3KB7A 2C4GA 2L00B 4L46A 3AGMA 3RJCA 5I0BA 1Q8ZA 4EOKA 3RK7A 4AUAA 2NNWB 5BUEA 4NNJB 3OOMA 1PF8A 4AOJA 4YBJA 5CASA 4BCQA 4FULA 3AC3A 4JQ7A 3NLBA 1XBCA 4C34A 5JT2A 3MJ2A 3QTUA 5HO6A 4FTNA 3SXFA 5HGIA 4FICA 1QPEA 4HGEA 2KDFB 4CEGA 2RFEA 2O65A 3CLYA 4YU2A 3UVQA 2QOKA 2MBEA 1E8ZA 4HVIA 5AR8A 3TKUA 2IWIA 1R0PA 2VWYA 2R3OA 4QPSA 2KDIA 2HXQA 2ACXA 4J52A 3QIJA 2OSCA 2Z0EB 4FGBA 5DT4A 1UH6A 1Q4LA 5CZIA 2GTNA 2KANA 2P55A 5M09A 3R9HA 2MP2A 4W9HA 3FMHA 3EZRA 4ZLZA 5AUVA 2FNJB 3E8EA 3IBEA 3ODYX 4N0SA 4U3ZA 4R78A 4XV3A 5LWMA 1YD8U 4YUQA 2BCJA 4AN3A 5LMAA 4MGIE 3UIXA 4OGRA 3GOPA 2UZVA 3ORMA 4FV7A 3CGFA 3ZLZA 3PG1A 5ACKA 4DCAA 2VNWA 1XBBA 4OT5A 3TM0A 2DYLA 4GYGA 2C6OA 3FLZA 4NFMA 2XNMA 4CYEA 1PXIA 4ORKA 4TYHB 5HZNA 4OUCA 4BC6A 3NEWA 2C7NB 1OL1A 3O50A 3VBWA 3IGGA 5EYKA 2CPKE 3UQFA 3IDPA 4BWXA 3NZSA 4ICUA 1J7LA 4EOYA 1B6CB 1DI8A 3K3IA 4Y72A 3JVZX 2ZVAA 4CZUA 2J0MB 5HICA 4IWPA 5AFVA 5J7BA 3H0YA 2ITTA 3ZNGC 4KZCA 4CSVA 2WTWA 2R4BA 2JKOA 3QLGA 5ANGA 3HL7A 4FHJA 2QO2A 3WAOA 4KSLC 4M68A 3Q4CA 3OFMA 5B7VA 2X2LA 4KV2A 4ZRKA 3QKKA 4KKEA 4ZMFA 3ZS5A 4E4LA 2KTRA 5IQHA 4JR3A 3N32A 3H1UA 4MD8E 3CQEA 3R7QA 3O8UA 3CSFA 2C60A 5L3AA 3ATSA 2ZB0A 5AUZA 3NAYA 3ZXZA 1U54A 2ETMA 4J95A 1H8CA 3DS6A 4MKCA 1O9UA 2QI8A 2PE2A 4ASEA 4WQOB 5FTGA 2KULA 3A8WA 5I3OA 5FXQA 1QPCA 4BDBA 4BTKA 4HWIB 3LQ5A 3BU5A 1Q8UA 2JUOA 5H3QA 1WM3A 1ZGUB 4EH4A 1REJA 2N4FA 1KE5A 1YOMA 2J90A 1FOTA 4FTJA 4Z55A 2XRWA 3PVBA 3VTWA 1E90A 3R83A 2LRWA 3M95A 2GMIC 3W32A 4CCBA 3QZGA 3EN7A 4LGGA 5CALA 4YO4A 3GU4A 4JX3A 4W8DA 4GOCA 4I6BA 5A14A 2W5AA 2H6DA 3A7HA 4O6LA 2V7OA 2HWOA 3EZVA 2Z59B 4FADA 1T45A 4IADA 3I7CA 4PS7A 3EWHA 2WGJA 5KHQA 3ONSA 2J7TA 1U59A 3KVWA 4EZ5A 3TT0A 3F3WA 4D4RA 4IM2A 3NCGA 5E1EA 5EKOA 4FTQA 4BDEA 4NJDA 4IFCA 3SOCA 5GZAA 4QTDA 3N4TA 2PVNA 4BFMA 3UQCA 4G3XB 2MBOA 4H36A 5L95C 2HD5B 2XJ1A 2X2MA 2VX1A 4OTPA 1IPGA 2YM3A 3QCQA 1M2RA 2OJRA 2GPHA 3U6JA 4ID7A 4LRJA 5E8VA 4CVAA 3QHWA 4FKQA 1Q8WA 3PLVA 4M3QA 3Q5ZA 4QP8A 1WBOA 3M1SA 2C0TA 3TZMA 4AT3A 3JY0A 4E4XA 4Q9SA 4OAUC 3HRCA 2YWVA 4D2RA 1WJ4A 2RSVA 1UU3A 2KOXA 5CXHA 4XX9A 3CXWA 2WB8A 3MVLA 5HNGA 1YI4A 3V5QA 4BCNA 3OEZA 3KF4A 3AMBA 4W8EA 2VX0A 1V0PA 3DU8A 4WNMA 4XG9A 2ZM3A 2R2PA 5DFPA 5IAAC 3PPAA 2F4JA 2C6MA 1TQMA 2QHNA 4X3FA 5E8SA 3C7QA 2W1CA 4YZDA 3BYOA 2P2HA 4GT4A 4QMZA 5FDPA 2O2UA 5EHYA 4YJVA 1YWNA 4KABA 5IMXA 5AAEA 4P2KA 4DA5A 4OLIA 4MWIA 4EH8A 2O2VB 3ID6C 3DLZA 4BTFA 3KK8A 1UA2A 4NIFA 4CD0A 2CJMA 1U4AA 2WMUA 3DK3A 4S32A 3KVXA 1MRUA 4R7IA 3FC2A 2OF4A 4YZBA 2RSUA 2JC6A 4L3PA 3ZFXA 3QZIA 3O8TA 4OTDA 3VUKA 4QQ5A 4WT6A 4ZIMA 4OTWA 2QR7A 5HG9A 4R1YA 3NYXA 4R7HA 3P7BA 3ECIA 4M7IA 4MGKE 2XK4A 1FINA 4GCJA 4EL9A 5I9YA 5CX9A 4XP2A 4RMAA 3FSFA 2DWBA 1Q3DA 1HE8A 5IUGA 3VUIA 2A4ZA 4CG8A 3BEAA 2C1BA 4A4LA 4AXAA 5IQIA 3MVJA 4GU9A 4D0XA 4GFMA 3O7LB 3B2WA 3N3KB 3F5PA 1J91A 4X7QA 2QO9A 4GXBA 5ICPA 5HO7A 2EKEC 4W9CA 2KWVB 1OPJA 4FV0A 4U43A 4E3CA 5GZ8A 2YN8A 3F88A 4ZZOA 2XBAA 4HGLA 4EONA 3MFSA 4G31A 4EJ7A 3WE4A 1IR3A 4D0WA 4YURA 3HZTA 5C01A 3EH9A 3AU5A 5J5TA 3G6GA 3BU3A 4JQWC 1IAJA 4XV2A 4YJRA 4LOQA 5C03A 3EMGA 4C36A 5BVDA 2G4DB 3ZDTA 2H9VA 1YQBA 2V7AA 4ZY4A 1OI9A 2J7QB 5M4CA 4FODA 4BCMA 4DFNA 1JKSA 5FM2A 2UZNA 2ITVA 3R7UA 5AEPA 3O7LD 3AC4A 5E8XA 5A54A 2QCSA 1Q5WB 4IB1A 3FI3A 1WXMA 4FHKA 4CTBA 5AP0A 5DPSA 4HPUE 4YJQA 3CPBA 4WOVA 3LFEA 2IO0B 3A9JB 3P7CA 4GV1A 2R2QA 4QPAA 3OTUA 4DFLA 2IVTA 4QQJA 4MD9E 4ALVA 5GHVA 3PGEA 5AJQA 3MPMA 1NA7A 1XT9B 4EORA 4XEYA 4FEXA 3HHMA 1KE9A 3CTQA 3APCA 4FL1A 2YIRA 4BKYA 2HY81 3ZDUA 3LJ2A 3PREA 4DDID 2LZ6A 2JXXA 4JVGA 3BRBA 4LG4A 4MNEB 4MF0A 3AD4A 2QOBA 4LRKA 3V8WA 5HD4A 4X2KA 1OBGA 4O7RA 1WR1A 1A48A 3VQIA 2VWZA 4D1ZA 3R04A 5H8EA 2QKWB 4NAWA 2DHZA 5CF5A 2HY0A 4AW1A 2IO2B 2K8BA 5K3YA 4HCVA 3LXLA 3HLLA 5AM7A 3L8SA 4D4SA 4G17A 3NOBA 1WMHB 4CLJA 3QARA 4EOOA 3DBCA 4QMPA 4DCEA 2UZOA 4Q2AA 5AEKB 2FA2A 4GYIA 3RHXA 2ZV9A 1QZEA 4RRVA 3A7FA 3GCQA 3L9PA 1S1QB 2JPHA 2XRUA 5IH5A 3DQXA 3EQIA 1GAGA 3AXWA 3G0FA 5ACBC 5BVKA 3TI1A 3E92A 2VRXA 5DI1A 3TL5A 3Q6WA 3KUZA 3I7BA 3H4JA 1XR1A 1XQQA 3NUXA 3PRMB 4I6QA 1E7VA 4PDPA 3DPKA 4QYEA 1YQJA 4WO5A 1OGWA 4BFRA 2BF8B 5HTCA 2VTTA 4AAAA 4O7TA 4ANMA 3MFTA 3KXGA 3OAWA 3C5IA 5TO8A 1GZOA 3KYCD 1IG1A 4DBGA 3WAMA 3PSEB 3W2OA 3PLAE 2EXCX 4ZAUA 4J98A 4LUDA 4WJPA 4F99A 3LFQA 1UBIA 2OICA 3V61A 2HELA 4KDLB 4BBNF 2HZIA 3R1YA 4N70A 3DKGA 3LFDA 5KMOA 4KA3A 4L53A 2LGXA 5BVNA 1SZMA 3QLFA 3R9DA 3PRZA 2PE0A 4WUNA 2YZAA 5LVLA 4PUZA 3F3TA 3CIKA 2L7RA 3KRWA 4DH8A 5BUJA 4QYHA 5IA1A 3F3VA 3ZH8A 5HEZA 2E2BA 2XKFA 2CCIA 3GC9A 2MA9B 3EFUA 4EZLA 4W9KA 4QNAA 1F0QA 2BZKB 2F7EE 3KULA 4S30A 3L9NA 3H6NA 3FLQA 5TE0A 2WMSA 4EK8A 3TXOA 2CN8A 5IQGA 3I5NA 3UOKA 3D2IA 4FV8A 3W2QA 1YVJA 5HG5A 2ETRA 4H58A 5IEYA 4FKRA 2IZTA 1UNHA 5A4TA 2VWBA 3UOHA 4W9LA 5DCNA 5L2SA 1Q99A 1KWPA 3ZMMA 4ZY5A 4FTIA 3FI4A 4C38A 3K9OB 5E8YA 4DEHA 3UO5A 3R63A 3TUCA 2OF2A 4JI9A 4Y73A 3H0ZA 1YX6B 1BLXA 1XH6A 3JXWA 5HG7A 4CFFA 2XK7A 2EB2A 1G3NA 2GQSA 1BL6A 3FJQE 3IW8A 5D12A 2CKPA 2C0OA 3DAJA 4GVJA 3VUHA 3LPBA 3PXKA 2YVCA 2OJJA 4TL0A 4N9F4 4G6NA 2XM8A 3BU6A 2WOTA 5DHJA 4RJ3A 4S33A 1Z9XA 5IH4A 3PG3A 4USDA 4R7BA 1Y8RC 3PYYA 5HE1A 2Y8OA 3BHYA 2JDRA 4LV8A 1VD2A 3FL5A 4YHFA 2EU9A 2QR8A 3SU8X 4APCA 2W1GA 2H96A 4RM8A 4NIFB 4DDGD 3F5XA 4JRNA 1MG8A 3B8QA 1SYKA 3QQFA 3AMYA 1DAWA 2BWES 4DLJA 3MY1A 5TT7A 1YXVA 3RMFA 3ZO1A 5TR5A 4YLLA 3WF9A 2B9IA 4FV4A 4RGJA 4HYHA 4B6LA 3BPRA 2ZCBA 4JBQA 4IC7B 3U6HA 4BIBA 2WMQA 3R6XA 3GC7A 4RFMA 4RIYB 3CF6E 4EOPA 3FY2A 4GT5A 2JAVA 3TJCA 1HCLA 3U8WA 2GNJA 4PDYA 4FKVA 2BHHA 3QRKA 3ORKA 2UZDA 3BE9A 4XOZA 3W1SC 4IFGA 5HOAA 4I6NB 4DT8A 2B53A 4NKAA 4DWFA 4FKGA 4X2JA 2RL5A 1W83A 1WZYA 4WIHA 4X21A 3PIYA 4D1SA 2BDFA 3ENHA 1ERKA 2IZUA 5J9LA 1RDQE 2G3QB 3KEXA 1B39A 5LMKC 2QLUA 2KKCA 2C3JA 2Y4IB 2KLCA 3UVPA 5H8GA 4DHFA 2WNTA 3JS2A 3FLNC 3D0EA 2ZMCA 3F3UA 2C7MB 2K39A 4BDGA 3VQHA 5A4QA 1MRVA 3Q2MA 1V80A 2YHVA 5IA4A 5EI8A 4AW2A 2LGDA 5KE0A 5ANOA 2C5OA 4DG3E 4WJOA 1KUTA 4O38A 4JT3A 4ZEGA 1BI8A 5L83A 4BCOA 4TWPA 3PRFA 3ZZEA 4L9IA 2UW9A 5FP6A 5K4IA 4LGDA 2X8DA 3VUDA 4FZFB 4DTKA 5E8TA 2XZSA 1J3HA 5CI7A 2D2QA 3SC1A 5A6NA 3UIUA 5TOZA 4BYJA 4UXLA 5H8BA 5J7HA 2R0IA 3PY3A 3EQPA 4I22A 4KINA 3VS4A 3TDWA 4CHKA 5LVNA 4NM7A 5IQEA 4OBQA 4NTSA 3QQUA 1E8XA 4G3DA 4FT9A 2OIQA 2ZYBA 3FBVA 2JDVA 3HMNA 4FOCA 3TACA 2DAJA 3EKNA 5F20A 4PTCA 4J71A 4FGRA 2ZOQA 4GFOA 4E93A 4Y46A 5IEVA 5E92A 5L6PA 4HLEA 5FDXA 2OIBA 4A7CA 1J8CA 3AQVA 5CHFA 2YDKA 4FVPA 2YZLA 2JFLA 3VH3B 1WVYA 2DX5B 3BYVA 4UYNA 4I4EA 5ANEA 3NUSA 3FV8A 1P98A 4OAVB 1WGYA 3KYDD 2FGIA 2NPTA 5AR2A 3OMVA 4KUJA 4FSTA 5E8UA 2NO3A 3WZJA 3UC4A 1V6EA 3FMLA 4NM3A 2J0JA 4TWCA 2X4ZA 3K5VA 2NCNA 5IUHA 2R3FA 3U51A 2N1VA 2MCNB 4BRXA 2GFSA 2YCSA 5A4EA 3N51A 2V22A 1P4FA 4TYEA 2KFJA 1R39A 2J4ZA 3A9KB 3OEFX 1GNGA 1APME 3W8LA 1YHWA 5AA9A 3E64A 4GIVA 3D2KA 4FNWA 3TZ9A 4JQEA 3FDNA 3OTVA 4JDIA 4YLKA 4WSQA 3TNPC 4XYFA 3UIPB 2A5UA 5JN2A 3G15A 3QYWA 4Z3VA 4TYIA 5BQ0A 2A27A 4QTCA 3BEGA 4GGQA 3R8VA 3AC2A 3ERKA 4WBOA 4AQCA 4O0TA 1IASA 5JQ8A 4I41A 2FH9A 3DB6A 3QQKA 3AD6A 2WMVA 4OVVA 4YTFA 4K18A 2XIZA 5FLFA 2REXA 2FIFA 3Q4UA 4K77A 4M66A 2XIXA 4XP0A 3NW5A 2WDTB 5AP3A 3MTNB 1RJBA 3V6RA 2ASQA 3NYVA 4E74A 4LMUA 2KC1A 1UU8A 4BR3A 2XA4A 3DXNA 2ESMA 3ZTXA 5EK7A 2LAVA 1SNUA 5M57A 3H7PA 4MELA 2DZJA 1WBNA 2IBIB 2E9VA 4ZTMA 1TZ1A 2UZWE 1H08A 3VS3A 4ALWA 5B2LA 4NY0A 5D7VA 4HJKA 4Y83A 4HDOA 2JY6A 2JRIB 4QP9A 2A4LA 4O0WA 2C6KA 4IMYA 1BKXA 3IW4A 4HW7A 2XNOA 3E5AA 3GCVA 4C2VA 2Z8CA 3PIXA 5GZ9A 3CQUA 4EZJA 3MPAA 3BHHA 2XK3A 1IA9A 5EOBA 4BIEA 5IQFA 1KE8A 1P14A 1GC6A 2WMWA 3K5UA 5IMEA 3LKMA 4KSPA 4MNFA 2G01A 2A19B 3II5A 4AT5A 1Q8TA 5JK3A 3DCGA 4WKQA 3LW0A 4BVUC 3QA8A 1OL7A 5CEPA 4OVUA 1FPUA 2HJ8A 3G51A 2IW8A 4L7SA 3BY4B 5HX8A 2VTMA 3TNHA 2C68A 2PVRA 4EUUA 4AP7A 2Z2WA 3VRZA 4OTHA 5AV2A 4RWKA 1MQ4A 5HU9A 1P9DU 1TQIA 4LOPA 3RBWA 3VAPA 4BGHA 2KX3A 4L52A 1YWRA 4U81A 1OUYA 3TN8A 4YBKA 5KZIA 4QP2A 4RM9A 4RIWB 4DLIA 4ZOGA 1ZZ2A 3CD3A 3OROA 2AL3A 5J1VA 4AGWA 5IG1A 4FKOA 4ZTQA 4O7ZA 2QU6A 3WA0A 3L08A 4GK4A 2F7ZE 4HVDA 1JNKA 4FIJA 1AGWA 2KFKA 2R2OA 4H1MA 4CQGA 3WOWA 4BBEA 4S34A 2Y9QA 2RG6A 1V81A 1RW8A 3OUNB 1KV1A 3VS7A 4IAZA 1UWJA 3NGAA 3S2AA 3UG2A 4FEWA 2MBQA 1OL6A 2HOGA 4YL8A 3ZW3A 5F4NA 3PP1A 4NJ3A 5HIDA 1WX7A 3MESA 1NY3A 5IH6A 3UPXA 5TR6A 3PE1A 3TKIA 4M84A 2AL6A 1JLUE 2C30A 4RJ5A 3HA6A 2FSMX 4O21A 4PPCA 4FYOA 3OBJA 3GOKA 2B4SB 3FXWA 3DJ7A 4IZ5A 1SNXA 5EYMA 2I7QA 2YABA 3B1LX 3FZSA 5FEQA 5EW9A 2IG7A 2VGPA 3PIZA 1XH4A 4IZAA 2YAAA 4IHPA 3BHTA 5EM6A 4AW0A 2ITPA 4BOSC 5AR4A 3VS6A 5JFXA 1M2PA 4FZ7A 3UVRA 2E9PA 4FOBA 4UMPA 4I4FA 1WVWA 4YNOA 4XG4A 2BKZA 3R22A 5CSHA 3I0QA 3PXZA 2QOIA 3PJ3A 2I0YA 2CS4A 2JIUA 3NR9A 4PMSA 5EYDA 4QMYA 3M63B 4C62A 3JYUA 2KJHB 4BKGA 3D7TB 2R3JA 1FGKA 2WQEA 3C13A 5BYZA 2PVMA 3BV2A 4MH0E 2BAKA 3H9RA 2WMXA 5A4CA 5I9ZA 1E1VA 3EFJA 1H07A 1WVXA 2QKRA 2YISA 3DOWA 1IRKA 2DUVA 1WAKA 4II2B 3O0GA 3L8PA 4ANQA 4K1RB 4C7TA 1W98A 2PYWA 3EN9A 5B2KA 4W9DA 4CRLA 3P2BA 3NSZA 4BCJA 3GVUA 4YSMA 5HCZA 1UELA 1Z57A 3L54A 3QCAA 1PKGA 2XNEA 4XH6A 5FBNC 4MJSB 5ANDA 3NX8A 4YO6A 1JPAA 4EUTA 3OXIA 4E6DA 2BZHB 4FL2A 2BRGA 2NRUA 3JVRA 3VW6A 5CF8A 5L8JA 2JVCA 3H9FA 2K25A 3A1QA 3PJ8A 2F2CB 3HUBA 4U7ZA 3K54A 3CSTA 1ZMUA 2JFMA 3CGOA 5HNBA 2VX3A 3SRVA 5E7RA 5KMJA 3OF0A 4FK6A 3TKHA 4ERWA 2XVDA 4BDJA 3CP9A 4PP7A 4ACCA 3R9RA 2QOHA 3QUEA 5EM8A 4AWIA 1WF9A 5HESA 4JBPA 5AAGA 2HZ4A 2KJ6A 3VHTC 2UW6A 4A07A 1CTPE 4MXYA 1YWVA 4BICA 1STCE 3FAAA 3RZFA 2BILB 4QP6A 5HNIX 3IGOA 4O1OA 5IQDA 4RWJA 1WX8A 3FMNA 2ITWA 2C6IA 3KKVA 4HCTA 3A2CA 3E8NA 2B52A 3BKBA 5CHWA 2REIA 1UWHA 4FVRA 2B9JA 2OH4A 2B7AA 3HV7A 4NH1A 3FKNA 1GOLA 4BI1A 2UW7A 2QD9A 2HAKA 4MF1A 2CN5A 4GU2A 3E7OA 4NPNA 4DH1A 4XRLA 4BY9E 2OWBA 3UODA 1I42A 2VTSA 3E3BX 3U55A 4C3FA 4X2FA 2L3ZA 3KREA 3RI1A 4DGOA 3R73A 4QD6A 5AP4A 1YKRA 1YIWA 4J99A 4YJPA 3S3IA 5CAVA 3GU8A 4BCFA 5KBQA 4BTMA 3HIZA 1GNUA 1NBFC 4ASZA 2LVOA 5KMMA 4AS0A 4GMVA 2HXLA 4EWQA 3ZBXA 1JKKA 5AAFA 1PYXA 4JL9A 2FIDA 5CNOA 2G2IA 3MY0A 4EH9A 2JKQA 2KHWB 2OZAB 3VS5A 3R9NA 5EYCA 4X6QC 1Y57A 3ORPA 3UQBA 3B8RA 2UW3A 5CI6A 2KMAA 5C27A 4OBOA 3JW0X 4K81A 2XK8A 2B9FA 3UG1A 3A61A 3OXTA 3RALA 4NEUA 5JGAA 5DBXA 5ETIA 2X7OA 5FUTA 2ITZA 2N1WA 2W1EA 5AUWA 4AA5A 2ERKA 4O22A 2QODA 3W2RA 4IIRA 4BKJA 3BLHA 4FLHA 4D5HA 1OEYA 3R02A 2M8SA 1LP4A 1ZY4A 3AC1A 4QTEA 3L9MA 3ULZA 4EQMA 4R3CA 3HAMA 5AUXA 3ZO4A 2PPHA 4XC2A 2QC6A 3CKXA 4Q9ZA 4XCUA 4L68A 3QQGA 2UZEA 3LOKA 1G8AA 4K33A 4ANBA 2XEWA 1H25A 2EMTA 4UV0A 5ETCA 1Q5KA 3QJZA 4C35A 4TRLA 5IQCA 2UW4A 2KTFA 4FEVA 4MX9A 1P4OA 2XK5A 3NYNA 2Y4IC 4ZMEA 2PTKA 3QBNA 5LARA 4E4MA 2KNBA 2MBBB 3OCBA 3FZPA 4FV2A 3CBLA 4CCUA 1Z5SB 1UV5A 2IVUA 4HCUA 1Q8YA 4PDOA 2RPQA 5CEMA 1YXXA 5IA2A 2KQSA 2ZM4A 3WALA 3MW1A 1OMWA 2MW5A 5HVYA 3HMPA 4EOJA 3H10A 1YJ1A 2QOLA 5IISA 2A2AA 4WG4A 2BTSA 4U5JA 3A7JA 5FEDA 3UP7A 5BVWA 4Z9LA 3T9IA 4UWCA 4GKHA 1ZLTA 2NVUI 4HPMB 5C8MA 1G6JA 4GDKB 4KSKC 5FRIA 4W4XA 4D1XA 4MTAA 5LMBA 4FZAB 3MBLA 4IE9A 1OKWA 5K0KA 3DPDA 3MIYA 2DYOA 1G5SA 2XS0A 2W1ZA 2E9OA 1CMKE 4IAYA 4YC6A 2LWPA 4GIIA 3L10B 5C8NA 5CEQA 4HK2A 4ITJA 4NL0A 2W9NA 4KRCA 1EUVB 5BYLA 2W99B 1UZXB 2X39A 3RK9A 4TW9A 5KUPA 4WRGA 1GZKA 2WEVA 2WIHA 2R5TA 1PXMA 1URWA 4BBNC 4IVAA 1U46A 1EF1A 3EFLA 4FT7A 4M15A 3FMDA 5E4HA 2J2IB 4FTLA 5L4QA 4AX8A 4B7TA 5IQAA 3P23A 2IN6A 4KIPA 4ALUA 3QF9A 2CNUA 3WIMA 5FG8A 3FZRA 4NUSA 3FLYA 3FXXA 1HCKA 4HCNB 4J8NA 3O17A 2OBJA 5CQUA 3VRYA 2K8CA 3MHSD 4OR5A 4RVTA 3DT1A 2QOCA 3G9LX 3QCXA 3TL8A 4LRMA 2IW6A 3L17A 4I6HA 3AT3A 5HU3A 5JZEB 5CU3A 1XH7A 4D2TA 5L2TA 2HZ0A 2RGPA 3POZA 4DFXE 4HZSA 5T6KA 4F7SA 3HV5A 5EH0A 3D5XA 4UMQA 3OWKA 2KQ7A 2GFCA 4FSYA 3C4XA 3P86A 4ZRIA 5BVEA 3LM5A 4XG3A 4FTMA 4GUBA 1NI2A 4CGAA 2CKHB 3GC8A 2ZCCA 2XYNA 2VO7A 3NNXA 2KWCA 4W9WA 1YXSA 1XO2B 5FTOA 3KFAA 4MEMA 3QKMA 5DEYA 2UZLA 3RK5A 3C0GA 3DBSA 3VN9A 2PMLX 3PZHA 2XF0A 3SW7A 1WMKA 1EO6A 3R8MA 2NR2A 4HYUA 1J0GA 4PQNA 1Q1OA 1G8SA 4FKLA 5KKRB 1DI9A 3QX4A 4KS8A 1JAMA 2J5FA 4O2ZA 3OY1A 2ITQA 3OP5A 4XOYA 3WIKA 4PF4A 2VN9A 3OHTA 5L8KA 2XCHA 3ZZWA 1NXKA 4MBLA 4GVAA 1WCCA 3H9OA 5JHBA 1WBPA 1WFYA 4G16A 2WYQA 3QD0A 3DNEA 3RPRA 2GCDA 5C4LA 4XNEA 3UIOB 3QRUA 3CS9A 2RFDA 2P3GX 4IG7B 5JEBA 3EOCA 2OGVA 3Q9ZA 2ERZE 2WTKB 3PTGA 2ONLC 5GINE 3NHEB 3DBHI 2PZ5A 3I5ZA 3VUXA 2I40A 1GZ8A 1ISNA 4B99A 4PRJA 3RTPA 4U44A 5CT7A 2VTAA 5FEEA 5C8KA 4ITHA 2IZSA 3PRIA 4AZVA 3R7VA 3RAHA 4EQCA 3HP5A 3KXXA 4DGMA 3ZSIA 3QWJA 4MWHA 4ACMA 5CAUA 4OTQA 3UBDA 2WQOA 5JFSA 1PMUA 4PTEA 4PMMA 3GQLA 2PMOX 5BPYA 1XWSA 3QRTA 1AQ1A 4C8BA 4GRBA 5DPRA 3O96A 3I6WA 3V5LA 5CAQA 4JJRA 2IW9A 5D2MB 1REKA 3UIMA 1WGGA 4J8MA 1MUOA 1GIJA 4J97A 2UW5A 5JRQA 1F9JA 4MM3A 2Q0BA 1ZKHA 1FVRA 4G5PA 3SW4A 3FYKX 1ZOEA 3G9NA 3QC4A 3FE3A 3RWPA 1GUAB 3PY1A 4YC8A 3DDQA 4F08A 3SKCA 4K8AA 2OK1A 2XNNA 2MLBA 4EC8A 3UNJA 1YDRE 2RD0A 2WQNA 4MD7E 3R8UA 5AUUA 5LXIB 1JOWB 2BIKB 3SG8A 3UF8A 1R0EA 2O6VD 3IOPA 2MRPA 3LE6A 4UX9A 4F7JA 3KUCB 4JRVA 2LXAA 2W7XA 4ZK5A 4FTUA 4Z16A 3PJ1A 4W9XA 4PNKA 1YOLA 3DDCB 1IP9A 4FTKA 4L3JA 1YXUA 2XEYA 5IUIA 2EUFB 3PHXB 2XK6A 3QYZA 2HENA 3QAQA 2ETKA 4IX5A 4DE4A 5J9YA 4OW8A 3WF8A 2PU8A 3GXLA 5KMLA 4F64A 2YITA 4F9CA 3ALOA 3BGQA 2XNPA 4OTGA 2VTPA 3FHIA 3JR1A 3JSVA 2I0EA 1ZRZA 3SA0A 3KMWA 5DA3A 4C33A 2JIIA 4JBVA 5AV0A 4DC2A 4BCPA 3DGKA 2DS1A 4CKJA 4V05A 4AG8A 3AOXA 5DMZA 4O1PA 5AX9A 3FYJX 4W9JA 2XNBA 3MTFA 4B9DA 4JDKA 1XJDA 3EC8A 4IVBA 5E1SA 4NM0A 4ZJIA 2CR5A 1LPUA 3U9CA 4JG8A 1TKIA 3Q9YA 4FN2A 4GU6A 3O2MA 4R3RA 3HUCA 2XUUA 3TV4A 4C57A 5C4KA 1UKHA 4TNBA 4WNPA 4DHZE 2OW3A 4KRDA 3PRPB 3UMWA 3TCAA 4NK9A 3OWPA 3FLSA 3MTLA 2OG8A 3APFA 3H7SA 4TQ1A 5L6WL 4EH5A 3ELJA 5LCKA 2PZIA 3VTVA 4BZNA 4ZY6A 3E62A 3IK3A 3WZUA 1RAXA 3LMIA 1M14A 4ERKA 3THBA 3R7IA 2UW0A 5T3QA 2WTJA 4B6WA 2Z60A 2QVSE 2I6LA 4HXDA 2W4OA 2ZAZA 3P79A 2PE6B 2W96B 3QX1A 2J0IA 4U3YA 1M7QA 2VGOA 5IQBA 4M69B 3DVNV 2AEHA 1SM2A 3D15A 4LGHA 2VWXA 4IVDA 1FGIA 3FZ1A 4KBAA 1T0YA 3L8VA 1GIHA 4IACA 4F9WA 3EB0A 4JOAA 4RWLA 1FMOE 2F7XE 4BKZA 2ZV7A 3FY0A 5HKMA 1OZ1A 3P1AA 3FQHA 4EH6A 4O7VA 3DK7A 3I60A 4EOSA 4DHJB 3DFAA 5JZNA 5AWMA 2IYDB 4GKIA 4TN6A 3ML9A 4L00A 3OG7A 4F0FA 2M4NA 5BMSA 3ZLSA 5DRBA 3BYSA 4WG3A 2R64A 3MH3A 4H3QA 1OB3A 1ZZLA 1PXPA 5AR5A 4D2SA 4LYNA 3EHAA 2WPAA 2V0DA 2JEDA 4ZZMA 4X6RA 1NW1A 2P0CA 2VTHA 1YI3A 4XP3A 4HCPB 2Z0DB 4GL9A 3FPQA 4FZDB 3VS2A 1GY3A 1TGZB 2WTIA 3O51A 3V5WA 1L8TA 4DHJD 5J79A 3QHTA 2BALA 5D10A 1LM8B 2YERA 5BNJA 1URCA 3RAKA 4YTCA 2YDIA 4IB5A 1JWHA 5CHVC 2RGFA 4U6RA 4FL3A 1NVQA 4CV9A 4C02A 3ORLA 1WBWA 3I0OA 5CZHA 2PUUA 2GS6A 2PPQA 1ZYJA 4F8CB 4RX5A 5JMSA 3F2NA 2MQJA 1QMZA 3L9LA 5J5SA 5CSVA 5ANJA 2FCMA 1MP8A 3E7VA 2YIXA 3QX2A 4F1TA 5D7GA 2CHWA 3UZRA 2UZBA 3VFKA 4IX6A 3U4WA 3ULIA 1F3MC 2Q83A 2AUHA 1P2AA 2B54A 5BVOA 3X23A 4FTOA 3ZHPC 2BRHA 4F7NA 5LXHA 4E5WA 5EDSA 4V0GB 1K2PA 3A4PA 1XH5A 2RIOA 1H1PA 4TQ0A 2QOOA 2Z02A 2XMYA 1CDKA 5DR6A 4IC8A 2CKQA 3QRIA 3Q2JA 3AMAA 3BINA 2YAKA 2C1AA 1H8FA 4A20A 2F49A 2ZZPB 4O86A 3CPCA 4QQTA 4QO9A 5FBOA 4AOTA 3SQQA 3FQSA 3QU0A 2CHLA 3MV5A 3QXPA 1WBVA 2QURA 4CFXA 3L8XA 3RULA 4HNIA 2L05A 2LD9A 4LV5A 4GW8A 5K4JA 3HDNA 3C4ZA 4FKUA 4AWJA 3PXFA 2B1PA 4WSYA 2NBUA 4EHGA 4EYMA 4A4OA 1M94A 2BAJA 3F5GA 4GUEA 1OM1A 5KX8A 5JFWA 3GC0A 4X2NA 4FG9A 1TQPA 3MWUA 4UMRA 4OBPA 2VRRB 3TIXA 2B0QA 5HQ0A 4NM5A 3MH1A 4LOOA 5J18A 1U5RA 1TTNA 4FIHA 2C3LA 2W5HA 5GJFA 4C37A 2KN5A 3LXNA 3LXPA 3VHEA 4CV8A 4F6SA 2P4IA 3NW6A 3DXPA 4URKA 3CSVA 3V04A 3NIZA 3LFAA 4M67A 2K8HA 4CFNA 1P1AA 3MGYA 5D9HA 5AR3A 3KRLA 4DBNA 5FXSA 2GQRA 4ASWC 3HYHA 3NVKI 4ANSA 3COMA 4BKSA 4D55A 2QO7A 5CY3A 5DT3A 4XG8A 3JPVA 3LQ3A 2L0FA 2WEIA 4EBWA 4JAJA 4L43A 1L7YA 4I23A 4DG2E 4U41A 4BGGA 3ZLYA 1OL2A 3QL8A 5L8LA 2PUIA 3E87A 4M13A 3MI9A 5CAPA 2WU7A 2C9WB 3OCGA 4RIXA 4HYSA 1PXJA 3RINA 2W9ZB 1H1WA 2OOBB 2PVHA 5EHOA 5A6OA 3AULA 5I9UA 3HX4A 4NJ6A 1Q24A 2J0LA 4EHVA 3IKAA 2FYSA 2B3AA 3NIEA 4E1ZA 3UC3A 3QALE 2KJRA 2W06A 1PKDA 3WILA 4ENYA 4AFJA 3DTCA 3HEGA 4J53A 3DK6A 1Y8GA 3ZUUA 3D94A 4U42A 2JT4B 2OU7A 4EHEA 1WRDB 1U4DA 3IW5A 4XLVA 5L2IA 3IECA 4FIFA 4DTBA 1B38A 4RSSA 2I1JA 3DKCA 3FZOA 4E73A 2C69A 3I1AA 1P3QU 5L2QA 3PA4A 4TYJA 3FEGA 3ZONA 3DJ5A 4FK3A 4RZVA 4AGCA 3GQIA 2K6QA 5G2NA 4NWMA 3GP0A 4ANUA 3TJPA 4F65A 2KO3A 3AI5A 4FNZA 4FUXA 4F7ZA 3WF6A 1OKYA 4HVBA 4CKRA 4AW5A 3UPZA 4D4VA 2XJ2A 4OTIA 3VIDA 3BCEA 5HLWA 4NZWB 3FKOA 5AP2A 4ZSGA 4J6IA 4WWPA 1NDDA 4WJQA 5DG5A 4FZ6A 3QGWA 3CJFA 4M0YA 4B9KA 3RUIB 5I5ZA 3HMIA 3RPOA 4Z7GA 2JRHA 4JXFA 2BDJA 4FV6A 4N6ZA 2WIPA 4FSMA 1WM2A 2HIWA 3RYTA 1L2NA 5KO1A 3OCSA 4U40A 2GQGA 3F7ZA 5ETAA 2LI5A 1W7HA 3VUWA 3GI3A 2CGWA 2QOFA 3ZYAA 3KMMA 2PL0A 2WU6A 5F9EA 2CGXA 4Y5QA 4O84A 2CHZA 2VTIA 4C2WA 1H1QA 3ZNHB 2CNQA 4IAIA 2GNGA 4AA4A 4AFEA 5KKRC 4BKTA 4MSQB 4BOZB 5CANA 3W1FA 3QUDA 4K9YA 2KVRA 3IG3A 2MP2B 4TYHA 1Q41A 3Q4TA 4IEBA 3VUGA 1PW2A 4NW5A 1PMNA 4RC3A 3DJ6A 2IZVB 3LZBA 4WNOA 2Q0NA 4M14A 2ZVNA 3WE8A 2PK9A 4PL3A 2W9FB 3K3JA 3QZFA 3S4QA 2V1YA 5J17A 4D58A 2J0MA 5JHAA 4L8MA 4F4PA 4M97A 2ZMDA 2VTRA 1YDSE 2YM4A 2KXJA 4QYFA 4F09A 3VUMA 1K9AA 4IXPA 5D94A 2WTKC 3VNTA 3W1SA 4E26A 3FL4A 3ANQA 3HK0A 3NW7A 4PL5A 3H3CA 4APPA 2ZJDA 5EM7A 3PVLA 1NVRA 4O96A 3NS9A 3VBXA 5K5XA 2OXXA 5LMKA 4WJNA 3KRRA 5EHLA 3TV6A 4OTFA 1CKPA 3A4OX 2YFXA 5EW3A 4AU8A 2BIYA 3OW3A 3ZRFA 5IDPA 2YIYA 4IM0A 3R8PA 1GJOA 4RX9A 2KLGA 4P5ZA 3C4EA 3AC8A 3MFRA 3ZO5B 2ZPNA 5AP6A 4MXXA 4G3CA 2BKFA 4QMNA 3EECA 2PVFA 2LVQA 2KTRB 5EQPA 4BL1A 2W1IA 3R8LA 4ANNA 3C51A 2VTNA 5AZFA 3EQBA 1OIRA 3PP0A 4MXAA 2Y6OA 4BI2A 3OT3A 4F63A 2YM7A 3Q04A 1U54B 3VQUA 3RKBA 4WUAA 2GOWA 2BTRA 2X6DA 5KBRA 3W18A 3R9OA 3A7GA 1YW2A 4KS7A 4K11A 2C6TA 4W9EA 4I0RA 3WANA 3G2FA 3U54A 4RIOA 5JGDA 3DNDA 2QONA 3HECA 4YP8A 3H9DA 3DZQA 2HZNA 2QHMA 4I94A 3LFSA 3T8OA 3BLRA 4NQLB 3UYSA 4MYGA 3PSDA 2P33A 4P7EA 4KD1A 3PFQA 3WF5A 3WF7A 4ZS0A 5DOSA 5F1ZA 4O7WA 3EN4A 4FNXA 2Y4PA 5D41A 5BMMA 2PULA 5LOHA 4EJNA 4KIKA 4QRCA 3QQJA 3WIGA 1E7UA 1WXAA 3ZSHA 2OKRA 4YSJA 3EQGA 3G6HA 4WNKA 4PS8A 1KLVA 4NYEA 2IVVA 3SXSA 4IJPA 4KZ0A 4G9CA 3E88A 5LVMA 4HZRA 5C1ZA 4YHTA 3KY2A 3V62A 4GEOA 4ASDA 1XH9A 4FEUA 3FI2A 3RGFA 2OH0E 4ZDVA 2JAMA 3QC8B 5AADA 3V5TA 5EKNA 3LJ0A 1O6YA 5KZ0A 1UBQA 3IS5A 4YJTA 4GDLA 3CY2A 3PTFC 4HVHA 3F5UA 2L0TA 3P4KA 3SD0A 4C59A 4I0SA 1OIYA 3QK0A 4IX3A 2A0CX 2WTVA 3DA6A 2VNYA 2BAQA 3LJ1A 3UIBA 4TWNA 4FT0A 4F9BA 4RIXB 3NZUA 4AN9A 3EJ1A 2PUPA 3W16A 4LJPB 3ROYA 4W4VA 4RA5A 1Y8YA 3KU2A 4UYAA 4BHZA 5IEXA 2GU8A 1AD5A 4CMOA 4O7SA 2YCQA 3UYTA 1P5EA 3RZWC 5M4IA 3TZ7A 4UZHA 4X3FB 4DGGA 3RNIA 4BDDA 5DT0A 4XBRA 3NUAA 1WE6A 1V0BA 3TWJA 2KDBA 4AOFA 5DPWA 4P4CA 4A9SA 1PXOA 3PT2B 2RF9A 2VTOA 4FV5A 3D7ZA 4II3B 5HBJA 1ZOHA 3CCNA 2B9HA 4JDHA 4DINA 2J0KA 4M8NA 2LGCA 4UWYA 3R28A 3G33A 2Y5BB 4HYIA 3P78A 3R01A 3RAIA 4DTAA 2VU3A 1RRBA 4DHZB 4EKUA 3RCDA 1FVVA 3R2BA 3F6XA 4MDKE 4O91A 3U7DA 5J87A 4EH7A 2W0JA 2NS5A 4DFUA 4BWPA 5HKHA 3ROCA 3DY7A 5DNRA 2JBPA 4BDHA 1WBTA 4DGNA 1WXSA 3P9JA 5CU2A 5GNKA 4MBJA 4Y85A 4BBFA 4BVUA 3RPSA 4BBMA 5AMNA 4BCIA 4JG6A 2RG5A 4EKLA 1V9JA 4TTHB 4K2RA 1FMKA 3TEIA 3OT8A 3UQAA 2VWIA 2ZNVB 3ZVVA 4RZWA 3QGYA 3PXRA 2ZDUA 1A5RA 1GC7A 1UD7A 3GCUA 3VO3A 4EZKA 5BVFA 3IG7A 4JDJA 2ITXA 4Y95A 2CHXA 1OIQA 2UWQA 5EI6A 3V8TA 3COKA 1OIUA 4RLKA 1SE9A 5KCVA 3TNQB 4MXZA 2VWWA 4IJ9A 3A9JA 3FMJA 3QHRA 4BDIA 3G90X 1GJZA 2CLXA 3IDCA 5DN3A 4D9UA 3M2WA 3BZ3A 4PMPA 2YM8A 5CAOA 2J51A 3BX5A 3SDJA 3W2SA 3BIZA 4XRJA 4D9TA 1OGUA 4RJ6A 1SVGA 4ICVA 2J5EA 5M53A 1XH8A 1Z5MA 3GU7A 4GIHA 4YPSA 2JDSA 3RP9A 3PPZA 3KCFA 2BZJA 4EEWA 4AJWA 4MNEA 3MJWA 3RVGA 5L6OA 1WGDA 4XBUA 4AACA 2Z7QA 4PL4A 3SAYA 4CMTA 5C23A 3ZIMA 2XEZA 1QPJA 2G2FA 4CYJA 1BT0A 3MVMA 1M2QA 1C1YB 3M11A 2GSFA 4OTRA 3SDLC 2XKDA 4GH2A 5T68A 1WY8A 3LCTA 2VTQA 3ZKJC 1WMHA 5AV1A 5EQEA 3IOKA 3PWYA 2GDOA 3SOAA 1OVEA 2WWZA 2WHBA 4R6VA 3A7IA 5HVKA 4KIQA 3DVGY 2BFYA 3OUKA 4XS2A 1KOBA 3R7EA 4I5HA 4RA4A 4K1BA 3UO4A 4HJOA 4CKIA 4D2PA 1ZXEA 5M51A 1BYGA 1KE6A 4AJYB 2JD5A 5CU4A 4NAWB 3W33A 1I35A 3LIJA 5AIKA 2R3QA 3P7AA 2BFXA 3D9VA 3TG1A 4IWDA 4GT3A 2W4KA 3R0TA 2PVJA 2C6LA 4AE9A 3LFCA 5JRSA 5CVGA 2JKMA 3BELA 3MB7A 3SD5A 1PJKA 2C0IA 2RFNA 4FBXA 5A4LA 1Y6AA 4IX4A 4U45A 3DFCB 4A9YA 1QL6A 4MH7A 3TNWA 4C61A 3A4RA 5FXRA 3CY3A 5BO4B 3LLAA 4ARKA 5CSWA 4C4HA 2N9PC 2EXEA 2E9UA 4KBKA 4CFVA 4MGYE 4GK2A 1YXTA 2IPXA 4QNYA 4F9AA 1OITA 2EB3A 3NNVA 4NCTC 3CEKA 3HP2A 2LGYA 1W82A 3AT4A 3ANRA 4FT5A 5EM5A 1CKJA 1IYFA 1L3RE 5GIPE 4E6QA 1LUFA 1NVSA 3DKOA 4QOXA 4GB9A 3PY0A 5E6PA 4FKTA 5DRDA 4G6OA 5CENA 2WMBA 4O0RA 4KIKB 2Y6MA 4U0IA 3N4VA 3FPMA 3QWKA 2HE7A 3HRFA 4Q5EA 1OPKA 1KV2A 5IKWA 4X57B 4IDVA 4RJ7A 3IPHA 3ZBFA 3ZUNA 4O83A 2GMXA 3UO6A 2FB8A 3E8CA 3A60A 3ZO3A 4K7SA 2V55A 4ZRJA 3R7YA 4ANWA 4DAWA 4LQMA 5DGZA 3A33B 4CFUA 4ENXA 3IW6A 1UU7A 3B0AA 4FSUA 4C4JA 1NT2A 4LFIA 4UN0C 4PTGA 5CVFA 3KULB 3QTIA 5HORA 3NUPA 3FQEA 1UNGA 3CKWA 3TTJA 2BZIB 3BQCA 2IJMA 4IWOA 4GSWA 1K8RB 3NUUA 2YJRA 4GDLB 3UGBB 4U79A 1E1XA 4RLLA 4O0SA 4RPVA 1PYEA 3JUHA 4EK6A 4X3JA 4IQ6A 4ANOA 1PQSA 1J7UA 4ZTNA 1V5TA 4U9AA 4G6LA 4QMVA 2GBRA 3OBGA 2HCKA 3PUPA 1ZOGA 3R7RA 4ACGA 2R3RA 2BUJA 3BLQA 4EK5A 1MRYA 2Z7SA 2VD5A 3LAUA 4FTCA 4X2GA 4L3LA 3W1YA 1WJ6A 3DXQA 4MQ1A 3TBLD 5KMIA 3Q4ZA 5GJDA 3IONA 5CLPA 5CXZA 3ZNZB 2JLDA 2XH5A 3H30A 3UOJA 2OZOA 2X0GA 1BI7A 4ZTSA 2D11A 3QA0A 4FMQA 4QMQA 2XKCA 4C4FA 5F94A 4HGTA 3L13A 2YLMA 2XCKA 2PUNA 5D11A 2HTHA 3UE4A 3DBFA 2ZB1A 5J95A 1ZYLA 4EOMA 4TUUA 3WAPA 3NDMA 1VCBA 3QAME 3FKLA 5JH6A 4I24A 4FV9A 4GN1A 2WZJA 3L0WB 4PWNA 3OWJA 1LR4A 4IC7A 2X8IA 4TNDA 4RX7A 3VS1A 4FUYA 2FVDA 1DM2A 3N9XA 5AUYA 1OBDA 3O23A 4DH5A 4RIYA 3DOGA 1SMHA 4O7LA 3VVWB 2FSLX 3FLWA 2HW7A 1QCFA 5JGBA 3UZPA 5HIEA 5KNJA 2FO0A 3V5PA 3ZRKA 4XJ0A 3PPKA 3KUDB 4YNEA 3LFNA 3MH2A 4KBCA 4W9GA 5DPTA 4XX5A 2C5YA 2OJ9A 4XG2A 5DEWA 3SLSA 4TV3A 2OXDA 1JKLA 4EEVA 4BYIA 4ZP5A 3REPA 4F1MA 4NQKE 5CEIA 5E6OA 4GJ2A 2ITYA 3QZHA 4G34A 4M0WB 2R3NA 3ZTDA 3PZEA 1JBPE 3NUNA 3SXRA 4IBMA 2YM6A 4FIIA 3ATTA 5AZGA 3HKOA 3GB2A 5CWZA 3ZLWA 5I3RA 4G1WA 3R2YA 4LMNA 4AGUA 3R3MA 1SIFA 4IAFA 2VZ6A 1H27A 4FSQA 3OCTA 2X4FA 2WKMA 1ZWSA 4G50A 5FTQA 3ZEWA 2FCNA 3JVSA 2AC5A 4P5QA 2YIWA 2HK5A 4FI1A 5GIOE 3R1SA 3MA6A 3DBLI 3W55A 1J1CA 1RLFA 2LRUA 2JWZA 4K7WA 3CC6A 4FV3A 2DZMA 4QMTA 4AUQC 4EOLA 1EF5A 3S2PA 3OS3A 2BDWA 3KXMA 4YJUA 4M12A 3QUPA 4DEBA 4MXOA 5EQYA 5K5NA 3BWFA 1JSUA 3CR0A 5M4FA 2XJ0A 2JBOA 3S1HA 4H3BA 2G45B 4F70A 2R7BA 3KVFB 4JGHB 4CT1A 3VH4B 3BGPA 3PDTA 4QTAA 2YA9A 3NZ0A 2YM5A 2UVZA 1I44A 1KM7A 1RE8A 3OJ3A 4EWHA 3OC1A 3V01A 5LJJA 3P0MA 3K2LA 2YCFA 5AM6A 4HGSA 1TBEA 5CEKA 3QTQA 3ORNA 4O7YA 2YWPA 3VHKA 4ZSEA 5HBEA 2WMAA 2QU5A 3LM0A 4FJZA 3ZFYA 3Q3BA 4E20A 2G2HA 3ENMA 2V5QA 3MJ1A 2DENB 1J7IA 1KSWA 2XM9A 4UBAA 4LL5A 4G3EA 2PMNX 4UMTA 3ENEA 1Q62A 3X0WA 3KMUA 2V3SA 4G2FA 4QP1A 3KRJA 2MBHA 1YHSA 1Z2MA 4E6AA 3SVVA 3EN5A 5IA7A 4CNHA 4EZ7A 2PZPA 3NWWA 3C0HA 2W1DA 3K9PB 4C4EA 5DR9A 2J50A 3R7GA 4AN2A 2QLQA 1OKVA 1VEBA 4RMZA 3ZM9A 4JLCA 1H0WA 2C5NA 1JSVA 4JBOA 2QOQA 3UNKA 3A9KA 4C3RA 5HI2A 2BKKA 2PZYA 3LCKA 4AZSA 5HE3A 2NPTB 4YMJA 4ZTHA 4C4IA 1C3TA 3GZNI 3RD2A 2OFUA 3GT8A 4AZWA 4DT9A 1OECA 2KTYA 4UZDA 2ZEQA 5CSXA 3AU4A 2K6DB 4DK5A 5M07A 3UOLA 5AIRA 5K0XA 2KX0A 1R1WA 3F3ZA 3FUPA 5B0XA 3C0RB 4LCDE 3LCSA 2VAGA 2XIKA 4I3ZA 1LQBA 3OY3A 2X81A 5CF6A 3LMHA 2D07B 3DAEA 1FBNA 4X3FC 4FSZA 2D3GA 3EQHA 4WHZA 3KC3A 2ONLA 3ETAA 4IZ7A 4DITA 2P2IA 3HV3A 1WGRA 4TKSA 4HVSA 1U5QA 2BRBA 2CNVA 4L67A 3BYUA 2WTCA 1YRPA 3B08A 2I0HA 5JKGA 4FJYA 3TUBA 3V60A 5C26A 4JS8A 4DFZE 2AC3A 3Q9WA 4TT7A 1M17A 2ITOA 4ZZNA 4QMOA 4FJVB 4UB7A 3PXQA 1PXKA 1Q97A 3BHUA 3TMPB 5JSMA 1BL7A 3F66A 2VO0A 3GU6A 4LI5A 4CFWA 3LQ8A 2YJSA 3H7PB 3FHRA 2I1MA 2NRYA 2IY0B 1OEYJ 2CGUA 5JZJA 4CFMA 4BZOA 1WX9A 5FGKA 3RM7A 5HLPA 4J7BA 5CNNA 4A4XA 5EDQA 1R4NI 3HM3A 1XQZA 4YZ9A 3HVCA 3PA5A 4BN1A 1SVHA 5H2UA 4I20A 5CU6A 3RAWA 4DH3A 4RG0A 2CSNA 2Z7RA 4XHKB 4K6ZA 2ZNVC 3DKFA 3GUBA 4BDAA 3KCKA 5HVJA 3Q3JA 1WIAA 5CTPA 2XKEA 3WYXA 4G3GA 4W4YA 5FQDC 2QHOA 3IW7A 4JR7A 4YZMA 2I1KA 2LJ5A 3A4SC 2H34A 3COIA 1H24A 2MSED 4RIWA 5C1QB 2BGFA 1O6KA 1V86A 2YLEA 2XYUA 4ZSAA 1IA8A 4HVGA 4LDTB 2OJGA 5DH3A 4A3OA 4MQ2A 2FUMA 4BZDA 1CM8A 1ATPE 2UVXA 4L6QA 3DVGX 3ZU7A 5AZHA 1WJNA 4RFZA 1H0VA 3ZM4A 1VZOA 4NTTA 1SGHA 4G3FA 3ORIA 4G5JA 4W9FA 2BYFA 4IAAA 3ZDMC 4ZTLA 3D5VA 3KL8A 4AE6A 5TF9A 3DQVA 3EIDA 3QWZB 2CCHA 3G5DA 4GJ3A 1WJUA 1H28A 3VS0A 3AC5A 1BUHA 4UALA 4WAAA 4O81A 2CU1A 4FT3A 3GFEA 3NRMA 4CLIA 2KFKB 2PSQA 2ZV2A 3BYMA 1GZNA 4LDTD 4ZJJA 3QTWA 3A8XA 3DAKA 4WWNA 1H1SA 2WX0A 3C4WA 4MK0A 3FMEA 3LJ3A 4FIGA 3D32A 4QYYA 3E3PA 2C5XA 2X2KA 2UZUE 2WMTA 3PLSA 4BDKA 1ZMVA 1Q3WA 4MEDA 3KN6A 3FSKA 5CEOA 2B55A 1GIIA 3V8SA 4N6YA 1OKZA 2QG5A 4LUEA 3VF8A 5GMVA 4O2PA 1WZ3A 4USEA 1E5WA 2XK9A 1H01A 4P90A 4LM5A 3D7TA 4I92A 3TZ8A 5EG3A 5ETFA 4QTBA 1X1MA 3W10A 3GCSA 3TIZA 3SHEA 4L42A 4N57A 3MSSA 2OLCA 5A9UA 4EFOA 5CX3A 3R1QA 5BX0A 5C9CA 4UEUA 3DDPA 2R0UA 4R1VA 5F95A 4MBIA 1QPDA 4EOIA 1YDTE 2KC2A 1OPLA 4AA0A 5E90A 1S3SG 5CYIA 1W0XC 2GTMA 4O0VA 3VUYA 1KJTA 4ANVA 4FKPA 4Y8DA 3LXKA 3ZRLA 1S9JA 4BWKA 3EQFA 3MIAA 4E4NA 5G55A 4MJSA 5IU2A 3EYHA 5HTIA 5HE0A 2R3GA 5AP1A 2FCSA 3VUTA 2GHMA 2E9NA 2G9XA 3N4UA 2J9MA 3C1XA 2IY1B 4F7LA 2JITA 3TV7A 3WARA 2X9EA 4AF3A 4B8MA 4GSBA 2FCQA 4U97A 2OXYA 5A46A 3QTZA 2C47A 3P5KA 2VWUA 2DZKA 4TWOA 3IO7A 3V6EB 2GHLA 2ZVOA 1VYWA 2K1FA 1UNLA 2PZRA 4YZNA 3KXZA 5M06A 5E8ZA 2HW6A 1W84A 1WGHA 4CYIA 2VTLA 3FZTA 5M44A 1O6LA 3A99A 3W2PA 4BDFA 2BWFA 1PHKA 2YIQA 5LQFA 2LVPA 3ML8A 1JKTA 3A1QB 3KK9A 3L16A 4NKSA 4E5AX 4TXCA 2R3MA 2HYYA 1ZYDA 4NT4A 3I4BA 3SRVB 3ZRMA 1CMXB 3LHJA 4FTTA 2WMRA 5A3XA 3WI6A 2WXVA 4FIEA 1H4RA 2JZ3B 3UTOA 5CU0A 5KHOA 5FM3A 1ZAOA 4XLIA 3MDYA 5M56A 4L45A 3S0OA 3MH0A 4YJOA 3Q9XA 2GS2A 2WQBA 3EFWA 2BKRB 4DEIA 4S31A 5LVOA 1DS5A 3C4FA 4QMMA 5AP7A 3QTSA 5DYJA 4A9UA 3ORXA 3POOA 2YLFA 4I0TA 4DGLC 4USFA 1IAHA 4CQEA 1WE7A 1TVOA 4PYUA 4FF8A 3V6SA 5DR2A 1FQ1B 3UMXA 4V01A 2C7HA 3ACJA 3UP2A 5CF4A 2F57A 3M3JA 1ZY5A 3WYYA 3ZUVA 2OZAA 5KMKA 4RC2A 3ET7A 1BX6A 4FE2A 2CKOA 1KE7A 3IDBA 2R3IA 5LWNA 4QMWA 2PVLA 4FSNA 2J6MA 3EHVA 3ZCLA 5IPJA 2DAFA 5DVRA 5EDRA 4DF3A 3D83A 3MA3A 5IF1A 5FD2A 4DG0E 3ORTA 4C58A 1P0RA 2BYVE 2PVYA 4EI4A 3NYOA 1FXTB 3RZBA 3WZEA 4TYGA 1ND4A 4ONAA 3D5WA 2DYBA 5M08A 4D28A 4PY1A 4B8LA 1IEPA 3FC1X 1E8WA 4IUMB 4QPMA 4HNFA 4KB8A 1JRUA 3HM6X 2GNHA 4HDQA 4AZFA 4PNIA 3VBQA 4E6CA 1LFDA 4IB3A 3MYGA 4CG9A 2JKKA 4M8TA 5IA3A 3C5UA 4I6FA 4UY9A 4DFYA 3NVMB 4QT1A 4RJ8A 3MB6A 3LMGA 4YJNA 4CT2A 3HGKA 3I6UA 3LVPA 3T9TA 4FVQA 3PVWA 2CGVA 2G4SA 5IDNA 3AD5A 4F1SA 4AP4C 1UVRA 3CD8A 2Y0AA 4ZLYA 3GOEA 4EHZA 4U80A 2VO3A 3DB8A 3BBWA 4FKJA 5I9VA 5M4UA 2VUWA 1W8CA 1MQBA 5EOLA 5BYYA 3R30A 3UINB 3OXZA 4BHNA 3BBTB 3OZ6A 4A06A 4E5BA 3PA3A 5EW8A 3S95A 1ZW7A 4G0NB 3GFWA 4KNBA 4H05A 1K3AA 4OT6A 5CQWA 4ZS4A 3HMOA 1A06A 2XK5B 4GDKA 4QMLA 3HV4A 4PS3A 4BIDA 2M1MA 3VWAA 4A9TA 4QMUA 1LEZA 3AG9A 1KOAA 2JZZA 5D1JA 5G6VA 4PX6A 2YCRA 3PVGA 1SVEA 5E6NA 5LLIA 4AZTA 4TKNA 5AV4A 3F9NA 5HTBA 2OO8X 4II5A 2W5BA 3EKKA 2M0XA 5HBHA 2X7FA 2G15A 1H00A 1X8BA 2DQ7X 2PEAA 2UVYA 5E9EA 2VTJA 1XBAA 4WBBB 3QD2B 2CMWA 4BTJA 4JQ8A 5I4NA 3C50A 3B2TA 2O63A 3NMUF 2FSTX 2PVKA 3F82A 3HMMA 4IM3A 4L44A 2F2UA 3KXNA 2DYMA 4GS6A 5FWKK 2NPQA 2GBNA 1OL5A 3PXYA 4W4WA 3V6CB 3WBLA 4KDIC 4IB0A 1ZYCA 4HPLB 3BV3A 3CJGA 2WAJA 1JQHA 3PZDA 2OJIA 3QCSA 4FNYA 4M8MA 3NY5A 3PE2A 3DBRI 4DEAA 4FEQA 3ZNID 2OI4X 5DWRA 2BRNA 3LLTA 4F1OA 2L76A 3TCPA 2ITNA 3D14A 1ZARA 4FKIA 4KIOA 4EC9A 4MGZE 2AYOB 3JYAA 4FG8A 3IVFA 1PXLA 3M62B 4JAIA 2GBKA 1H1RA 1WFCA 3CE3A 2GS7A 4MCVA 4PDSA 4F6UA 3PSCA 2ZM1A 3GGFA 3QQLA 4YZCA 3HDMA 4DEEA 4YGAA 4YJSA 4CMUA 3VBYA 3VULA 5IZFA 5FR6A 3RWQA 2N9XA 5CSPA 2QG7A 3RHKA 4DEDA 3CTHA 4XV1A 4PP9A 4EH2A 4JIKA 4AGDA 4QP3A 2C6EA 4TZRA 1WBSA 5HIBA 2JDTA 4RQKA 3DZOA 5AV3A 2HWPA 3RCJA 4LJOB 2PMIA 2M17A 2BROA 2O3PA 4Y5HA 5JFVA 1CKIA 2XBJA 2N7DA 2WD1A 3VJOA 4ITIA 2W05A 3C4CA 4FKWA 3BWJA 2W1FA 2X9FA 3VF9A 3TIYA 3KH0A 2VWVA 3VBVA 4FA6A 2NBWB 4YLJA 3HNGA 2KZRA 4N4SA 3FMMA 5CT0A
chains in the Genus database with same CATH superfamily
5LVPA 2JIVA 1WZ0A 4LL0A 2SRCA 4J1RA 4ANLA 2O5KA 1STEA 3VKHA 2QNJA 3RPVA 3U30A 4BCHA 3DBEA 3A62A 4DN5A 2W4JA 3DTWA 3Q3FA 3ZLXA 3DBDA 3E8DA 5BV3A 1NYQA 4DH7A 4ARIA 3C9WA 3Q96A 1J1BA 2GNFA 2V4LA 3LFFA 2UZTA 4XWTA 3KAWA 1AW7A 1UGMA 2LUEA 2WHIA 3NUYA 1F5QA 3BQRA 3TJDA 4CZYB 5ANIA 4RX8A 2UV2A 3BHVA 5I9XA 3QQHA 5J2RA 5HHWA 1WXVA 3ZO2A 4I6PA 4G6QA 3PSBA 3ZRCA 4Z7HA 4D5KA 1VYZA 4RVMA 3LCDA 2R3KA 4IANA 2MWSB 2QMTA 2X7GA 5JQ5A 3T48A 3ITZA 2A1AB 2XBBC 5LCJA 5IN7A 4EYJA 2O6VA 3ZFMA 5EDPA 3R66C 4R3PA 2QEJC 5AA8A 2VV9A 2R3PA 1OTRB 2GBJA 3Q52A 3RT3B 2XNGA 4IVCA 1LXDA 3FWQA 4NFNA 3WCQA 4BF2A 4HPTE 2IGDA 3KN5A 4O0XA 4U8ZA 2RFSA 4XMOA 2CKEA 4H1JA 2C3KA 2BPMA 3EFKA 4HYBA 4KKGA 2CJNA 3JY9A 4IZYA 2BHEA 3MVHA 4D4YA 4I21A 4WRSA 4M0ZA 4P7IA 4EBVA 4MHAA 3VJNA 4B0GA 5KHXA 4YHJA 2L8JA 4AT4A 5AX3A 3ZDIA 4FRFA 2C5LC 3D4QA 2EKIA 3TTIA 2LASA 4I93A 4F0IA 4ZXTA 3AKKA 1OQQA 4A9RA 1R78A 3OWLA 1LEWA 4FSWA 3PZ8A 4GFGA 2WELA 3ALNA 5HLNA 4JIOU 3T9LA 1I49A 5ITAA 4FTRA 2KDEB 1XHAA 3GU5A 2K0PA 1CSNA 2DZIA 1KTKA 3DVNU 1FXIA 3UNZA 3RCZA 3GENA 3VXWA 4FX3A 2MX2A 3I9V1 4I6LB 4E8AA 2PJHA 2CLQA 4AXDA 5L2WA 2OFVA 3KRXA 4H39A 4IAKA 2X1NA 3NPCA 3FC4A 1FMAD 4UWBA 3PPJA 1NYRA 3QC9A 3DBQA 4MSMB 4GG7A 3F69A 2BPSA 4NSTA 1OUKA 3HV6A 4XV9A 5D6JB 2JX5A 3ORZA 3FI8A 3OLMD 1AARA 1N5XA 4FV1A 1H4LA 4D2WA 4WG5A 2XIYA 1QX1A 3W0PA 4EK4A 4I5MA 2PLPA 4FBJB 3ACKA 2PKOA 3FXZA 5DIAA 1Y6BA 2IZRA 3QD3A 5H9BA 3CAZA 1A9UA 3E63A 2GNLA 3LCOA 2G9HD 3V5JA 5HE2A 1X03A 3T8MA 2H8HA 3C8YA 3EQDA 3BI6A 3M42A 3OJ4B 4Q5HA 3W0MA 4GMYA 3JSVB 3ODZX 3CQWA 3OVVA 2KWUB 2D10A 4R5YA 4XZ4A 3ZSGA 2R9SA 1GG3A 4CO7A 4RJ4A 3UGCA 3QXOA 2KD0A 2IO6A 4ZYNA 2FUHB 3LYYA 1T46A 1YOJA 5HG8A 1WXQA 3ZC6A 4ASXA 2FSOX 2GNIA 4JIAA 4PPBA 2BVAA 3R1NA 4I5CA 2IO3B 3QRJA 5HCXA 3TNIA 2JGZA 3C0IA 2QILA 1OQYA 5ANKA 3I81A 1B9RA 4R5LA 2R3LA 2EWAA 1D3ZA 2ITUA 5EFQA 4GK3A 5FK9C 2WQMA 3WZKA 2AX5A 3Q53A 5DE2A 3MY5A 1WI0A 5JH5C 3RPYA 1UU9A 2LXYA 3OW4A 3R21A 5G1XA 3SEBA 4E7WA 3PVUA 1VR9A 3MS9A 2YACA 3NCZA 1Y91A 4BGQA 5J1WA 4RWIA 3PJCA 3KA0A 4M69A 2IO1B 3QD4A 3WZDA 1SF0A 4O82A 4XG6A 2INPE 3APDA 5E91A 2BRMA 2R61A 2O64A 1WH3A 4EKKA 3QCYA 3PWDA 4IW0A 4FKSA 4BDCA 3GNIB 1UKIA 3AE7B 1ZMWA 1ZYSA 2R3HA 4TY1A 1DAYA 4QMXA 4FZSA 2IVSA 2WFYA 2FE8A 3EYGA 4O7NA 4A55A 2Y5CA 4BI0A 4YSXB 4R5SA 3V51A 3MN3A 1VR2A 4WA9A 4ZLOA 4CTCA 3QQ8B 5KMNA 2AYPA 4H3PA 3V3VA 2FAZA 4FG7A 3D4YA 1YOVB 4FC0A 1JSTA 4QMSA 2EVAA 1AN8A 4DHJA 3Q32A 3J9CA 3U8ZA 3KF7A 3UZTA 4HRSA 2C3IB 4RC4A 2O0I1 4NU1A 1M7NA 1I4LA 2ZDTA 1Q61A 4UXQA 4XUFA 4DYMA 3BLAA 5I9WA 2I38A 4C3PA 4LTUA 3Q5IA 1PMVA 1QOAA 4DEGA 1HWWA 4MH8A 3HAVA 3R71A 4YC3A 1QKZA 2VO6A 2GBMA 4BCGA 2Z7LA 1I09A 3QFVA 3AT2A 4R77A 3HA8A 4FYNA 2V62A 3TDVA 4IDTA 4ZSJA 2PE9A 2PWLA 2XP2A 3MPTA 1O7DB 4YTIA 2Y7JA 3F7WA 1TQUA 2C5VA 4MXCA 3A98A 2Z0VA 2W17A 4QQCA 4PT5A 4O0YA 4NJ7A 1J19A 3CTJA 3ZC5A 2MJDA 2CDZA 3IHPC 1HZ5A 4F0GA 4CZTA 4WWOA 1H26A 2WXNA 4EQUA 4C0TA 2RR9A 4EZPA 3SGCA 5B2MA 3UQGA 5KHWA 2BYEA 2LXCA 3P4SB 3PJ2A 3VVHA 3RM6A 3QKLA 1V1KA 3SHQA 2WU5B 3O71A 3CWIA 2F9GA 4HOKA 3DLSA 4IH8A 4L01A 1V0OA 2OJWA 3DHHC 3SR6A 1E9HA 2C6DA 3KXHA 4CRSA 1RQQA 4EH3A 4D2VA 4FTAA 1R4MI 3OD6X 4PYZA 3ZTCA 2W1HA 2GHGA 1S9IA 4ACHA 4KSQA 3I79A 2PY3A 2UYZB 4RT7A 5M55A 4PPAA 4A3PA 4QYGA 3EL8A 3TEZA 4X0MA 5IA0A 3UDBA 4RBLA 2BR1A 2OIDA 1XD3B 4NJCA 3GBZA 3LFBA 5FP5A 5K9IA 4YPDA 5DLSA 3TUDA 5AP5A 2WOUA 2RPVA 4RQVA 2KK8A 2YDJA 1WYGA 2WO6A 4O0UA 2OBMA 3QTRA 4YR8A 4YTHA 1R3CA 2G1TA 4KVGB 4MVFA 2NBVB 2ZV8A 4B4LA 4V0GA 2FUG1 2EXMA 3IQ7A 5E8WA 3T3VA 3U6IA 3PHWB 2WTDA 3SX9A 4R8QA 3AE9B 1OA1A 3EN6A 2JF5A 3CMMB 4ZSLA 4B95A 4I5PA 1YHVA 3NAXA 1WR6E 4ZTRA 3UJGA 4BB4A 4EOQA 1PRYA 4JG7A 3BGZA 2XIRA 3GEQA 3ZYYX 3IT6B 5CVHA 3O65B 1WYWB 4XG7A 4ACDA 1A70A 3VONA 2ND1A 4JNEA 3RPMA 4RVLA 5EI2A 2N7EA 4DXAB 1PGAA 4W9IA 1JVPP 1M52A 3LVTA 3KQ7A 3DQWA 1BUIC 4NW6A 3D5UA 1ET6A 1PMEA 3OOGA 3BVXA 4RVKA 3NNWA 4DBXA 2WX1A 3LDZE 3AGLA 2PE1A 2QQ7A 4AOIA 3W8QA 4K7UA 4PMTA 5GJGA 4L7FA 4IWQA 4F6WA 4ZJVA 3NS8A 4I1ZA 3PLUA 4R3DA 4M00A 3GCPA 4V04A 4FSRA 1XKKA 2O6VB 2AWTA 4AZ6A 1KH0A 4TPTA 3EQCA 3ZEPA 5J9ZA 4P16A 4EK3A 2WXLA 1VJYA 2EMSA 1RFAA 2ZJWA 3R7OA 4JX7A 2X6EA 3F61A 3NNUA 5HCYA 3PV1A 4DFBA 1HOWA 4PV0A 3E93A 3O8PA 3PS6A 3DV3A 4FA2A 3SV0A 3Q60A 3U87A 1E8YA 4C4GA 3Q6UA 2UUEA 4RFYA 3KW5B 1PXNA 3VC4A 4WD5A 1FVTA 3MFUA 3CZNA 4QP4A 5IA5A 1J7BA 2XB7A 4KAOA 5HX6A 3ZXTA 1YI6A 5D7AA 2R7IA 4S2ZA 3P08A 3T3UA 3ZOSA 4J96A 5CS6A 4F9YA 3AXCA 2AQ3B 1T0SC 3ZUTA 3EQRA 4MAOA 5CTRC 5AUTA 2ZPYA 3F2AA 3FMKA 4NCTA 3W2CA 4GG5A 2NP8A 3HRBA 4KWPA 1V5OA 3B9JA 3L1SA 4KKHA 2O0UA 3VAWA 1V49A 4G9RA 4QP7A 2PW9A 4BCKA 4AZEA 3QTXA 2YEXA 5HO8A 3ALBA 3KIOC 2PIAA 2UW8A 5J8IA 3COHA 4K0YA 2W55A 1Q0WB 1KOTA 4UMUA 5BUIA 2O8YA 3EL7A 5HD7A 1PY5A 5TKDA 3R00A 3S00A 3F2RA 3BL9A 3BE2A 4O27B 5LXMA 1EH4A 4ANXA 4CXAA 3M3WA 3DCVA 3P5JC 2BMCA 1BMKA 2O2VA 2JDOA 2RKUA 3VW8A 1GOZA 2I0VA 3DX2A 1L5PA 3VDZA 4E71A 3RV1A 2X8EA 1I4RA 4NSWA 3SG9A 4G11A 2D5GA 5AR7A 2KMCA 1V2YA 3VBTA 2OJFE 2N9EB 3TMOA 3N30A 3U9NA 4AXEA 3IFWB 1YX5B 3DHIC 3KGAA 2Y3AA 5DPVA 3R8ZA 4FR4A 3G0EA 1ZXHA 3VTUA 4JNWA 4B9QA 4EZ3A 3U4UA 3I3TB 3RNYA 2PHKA 4O6EA 4BKSD 4EZUA 2WXIA 3KB7A 2C4GA 2L00B 4L46A 3AGMA 3RJCA 5I0BA 1Q8ZA 1I4PA 4EOKA 3RK7A 4AUAA 3KDRA 2NNWB 5BUEA 4NNJB 3OOMA 1PF8A 4AOJA 4YBJA 5CASA 2WXHA 4BCQA 4TMAB 4FULA 3IAM1 3AC3A 4JQ7A 3NLBA 1XBCA 4C34A 5JT2A 3U2SC 1KLUD 3MJ2A 1IGDA 3QTUA 4YXDB 5HO6A 4FTNA 3SXFA 5HGIA 4WQMA 4FICA 2YL5A 3EJTA 1NENB 1QPEA 4HGEA 2KDFB 4CEGA 2RFEA 2O65A 3CLYA 4YU2A 3UVQA 2QOKA 2MBEA 4US8A 2W54A 1E8ZA 4HVIA 5AR8A 3TKUA 3EJUA 2IWIA 1R0PA 2VWYA 2R3OA 4QPSA 2KDIA 4D2KA 1HXYD 2HXQA 2ACXA 4J52A 3O13A 3QIJA 2OSCA 2Z0EB 4FGBA 5DT4A 1UH6A 1Q4LA 2DBYA 5CZIA 2GTNA 2KANA 2P55A 3B51X 5M09A 3R9HA 2MP2A 1SJED 4W9HA 3W5UB 3FMHA 3EZRA 4ZLZA 5AUVA 2FNJB 3E8EA 3IBEA 1FPYA 3ODYX 4N0SA 2N0SB 4U3ZA 4R78A 4XV3A 5LWMA 1YD8U 4YUQA 3BUIA 2BCJA 4AN3A 5LMAA 4MGIE 3UIXA 4OGRA 3GOPA 2UZVA 3ORMA 4FV7A 3CGFA 3ZLZA 3PG1A 5ACKA 4DCAA 2VNWA 4O4CA 1XBBA 4OT5A 3TM0A 4AXFA 2DYLA 4GYGA 2C6OA 3FLZA 4NFMA 2XNMA 2XNAC 4CYEA 1PXIA 5G5GA 4ORKA 4TYHB 5HZNA 4OUCA 4BC6A 3NEWA 2C7NB 1OL1A 3O50A 3VBWA 3IGGA 5EYKA 2CPKE 3UQFA 4AZGA 3IDPA 4BWXA 3NZSA 4ICUA 4P6VF 1J7LA 4EOYA 1B6CB 1DI8A 3K3IA 4Y72A 3JVZX 3HAJA 2IDYA 2ZVAA 4CZUA 2J0MB 5HICA 3IT4B 4IWPA 5AFVA 5J7BA 5H8YE 3H0YA 2ITTA 3ZNGC 4KZCA 4CSVA 2WTWA 2R4BA 3DBLB 1QOBA 2JKOA 3QLGA 5ANGA 2XALA 3HL7A 4FHJA 2QO2A 3WAOA 4KSLC 4M68A 3Q4CA 5EE1A 1I4XA 4YWGG 3OFMA 5B7VA 2X2LA 4KV2A 1GNTA 4ZRKA 1DOYA 3QKKA 4KKEA 4ZMFA 3ZS5A 4E4LA 3GB1A 2KTRA 5IQHA 1C4CA 4JR3A 3N32A 2OO2A 3H1UA 4MD8E 1OAOA 3CQEA 3R7QA 4TSSA 3O8UA 3CSFA 2C60A 1J7AA 2EX3B 5L3AA 3ATSA 2ZB0A 5AUZA 3NAYA 3ZXZA 1U54A 2ETMA 4J95A 1H8CA 2F7RA 3DS6A 4MKCA 1O9UA 5BMHA 3ZJTA 2QI8A 2PE2A 4ASEA 4WQOB 5FTGA 2KULA 3A8WA 5I3OA 5FXQA 2JSVX 1QPCA 4BDBA 4BTKA 4HWIB 3RN9C 3LQ5A 3BU5A 1Q8UA 3O3OB 2JUOA 5H3QA 1WM3A 1ZGUB 2XAOA 4EH4A 1REJA 2N4FA 1KE5A 1YOMA 2J90A 1FOTA 4FTJA 4Z55A 3RMKC 2XRWA 5I4DA 3PVBA 3RI7C 4AZCB 1JWAD 1E90A 1YJIA 3R83A 2LRWA 3VTWA 2PTLA 3ZJUA 3M95A 2GMIC 3BVGA 3W32A 4CCBA 3QZGA 3EN7A 4LGGA 5CALA 4YO4A 3GU4A 4JX3A 4W8DA 4GOCA 4I6BA 5A14A 2W5AA 2H6DA 3A7HA 4O6LA 2V7OA 2HWOA 4C7ZA 3EZVA 2Z59B 4FADA 1T45A 3GE3C 3ZEDA 4IADA 3I7CA 4PS7A 3EWHA 2WGJA 5KHQA 3ONSA 2J7TA 5TSSA 4LNNA 1U59A 3KVWA 4EZ5A 2L83A 3TT0A 3F3WA 4D4RA 4IM2A 2F7OA 3NCGA 5E1EA 5EKOA 4FTQA 4BDEA 2A98A 3Q69A 4NJDA 4IFCA 3SOCA 2DLBA 5GZAA 1TQTA 4QTDA 3N4TA 2PVNA 4BFMA 3UQCA 4G3XB 2MBOA 4H36A 4OW0A 5L95C 2HD5B 4O4FA 2XJ1A 2X2MA 2VX1A 4OTPA 2MJEA 1IPGA 1IUEA 3U7ZA 2YM3A 3QCQA 4LNOA 1M2RA 2OJRA 2GPHA 1SB3C 3U6JA 4ID7A 4LRJA 5E8VA 4CVAA 3QHWA 4FKQA 1Q8WA 3PLVA 4M3QA 3Q5ZA 4QP8A 1WBOA 1L0YB 4WPCA 3M1SA 2C0TA 3TZMA 4AT3A 3JY0A 4E4XA 4Q9SA 4OAUC 3HRCA 2YWVA 4D2RA 1WJ4A 2MEKA 2RSVA 3AB5A 1UU3A 2KOXA 5CXHA 1SUFA 4XX9A 3CXWA 2WB8A 3MVLA 5HNGA 1YI4A 3V5QA 4BCNA 3OEZA 3KF4A 3AMBA 4W8EA 2VX0A 1V0PA 3DU8A 4WNMA 4XG9A 2ZM3A 2R2PA 5DFPA 5IAAC