4IM3A

Structure of tank-binding kinase 1
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
659
structure length
605
Chain Sequence
GSMQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNRPVDVQMREFEVLKKLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGMNHLRENGIVHRNIKPGNIMRVIGEDGQSVYKLTDFGATVDLWSIGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITGKPSGAISGVQKAENGPIDWSGDMPVSCSLSRGLQVLLTPVLANILEADQEKCWGFDQFFAETSDILHRMVIHVFSLQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQELIYEGRRLVLEPGRLAQHFPKTTEENPIFVVSREPLNTIGLIYEKISLPKVHPRYDLDGDASMAKAITGVVCYACRIASTLLLYQELMRKGIRWLIELIKDDYNETVHKKTEVVITLDFCIRNIEKTVKVAAELGEISDIHTKLLRLSSSQGTIETSLQDIDSRLSPGGSLADAWAHQEGTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLAYNEEQIHKFDKQKLYYHATKAMTHFTDECVKKYEAFLNKSEEWIRKMLHLRKQLLSLTNQCFDIEEEVSKYQEYTNELQET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase TBK1
publication title Structure of Tank-Binding Kinase 1
rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 194
structure length 605
sequence length 659
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-01-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF18394 TBK1_CCD1 TANK-binding kinase 1 coiled-coil domain 1
A PF18396 TBK1_ULD TANK binding kinase 1 ubiquitin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4im3A02
1.20.1270.420 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4im3A04
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4im3A03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4im3A01
3PTGA 3DXQA 3ZH8A 4MH0E 1KWPA 1ZXEA 2Y0AA 3P78A 5IH6A 4BDKA 3ZW3A 1Q1OA 2KWCA 4AZWA 3FUPA 5EM7A 4I41A 3WIKA 3FI4A 1H08A 2XEYA 4FUXA 3DOGA 3EL8A 4Q9ZA 2R2PA 3ORXA 1OIYA 4BRXA 5ANKA 4EJNA 3MVJA 4B8LA 4C36A 4YC6A 4P7EA 3ZXZA 3BQRA 3CD3A 3VS5A 4ZZMA 3WE8A 4GT4A 2WU7A 2F7XE 2GNGA 2KWUB 4RIXA 4O0YA 4L01A 4X21A 4XOYA 4FNZA 3ZLWA 5CQUA 4FTMA 3DJ6A 5EDQA 3A4SC 3EECA 1P2AA 2KFKB 5LMKA 2KVRA 2IG7A 4QNAA 4QMXA 4APPA 3KCKA 2JT4B 4L42A 3V5QA 4DFUA 2BGFA 2VRRB 3IDCA 2JKQA 3ZNGC 2C30A 5CI7A 4K0YA 1WM3A 3A9JB 2OXYA 4HJKA 4U41A 1YHSA 3GU8A 4C2VA 3MH0A 4MDKE 3PLVA 4N6ZA 3R28A 1WJ4A 3ZUTA 4DHZE 5G55A 3UG1A 3A4PA 3POOA 3E8CA 3HECA 3D5XA 4PPCA 2OZAA 2VTTA 4WQOB 1ZW7A 3MH3A 3KVWA 1WF9A 1R1WA 2REXA 4ID7A 2ZV2A 4F70A 4J96A 4FV2A 1FVTA 5H8EA 3LCTA 4DGOA 5FEQA 4KS8A 2OIDA 3PJ8A 4OVVA 3U8ZA 2NPQA 4I0RA 2DZJA 4L67A 3G2FA 4AT3A 4RBLA 1YI4A 3OROA 4QQCA 2P55A 3R83A 1GZ8A 3GT8A 4NCTC 3NZ0A 3V51A 4BBMA 4MJSB 3A1QA 3TL5A 5JT2A 1SIFA 4B7TA 2BDFA 4UZDA 3ORMA 3DK6A 4CYIA 1BLXA 3ZDMC 4RJ7A 4FULA 2J5FA 4BIBA 2O6VA 4I22A 2RGFA 1UU3A 1PKDA 2ERKA 4XUFA 4DF3A 5DWRA 4P5ZA 5BUIA 2XIKA 4YL8A 3A2CA 1WR1A 4D5KA 3TN8A 3L9NA 3JS2A 4JIOU 4KV2A 3WZDA 3W2QA 4E3CA 3NWWA 2E9VA 3KN5A 5EOLA 3C0GA 1Y8YA 2L3ZA 5KMKA 4I0TA 4X3JA 3VUHA 3LLTA 1PMNA 3NS8A 5GIOE 4ZEGA 3JR1A 4C33A 4I6FA 1PXMA 4BYJA 2PVLA 3W2SA 4CXAA 2YDKA 2KJRA 3Q3FA 1YWNA 5BYLA 3UVRA 4DTKA 3AC5A 4NUSA 3HP2A 5KBQA 4IFCA 4QTAA 3VNTA 4NAWB 4GIVA 4O7RA 4HW7A 3SA0A 3DB8A 3R7VA 1WVYA 2V55A 4WAAA 2Z7RA 3F7ZA 2C7MB 4FV7A 4IUMB 2W0JA 5AP1A 4U9AA 3PIZA 1OIQA 4MWHA 3NUXA 3AC3A 3AMYA 3RAKA 1J7UA 2KTYA 4UALA 3CS9A 3UVPA 2C1BA 4GGQA 4ZS4A 2PZYA 3FSKA 1NA7A 4FYNA 1RQQA 2A4LA 1PXOA 2ITXA 2YDIA 3JYUA 1GJZA 4QMYA 2FCMA 1W84A 3QKKA 2CN8A 4EEVA 5F94A 5HE3A 3S1HA 5AV2A 2DX5B 3QQFA 3ALOA 3VBWA 2UW6A 1H1RA 4RWLA 4ZRIA 4EH5A 4ENXA 3HYHA 2QO9A 5EQEA 2QHOA 3GBZA 3Q6UA 2WMAA 4M8NA 5M4FA 3DZOA 3MPTA 2LGDA 1V6EA 3QALE 3OOMA 4N0SA 2M0XA 5LVPA 4KSPA 2PE1A 4KD1A 4GDLA 2CHZA 4PNKA 1PXPA 2Z60A 2XIYA 5CU0A 1PXJA 4BR3A 4EBVA 5FTOA 2HZ4A 4JGHB 3PLUA 2YAAA 2NBUA 2YM4A 4XP0A 2W06A 3IKAA 4XG9A 2YLFA 3FBVA 5HVJA 4FG8A 5AR8A 1CTPE 3DCVA 4D4SA 2WO6A 5CYIA 4A9YA 5JHBA 4DFBA 3NY5A 3VS4A 3PWYA 3OT3A 4JQ7A 2L00B 4EQCA 4GV1A 4O0XA 3WZJA 4EC9A 2ZDUA 3QC8B 4BL1A 1R39A 3DKGA 2VWXA 4ZK5A 2FSTX 2C6DA 2PPQA 4MXZA 3EN6A 4CRSA 4K77A 3OG7A 4LUDA 3MA6A 2XJ2A 3WF5A 3QYWA 4YUQA 2PMOX 3CSVA 4NW6A 2NR2A 2W1EA 4OAUC 4LDTD 1H0WA 2FSLX 4LI5A 4X2GA 1JPAA 5HCZA 2JDTA 3NCZA 4ZTNA 4O22A 4X3FA 4ZTRA 4MNEB 5AZHA 2ONLA 2QOHA 3TACA 1B39A 3AT2A 2V7OA 5A3XA 2B9IA 2O63A 4W9DA 5AP0A 2HENA 3W10A 3ZDTA 5AUTA 4X3FB 3C0RB 3WF9A 3P86A 2BRNA 1OBDA 1JSTA 4BCJA 5LCJA 5HIEA 3ID6C 4CMOA 2B52A 5KMIA 2B7AA 3VJOA 4TPTA 5EI8A 4AN2A 4I6LB 4E5BA 2RFNA 3IW7A 3H0YA 3JVZX 1YDSE 3DNDA 3QD3A 3W1FA 2C3IB 5HLNA 4DN5A 3RK9A 4LCDE 1FGKA 3GC7A 3Q2JA 2I0HA 2IW8A 4NSTA 3ZMMA 3WAMA 2BCJA 1H1WA 4E8AA 3VTWA 2G3QB 2JF5A 1Z57A 2XJ1A 2UW0A 4RSSA 3HKOA 5ANIA 2PHKA 4O6LA 3TV6A 4E7WA 4KKHA 2Y4PA 3OBGA 4FN2A 3QTZA 3Q04A 4W4YA 3IO7A 4Y8DA 5FXQA 2RG5A 5B2LA 3EL7A 4FLHA 4Y73A 1P4FA 3AC4A 2I6LA 4G2FA 4BKZA 4EOPA 2ZJWA 4FTRA 1VJYA 3PZEA 4GJ2A 4GRBA 3PS6A 4QTEA 2AYPA 2UZDA 4KRDA 1V0BA 4F99A 5BMSA 2LGYA 1V80A 1AQ1A 4L53A 1ZLTA 4FG9A 4HJOA 3KUDB 1GZKA 2YLEA 1Q5WB 4C34A 3DS6A 4GXBA 3HGKA 3QC4A 3UP2A 1H0VA 4I94A 4MD9E 3LCSA 4TWPA 3ETAA 1BI8A 5AUVA 2Z0EB 3KGAA 2GFSA 2WOUA 4DLJA 2MQJA 4J8NA 3FI3A 3TUDA 4UEUA 3PPZA 3F6XA 3LFFA 4XG6A 3NGAA 4I5MA 4OTPA 1J91A 5HE0A 5KKRB 5IEXA 4CKRA 2KJHB 3JYAA 4EL9A 4FKIA 3JVSA 2G4DB 5DLSA 4YZDA 4ZRKA 1UZXB 3DQXA 2KFJA 3GQIA 1K2PA 4ZRJA 2QCSA 5HU9A 3PRFA 2WQBA 4H58A 2ITTA 4I6HA 3EQCA 3NW7A 5BPYA 3COKA 2CHWA 4LJPB 4Y83A 4W9XA 2BPMA 3DVNV 1V0PA 3TJPA 4ONAA 3NAXA 2HYYA 3E92A 3VN9A 2GNLA 5FDXA 3PVWA 2WPAA 5ETAA 3WALA 2OW3A 1LQBA 4BN1A 1ZOHA 3GEQA 4KIKA 3FMKA 5KHXA 3IW8A 1M94A 1QPDA 4BCOA 1UU9A 5FTQA 3QTXA 3SC1A 1MQBA 4YZMA 1URWA 3UGCA 5I3RA 4QD6A 3EWHA 2J6MA 2G1TA 1F5QA 3SX9A 4K7UA 1E7VA 2J51A 5I9ZA 1UKHA 2GOWA 1UKIA 1CKIA 2ZMDA 2LJ5A 3D32A 5IUGA 1XHAA 2X1NA 4RJ8A 5AEPA 1SNXA 2J2IB 3HAVA 5HBHA 4U7ZA 2JY6A 1YJ1A 2XJ0A 3OCBA 5KZ0A 1TQMA 3LJ3A 4D2WA 3TIZA 4F9AA 1LXDA 2DZMA 3PHXB 2XNOA 2GBMA 3KUZA 3VHTC 4H1MA 3QLGA 1ERKA 3A62A 1ZMVA 3ZDUA 3QQ8B 4EZJA 2IBIB 2WXVA 5FRIA 4M8MA 4LMNA 4FZDB 2I7QA 4WNOA 1W8CA 4Y95A 3PRMB 2ZVNA 1H1SA 3ZNZB 2XMYA 3BIZA 2XNGA 4YR8A 2OOBB 2JIVA 2XKCA 5GMVA 3B08A 4OTHA 4UWCA 5FG8A 4L00A 2FCNA 3IDBA 5IA2A 2MSED 4YJOA 5H3QA 1WE7A 1ZZ2A 2UW9A 4I4EA 3ZTCA 3MTFA 4YO4A 3O65B 2IVVA 3EQHA 2R3MA 5KMOA 5BVWA 1UNLA 4IQ6A 3TDVA 3OWPA 1QPCA 4FV6A 2OBJA 3FMNA 4ANOA 2XBBC 4RG0A 4J52A 5LMKC 1PMUA 3MS9A 4GFGA 2GMIC 3MTLA 5I9WA 3KEXA 3OMVA 4EH2A 2DYBA 3I4BA 4CSVA 3QQGA 4LUEA 4Z3VA 3NZSA 2CGUA 1NT2A 5JFWA 4DEAA 5JEBA 2VWZA 4M3QA 4TQ1A 3K5VA 1OIRA 4GJ3A 5AUYA 2V3SA 2ITZA 5M44A 2L8JA 5AR3A 3R00A 3ZFMA 4I6QA 2OJRA 2CJMA 2DS1A 4K6ZA 2PL0A 3LLAA 2GCDA 3R71A 3IGGA 1R78A 5TR6A 3BQCA 4I4FA 4EH3A 3P9JA 3T9IA 5FBNC 2PUNA 2YIXA 2NBVB 2UZUE 3GOEA 5DN3A 5EQYA 3O7LB 4H3PA 3F5GA 4LMUA 2ZZPB 4HCTA 4YTHA 3MWUA 4FZ7A 3GU4A 5EHOA 1P98A 2UW8A 4O7LA 5M4CA 4G9RA 3VRYA 4CFMA 2PVHA 4F7NA 3OEFX 5IUHA 4FE2A 1Y6AA 4I6PA 4PMPA 3SRVB 2UW3A 2CGVA 3EQFA 4F0FA 2PWLA 3RM7A 2C3KA 4IH8A 2J0LA 3PXZA 1IA8A 1Q8YA 1WJ6A 3KRJA 5AZFA 3DY7A 3E62A 2Z2WA 4EK5A 3PIYA 4NIFA 3R63A 2PZPA 1P0RA 4UYAA 5DYJA 5H9BA 5AAGA 3ZUNA 2XK7A 2E2BA 4QP9A 3RULA 4ZLZA 3VFKA 5JZJA 4KKGA 3PJ3A 5AP2A 2FYSA 4BZNA 2JUOA 5A4TA 2A4ZA 1ZY5A 5LXIB 2ZB1A 4QMPA 3FSFA 1YXSA 3FJQE 1ZMUA 4W9HA 3QWJA 2LUEA 5AAEA 4FTOA 3RNIA 4HDQA 4Z7HA 4FL2A 5E8XA 1PXNA 4FV5A 3MDYA 1Q24A 4WSQA 5A46A 3TUBA 3Q4UA 3Q9XA 1FVRA 4C4HA 3IK3A 3A7IA 3TCAA 3TI1A 4EH6A 4QP1A 1Q4LA 3ZO4A 4HVHA 4G17A 1ZOGA 4S33A 3C4ZA 3VF8A 3BLHA 4E1ZA 4YTCA 2DHZA 4UYNA 2UVYA 4ZYNA 1PXLA 3UIXA 4DA5A 1VYWA 4L46A 1O6KA 5DPTA 3GC8A 4O0TA 2CU1A 4LDTB 4ZTMA 4F08A 3GOKA 1WGRA 4RA5A 3VQUA 4YTIA 3TNQB 2AL3A 2FA2A 2LASA 1OVEA 5CEPA 3PXQA 3D15A 4AP7A 4DGMA 4DAWA 3CMMB 4MVFA 1WMHB 2OWBA 2BZHB 5E6OA 2WMQA 4O7ZA 2NRYA 1A48A 3U6HA 3UINB 2YJRA 5BUJA 4BDFA 3F2NA 3BY4B 1PRYA 4FIHA 2R5TA 4MTAA 5HO8A 3C4FA 1NI2A 2ITQA 3PG1A 3R9NA 2MBBB 1EF1A 4W4WA 1RFAA 2W1DA 2JAMA 1T46A 4DG2E 4DT9A 4GYGA 3QA8A 3BELA 3IS5A 4M68A 4JJRA 2HZIA 5DPSA 3VC4A 5EHLA 2UVZA 4IJ9A 4HVBA 2ETRA 4AZTA 5TF9A 3RHKA 4MYGA 3EKNA 2BYVE 4UWBA 4G6OA 3R8UA 5CY3A 2QODA 5LJJA 3TZ8A 4LOPA 3IHPC 2CKEA 1WGGA 3I1AA 3DVNU 3QQJA 5CAUA 3EYGA 4AWJA 2CN5A 5FGKA 1Q99A 5IA1A 1V86A 5C26A 1KUTA 4BTMA 2YM5A 3SOAA 1JRUA 3DQVA 4X2KA 5CX3A 2B9FA 4HGTA 4GUBA 2G15A 1J1BA 4JAJA 4ZAUA 4A4LA 4FTIA 4DBXA 1K8RB 3C4XA 2PVJA 2VTOA 3EZVA 3B8RA 4EOKA 5DR2A 5HKHA 3QTWA 4MWIA 4B99A 2C5OA 1YXXA 5AR2A 1W7HA 4C62A 1WFYA 2CHLA 3OY1A 1RRBA 4DHJD 3GCPA 3E7VA 4X3FC 5K0XA 5LQFA 5E92A 4M12A 4CLIA 4Y5HA 4FV4A 4M84A 1EO6A 4YZBA 2E9OA 4M8TA 3IW5A 4AJYB 2XKFA 3TJDA 4FIEA 5AUUA 4IAIA 4I5PA 3QTRA 4OBOA 4D1SA 2IZRA 3NOBA 2OK1A 1ZY4A 5L3AA 5C4KA 5JMSA 4ACGA 3L13A 4YNEA 3K9PB 2HTHA 1WX9A 2N7EA 2CLQA 3L17A 1OGWA 4O96A 3QK0A 2XM9A 4G3FA 3O8PA 4ANVA 2BIYA 4CMTA 4E4NA 2BR1A 2W4OA 3FC1X 4BTJA 3UC4A 4W9JA 2GHGA 3S4QA 3VH4B 3U9NA 4KB8A 4IC7A 3U6JA 1RE8A 4I23A 3SW4A 5GZ8A 3KC3A 1C1YB 2W1CA 4IX3A 4XP3A 4N6YA 2JRHA 4FTUA 4F9WA 3VDZA 1OUKA 2VGOA 3SOCA 3WIMA 5HX8A 4XBRA 5B2KA 4O2ZA 4FADA 2LRWA 4FKJA 4U44A 5HBJA 5HG8A 5FXRA 2W1ZA 4TKSA 3MB7A 4W9CA 4CG8A 3BEGA 5AIRA 5CVHA 5KCVA 3WZEA 2P3GX 2VTJA 3ALBA 2PMNX 4FVPA 5KNJA 1ZYSA 4IACA 3KXHA 3AOXA 5HESA 4G50A 4DHFA 3D83A 4NT4A 3RNYA 4MX9A 3QX1A 3IFWB 1P9DU 3PTFC 3TT0A 1NBFC 4FTQA 3HMNA 1U59A 3C4WA 5FP6A 2KZRA 4YLKA 3PA4A 4CKJA 5KKRC 1CDKA 5CU4A 2CCIA 3FKLA 4C3RA 3H9RA 3OWKA 3TJCA 4RFMA 3PY3A 3A9KA 4E71A 2WQNA 4QMSA 3LFBA 4E5AX 4FKVA 3R6XA 2V0DA 4H1JA 4L44A 3CTJA 3QJZA 4PNIA 3BU5A 1R0PA 4ZTLA 1Q41A 5LWNA 3EMGA 2MBOA 2WIPA 1UBQA 2WEVA 2O3PA 3R04A 4J8MA 4FTJA 5KHWA 3LDZE 4BVUA 2UZLA 4EQMA 3NW6A 4YP8A 2JITA 1OECA 4D4YA 3FWQA 4L3LA 5CX9A 1B38A 1Y8GA 1F0QA 4H3BA 4HVSA 3BKBA 3VUTA 3AI5A 4GL9A 1UA2A 3Q9YA 4XG8A 5DT4A 2XYNA 1IASA 2C9WB 4BDEA 4G1WA 3ZIMA 4S31A 3QTSA 5M57A 2WFYA 4Y5QA 4MXOA 4HXDA 1QL6A 3QQKA 3ANRA 3B0AA 2REIA 4AUQC 4I20A 4O83A 2K1FA 2WU6A 3EIDA 2YIWA 3QQHA 4FKWA 3DBRI 4M69B 4NJ3A 3LFQA 3KK8A 3RPYA 3F82A 4DH8A 5DMZA 5BO4B 3FZRA 1V1KA 4RC4A 5D1JA 2C5YA 2PUIA 3PUPA 4O1PA 1MQ4A 1XR1A 4ANUA 2RG6A 4JDHA 2X2MA 4FSWA 2K39A 4GB9A 3U55A 2VO7A 2F7ZE 4LOOA 3UO6A 1FPUA 3VULA 1ZAOA 1H00A 1TTNA 5F9EA 4CT1A 3NYXA 4LGHA 2PUPA 1EF5A 4CLJA 2QKWB 3DBLI 4YBJA 1WX7A 2PULA 4ALUA 3R3MA 2WNTA 5CASA 4KZ0A 2BDWA 4G3CA 4QQJA 2QU5A 4OT6A 2WEIA 4ZS0A 5DPRA 1ZZLA 2KDEB 3F2AA 4IVAA 4HYSA 3I79A 5DPWA 2VWUA 1WMKA 2MLBA 3N9XA 5C01A 3R8VA 4KIQA 3UBDA 4I5HA 1OEYJ 1TGZB 5F20A 4PF4A 2CPKE 3AG9A 3ZONA 4IWQA 3R8MA 2HY0A 3GC9A 3H3CA 4LL0A 3CE3A 3LCOA 2OLCA 2VX3A 4DTAA 3RAWA 3EKKA 5BYZA 3IPHA 5EK7A 2P2IA 1UWHA 4FT7A 1JKLA 2W17A 1OPKA 3AT3A 5T68A 4ACHA 4PS8A 3LMGA 1PMEA 5B0XA 3PFQA 3AGMA 4MD8E 2OXXA 3M42A 3W8QA 5J1WA 1DI8A 4C4FA 4BDIA 4QYHA 3T3VA 1WXMA 3DVGX 2W1HA 4TWOA 3LXLA 2MP2A 5HD7A 4X6QC 2YM7A 4FKPA 3WOWA 4KBCA 4HYIA 4D2VA 1UU8A 2CKQA 2QOQA 3KL8A 3O51A 3P0MA 1G8SA 1Q61A 4AW2A 2HCKA 5HTBA 3HDMA 3VTVA 4BYIA 3FHRA 2IVTA 2JDVA 2PE9A 4URKA 3CGOA 3HL7A 3SW7A 2JD5A 1WZYA 5K3YA 2W9NA 4FHKA 1ZKHA 4EZLA 4F64A 2PYWA 3WI6A 3BINA 4BCPA 2W5BA 2KQSA 3D2KA 2IO2B 3OJ3A 3TUCA 3Q5ZA 4FKRA 1DM2A 2YIYA 2WMVA 1PJKA 3QRKA 3X0WA 4QQTA 3BWFA 2YEXA 4I1ZA 2WMUA 3V6CB 5J1VA 2VRXA 2UZWE 3FC2A 3EN7A 5IDPA 3D7ZA 2QQ7A 5L2TA 3MHSD 4AZVA 2OJIA 3IW6A 4Y72A 4ZTQA 3HHMA 3L8VA 1LM8B 3G33A 3PPAA 5H8GA 2OJJA 2ZB0A 2L7RA 5DH3A 3C4EA 2K6DB 4J6IA 5IQCA 1Q8TA 5J87A 5L8JA 3R9DA 3W2CA 1BUHA 3VHEA 1UVRA 3G90X 3DDQA 5CLPA 4CFFA 5IZFA 3RWPA 1H27A 4KKEA 2Y4IC 3QHRA 3ZLZA 4OBPA 3NUYA 3PZDA 1XKKA 3L08A 4MCVA 4IFGA 4DFNA 2Y5BB 3D9VA 5E1SA 4IX5A 2E9PA 2W1GA 3EN4A 4EWQA 3S00A 1QZEA 3FQSA 2OG8A 4ZMFA 3TNIA 4F1SA 4G3EA 1GJOA 4XLVA 3GCQA 5E8YA 3RP9A 4O86A 1REJA 5IH5A 4OTFA 4RWIA 4C58A 2G01A 4GK2A 3OVVA 4GFMA 3DLSA 4C59A 4C7TA 4BZDA 3ZM4A 4NW5A 3SD0A 3ZU7A 3ZO2A 4IB0A 3Q4TA 4M67A 3P79A 2CR5A 4KRCA 1LFDA 3A7GA 4EOJA 3UF8A 4IG7B 5H2UA 2JIIA 1J7IA 2LGCA 4MK0A 4RZWA 4O6EA 3JXWA 2ZMCA 2G9XA 4BI0A 2OZOA 4RQKA 3QGWA 4KDLB 5D9HA 1F3MC 3V3VA 1P4OA 4M14A 2DWBA 4F1OA 1BI7A 1TKIA 2O65A 5M09A 4R6VA 5AV0A 4ZSEA 4M97A 3Q96A 5CF8A 4I5CA 3GVUA 4TYJA 2OH4A 4XH6A 4FNWA 4KWPA 4LJOB 3NNUA 2KLGA 2XEWA 5EI2A 2QOCA 2WZJA 3ENMA 3SDJA 2CHXA 3HP5A 3TZMA 5CVFA 5J95A 3D7TB 4EFOA 2DAFA 1M7QA 1XH4A 3PXRA 4ASEA 2XIRA 1WBWA 2WAJA 5DI1A 1YXTA 4L68A 3LOKA 3UGBB 1JQHA 2LD9A 5IA3A 1PY5A 4JG7A 4ICUA 4NYEA 4MSQB 4XV9A 2W9ZB 3UZPA 1OZ1A 4AF3A 1YWVA 4C38A 3CY2A 1FMKA 2F57A 4ZSGA 4WJPA 4O0SA 2E9NA 1GIIA 4ZY4A 2YACA 1VD2A 3QTIA 3AD4A 3QL8A 2GDOA 3ZBFA 3HA6A 4QYGA 3TM0A 4NM5A 2UZVA 2ZCBA 3QAQA 1E8ZA 3RT3B 2WTKB 2X2LA 3OUKA 1YHVA 1H24A 4L3PA 2PZ5A 4OT5A 1CMXB 3FLZA 5F1ZA 2CKPA 3LFSA 4AT5A 4EWHA 4YHFA 3O2MA 4AW0A 4YGAA 4JOAA 1YVJA 3JY0A 5T6KA 4WD5A 5D6JB 3VJNA 4MBLA 2FGIA 2R3GA 4J98A 2AC3A 2I1KA 1OL1A 4L52A 3ZFYA 3L0WB 3OTVA 4FKTA 4E20A 1YXVA 2GBJA 3TZ7A 1KLVA 2PSQA 4GVJA 5AADA 4BB4A 3EQRA 3QYZA 4TY1A 3RK5A 3H1UA 4WJOA 2B53A 2EWAA 4C4JA 3O23A 5KBRA 4B9DA 2BAQA 4D5HA 4AGCA 3V5WA 2OIBA 4HNFA 4O7TA 3KMUA 3PJ1A 2BRMA 3RZWC 2OSCA 3O8UA 2IW9A 3WF8A 2IYDB 4IWDA 1G8AA 5CNOA 1FVVA 2IWIA 3WZUA 4D9TA 3KULA 1IAHA 3G0EA 4QYFA 2XEZA 4B4LA 2OU7A 5C27A 5D2MB 4WKQA 4RJ4A 3ALNA 3UQFA 1MUOA 3DPDA 3EJ1A 3UZRA 4AU8A 5IEVA 4FICA 3LZBA 3O96A 4DEIA 4L8MA 1HCLA 4PP9A 4PDYA 1FGIA 4KVGB 2Y8OA 5BVKA 2Y9QA 3BGPA 4DDGD 4XX5A 5DBXA 2LWPA 2UWQA 4MHAA 3VS0A 3K54A 3PGEA 2KMAA 4FIIA 3Q9ZA 3KRLA 3LPBA 1YQJA 4FNXA 3PZHA 4EORA 3ZLYA 3NYNA 2B9HA 3R66C 1UBIA 4TUUA 4IAKA 3AQVA 3MW1A 5EDPA 4IZYA 3BYMA 2WGJA 3FZTA 4EH8A 4S2ZA 3KY2A 5HVYA 1WBPA 5CVGA 2H8HA 2Q0BA 5E1EA 1P5EA 2QOOA 5GHVA 5ACKA 1BL7A 5TT7A 5IEYA 1WGYA 2OFVA 2BZIB 4PTEA 4X6RA 4DC2A 4AOIA 2RF9A 4QTCA 2Z02A 3FYJX 2XP2A 1ISNA 2M8SA 3NUPA 2NPTA 4QP3A 3R7OA 1U4DA 3CBLA 4Q9SA 4F6UA 3VUWA 4FUYA 3VH3B 5E8WA 3HLLA 2K8HA 5CXHA 5EW8A 4OVUA 4PMSA 5J8IA 2KC2A 3Q3BA 4FOCA 2KC1A 4D55A 3H9OA 4DBGA 3S95A 5CF6A 3W32A 4CFXA 4K81A 4BCFA 5DVRA 4WJNA 5JQ5A 4V0GA 1IPGA 2HD5B 2QVSE 4K7WA 3OC1A 5M08A 3NYVA 5DFPA 5EQPA 3DPKA 3QD4A 3S3IA 3RBWA 2CGWA 1YDTE 3LFAA 4DITA 4NM0A 5CHWA 4MBJA 5FD2A 4V0GB 4IE9A 4MBIA 3F3TA 1GOLA 3HMOA 1YQBA 4WRGA 4BFRA 5HLPA 3BLQA 2W99B 2N4FA 2XBJA 5AWMA 4HCVA 4GU6A 5CEKA 4BKTA 4IX4A 2O2UA 4RM8A 5LVNA 4TWNA 1XH9A 5EFQA 3L9LA 5IQGA 3BYUA 2ETMA 4YLLA 3SVVA 4AZEA 1L7YA 5C8NA 4X2NA 3HZTA 3MY5A 3QTUA 4ANSA 5IISA 3BRBA 2EXMA 3W2OA 5DCNA 4RJ5A 4DFLA 3L8SA 4FMQA 4LQMA 2FH9A 3MESA 4BKSA 3W2PA 3RYTA 1E1VA 4PQNA 3BE9A 3S2PA 4CFWA 4UMTA 4D0XA 4PTCA 3WYYA 1S3SG 4CQGA 4TNBA 3Q4CA 3QCAA 2JKKA 2JFLA 5D7VA 1ZWSA 2JZZA 4CG9A 1Q8ZA 2QG5A 3PYYA 3PG3A 4XNEA 2YHVA 5IQIA 1M52A 4CT2A 4BGHA 2WQOA 4FHJA 3BBWA 4PMMA 4NEUA 5CANA 3P1AA 1O6YA 4QTBA 3CF6E 4U42A 2WQEA 5AX9A 3MH2A 1XQQA 2I1MA 5ANDA 3OCTA 3ODZX 5HICA 4JDKA 4HVGA 2PK9A 4GN1A 3QGYA 4AE9A 2J0MA 3F3ZA 4IM0A 1OIUA 3RWQA 4R1YA 2XH5A 4RIWA 3RZFA 2OF2A 2QHMA 4FX3A 5AP7A 3OW3A 3ZCLA 4IW0A 1E5WA 3G9LX 3QZIA 1Y8RC 1GNGA 3LQ3A 4LRMA 4FK6A 5KMMA 1GUAB 3PY0A 3O0GA 3ZRMA 3HMPA 3MFUA 2GMXA 3QX4A 4HDOA 3PVLA 3N4VA 1GZOA 4O0WA 5EH0A 2L0TA 3UMXA 2YM6A 3PDTA 4TYHA 4W9LA 4U43A 5DEWA 5FDPA 4JR7A 3LFCA 5DT3A 4UZHA 3UIBA 2PE0A 4EK8A 5DEYA 5FEEA 1WE6A 1Y91A 4ZTHA 2JBOA 2WX0A 4PDSA 2YWVA 5L95C 3PWDA 3IBEA 3C5IA 4L7SA 5A4EA 4APCA 4G31A 5CXZA 2GBRA 5CTPA 3KXGA 4CZTA 4CQEA 5CSVA 4CFUA 2C5XA 1JNKA 5CEIA 4FODA 5CT7A 3HK0A 1W0XC 4MQ2A 4NM3A 2IZVB 4WWOA 3F3UA 4B9KA 3OAWA 3POZA 2GTNA 4DWFA 1LP4A 3VUIA 3ROYA 4C02A 2YCSA 4D2RA 5AM6A 5DR9A 4F8CB 1AGWA 4BI2A 2VTRA 3FMLA 3RJCA 4JRNA 5HD4A 3CSFA 4AX8A 5EI6A 4P4CA 5L2QA 4A9SA 4ASZA 2A27A 5AX3A 2KFKA 4OTWA 1OL5A 2AWTA 1MRUA 2ZPNA 3VUKA 4D4RA 3TTJA 1UELA 2HXQA 2C5LC 2XF0A 5HHWA 2C7NB 3A9JA 5IQAA 3R7EA 4WG4A 2DYLA 3WZKA 4RX5A 2BRBA 2JKOA 3QXOA 5E6NA 1E9HA 2WELA 4A4OA 4GS6A 4CKIA 3FPMA 3C0HA 2C5NA 4NFNA 5CU2A 4X2JA 4FZFB 3V5LA 1YD8U 1UWJA 2V7AA 3LFEA 4UB7A 4GVAA 2JBPA 2OGVA 4FEXA 3FPQA 3HV3A 3PRZA 1WGHA 5DGZA 3LE6A 4FEWA 5I9XA 1K3AA 4QMMA 3EB0A 4LGDA 4DFZE 4JBVA 3MB6A 1A5RA 4II2B 4ANBA 4C4EA 1IA9A 3IQ7A 1XT9B 3WF6A 2ZJDA 3DBFA 5KX8A 4TNDA 4C3FA 3TZ9A 1R4MI 3KH0A 4O7WA 4ZZOA 5A54A 3R7GA 3MFSA 5C03A 3R9OA 4MJSA 2X9EA 4RPVA 4EKUA 1ZARA 3AMBA 3EH9A 1S1QB 3DBEA 2ETKA 1HOWA 5IA5A 2ZV8A 4D9UA 4O7VA 5L8KA 2ZM1A 2QOLA 3KU2A 2QNJA 1WXVA 4J99A 2B3AA 1LPUA 4F1TA 4ZJJA 4EHVA 1SE9A 3V60A 3GB2A 4TRLA 3PVGA 3QHWA 3DKOA 3CTQA 3U4WA 1NVRA 4RVMA 3SU8X 2M17A 4ANMA 1UD7A 1OTRB 3R22A 4TWCA 3LM0A 4HYUA 3UQCA 3R7RA 1YKRA 4YTFA 2PVFA 4XOZA 3RALA 1H4RA 4WHZA 3C51A 4EHEA 2GNFA 1H07A 4BF2A 4GG5A 4K8AA 2HW6A 3DJ7A 4O7SA 4FEUA 3APDA 4XX9A 3W2RA 5DRBA 4L9IA 4OLIA 3BHTA 3F69A 3Q3JA 1JKKA 3EC8A 4W4VA 3W16A 2VTQA 4NAWA 5EYDA 5JN2A 3ZC5A 3MYGA 3RHXA 4QP4A 4NJ7A 3OUNB 1GG3A 2M4NA 3L9PA 2OF4A 3GP0A 2FSMX 3FMEA 3R02A 1KV1A 2ZAZA 2M1MA 2UZTA 3GNIB 4XCUA 3BV2A 4MGZE 4BKYA 1U5QA 4AOTA 4FSYA 1P1AA 4TKNA 4IMYA 5HQ0A 5D10A 2W1FA 3BI6A 4QQ5A 5J7BA 2X7GA 5FXSA 3LXPA 1V0OA 4AACA 5IQDA 4ASDA 1PHKA 4YJVA 4L7FA 4OTDA 2ITYA 1WXSA 3E93A 3G6GA 4DK5A 3CPBA 3P7BA 3LXNA 2OJFE 2XK3A 3G0FA 3DBSA 4RVLA 2IW6A 1H01A 2X6DA 5ITAA 2KANA 4BGGA 2V4LA 1WBSA 2KTRA 3PLAE 2EB2A 1W82A 3UYSA 5CAVA 2YFXA 4R3CA 4K7SA 4CFVA 5IQEA 1V49A 2HW7A 5L2SA 3NDMA 4MQ1A 3V6SA 5LXHA 4RJ6A 2A2AA 4BTFA 3MTNB 4AOJA 3II5A 2GHLA 2KTRB 3S2AA 4XS2A 2WQMA 1I42A 2FSOX 1PXIA 3UDBA 3RAIA 4AOFA 3QWZB 2O8YA 3SQQA 1YX6B 2C6MA 2J4ZA 2GFCA 4DH5A 3QCYA 3LMIA 5CS6A 3NPCA 3OHTA 2BKKA 4NJDA 4QP2A 3KFAA 4D2PA 3DAEA 4IAFA 3QARA 2XS0A 1A9UA 3RPVA 4FTTA 2KWVB 4F7ZA 4MXCA 3GI3A 5AA9A 1XO2B 4TZRA 5KZIA 1BL6A 2B4SB 2YIRA 3QA0A 4JQWC 3R30A 1H25A 4EH7A 4HCNB 2IZSA 1OPJA 5HNGA 3DXPA 2XZSA 1KE9A 1WBVA 4WUAA 3DAJA 4A3OA 2JDSA 3OEZA 3QRJA 3UPXA 4LRKA 2KLCA 3OFMA 3SHQA 4FL1A 3C5UA 3TNHA 2BKRB 2XKEA 3RGFA 4BDBA 4BY9E 4UMPA 4NK9A 1E7UA 4CZUA 4IADA 5DG5A 4U45A 4BKGA 3KB7A 4YO6A 3UO4A 1YOMA 4R8QA 4U3YA 1XH8A 4R7HA 3DQWA 3WILA 3VW8A 1BYGA 5CAQA 2WOTA 1WGDA 1WZ0A 4KUJA 3HVCA 5GNKA 2ITPA 5HI2A 3WAPA 4ACCA 3M3JA 2F2CB 3OS3A 3DVGY 4MNEA 2CKHB 4O0VA 3H10A 4CRLA 3A60A 4QP6A 5D7AA 3NMUF 5GJGA 4EHGA 3RCZA 3AMAA 3BEAA 4JL9A 2W05A 3HNGA 2RKUA 4WWNA 3R9RA 3DCGA 1XWSA 2RFDA 4KIPA 1IEPA 4EZ7A 3EQBA 3ZO5B 2I1JA 4F6SA 4DH1A 3L16A 3DBDA 2ZOQA 1OI9A 3R2BA 4NH1A 2GHMA 1LR4A 1P3QU 3D14A 3JVRA 3UODA 4TN6A 4BDDA 1NY3A 2ITVA 5K0KA 5DA3A 3A7HA 3RINA 3ELJA 3E8DA 3H9FA 3UYTA 2J90A 1S9IA 1YRPA 4G11A 3BZ3A 4LRJA 4R3PA 3O17A 2NCNA 3FZPA 1NXKA 4XZ4A 4RX7A 1YWRA 2ESMA 2BZKB 3C9WA 2YIQA 4U79A 4FJYA 4MEDA 4DFYA 3GUBA 3VBTA 5HNBA 2HWPA 4AZFA 1J8CA 3G5DA 4E93A 2J0JA 4YJPA 1UV5A 2PE6B 2VWIA 4M0ZA 5CI6A 3R7UA 4Q5EA 3WE4A 5AUZA 3VIDA 5JKGA 5D94A 4DTBA 2E9UA 5HTCA 2J9MA 2QI8A 3V5TA 3EHVA 4GKHA 1E90A 4JX7A 5CSPA 2MCNB 3ITZA 4BOZB 3PP1A 4WJQA 3Q32A 5EKOA 4PWNA 4K18A 4EK6A 3PIXA 4YZCA 4ZP5A 1OKWA 1WVWA 1PXKA 2PMIA 2WKMA 2O6VD 3SGCA 3VQHA 1SNUA 3FEGA 2B9JA 5J9YA 2KK8A 2UZOA 3ZLSA 5JFXA 2WD1A 4FT0A 4MGIE 4U80A 5K5NA 2VWYA 3FXZA 2QOKA 3ZO1A 5KHQA 2W7XA 2JKMA 3MVLA 3MGYA 4P90A 4AN9A 2KN5A 4NKAA 4ZXTA 1GIJA 3EFLA 4AN3A 2MBQA 3RMFA 4MSMB 1X1MA 2UV2A 3L1SA 2QD9A 4GDKA 5AP6A 1YXUA 5HEZA 3DFCB 4CCBA 4CYEA 2QR8A 2PU8A 3SKCA 4V04A 1UU7A 4QMLA 3F88A 2X81A 4A9UA 3LQ8A 3PXKA 4EKLA 4DT8A 5HTIA 3LFDA 4D1XA 2JPHA 4GDKB 5KHOA 4FV0A 2BTSA 4MAOA 4HVIA 3QHTA 2KOXA 3V04A 2IY1B 5F95A 1H28A 1IG1A 2YCQA 1YI3A 2D07B 1VEBA 5L6WL 1XBAA 2ZV7A 2XCKA 3NVKI 1FBNA 2OH0E 4B0GA 5CEMA 1K9AA 4RVTA 2BKZA 3PXFA 2PE2A 5G2NA 5E7RA 1J1CA 3ZTDA 2C60A 2ZV9A 3FXWA 3L8PA 3FMHA 1KE8A 4CVAA 1Q8WA 5DOSA 3DZQA 1M7NA 2ZM3A 4FI1A 3NS9A 3DAKA 2KD0A 4JBPA 2WTVA 4LV5A 2VN9A 1M14A 1STCE 4LM5A 3ZM9A 4X2FA 4OW8A 2QU6A 2NS5A 3HEGA 4FEQA 2IY0B 2QR7A 5A9UA 3QZFA 1Q0WB 4JNWA 4AFJA 2VD5A 3RCDA 5FP5A 4XP2A 4D58A 4FIJA 4WNMA 1NDDA 3D2IA 2GS7A 2DQ7X 3BGQA 2VU3A 4PL3A 2OFUA 4WNKA 4O38A 5CSXA 3HIZA 4ICVA 2ERZE 3AT4A 4QMTA 3LCKA 2X0GA 2Q0NA 4WSYA 5CAPA 1OKZA 3DXNA 4J53A 1Q62A 3QZHA 2N7DA 3S0OA 4MELA 4HK2A 5I9YA 3PE1A 3L10B 3DTCA 2PUUA 5JQ8A 2KHWB 3C13A 2W5HA 3OWJA 1YOJA 2JDOA 4L45A 4XBUA 2ITWA 3A7FA 3E3PA 4MNFA 3F7WA 4FTLA 4TT7A 4OR5A 4ACMA 2QOFA 3QWKA 4HVDA 1XH6A 2ZEQA 4KSKC 4HCUA 5AFVA 4GH2A 4I24A 2LVPA 5KMJA 4BBFA 3DK7A 3ORTA 3AULA 3IGOA 2XK5B 3L54A 3FKNA 5M55A 4IDTA 3E88A 3ZYAA 3HRCA 2XNPA 4LOQA 3M2WA 4EOMA 1U4AA 5GZ9A 2PZIA 2ZM4A 2PEAA 3ET7A 3TNWA 2ZYBA 3UOHA 4UBAA 1URCA 5C1QB 4GK4A 4AA5A 4DH3A 4RIYA 3KXXA 4QPMA 4HOKA 1AD5A 2KULA 1UH6A 3PRIA 2HZ0A 4ANNA 5J79A 3RAHA 1JVPP 1WVXA 2YM8A 4ZZNA 3SRVA 5FUTA 4D4VA 4NTTA 1CM8A 2UUEA 5JZEB 4RIYB 3LIJA 5K5XA 2YISA 3DLZA 3WA0A 3HRFA 4C4IA 4BTKA 2F2UA 4CMUA 5F4NA 2YERA 4L3JA 4BIEA 3VW6A 2KMCA 2BKFA 3DGKA 4EEWA 2R3NA 5E90A 5BVDA 2GQGA 4FSMA 3VUXA 1PYXA 3L8XA 4X0MA 4TV3A 4TYIA 4FT5A 3CPCA 2VX0A 3E87A 2XIXA 5L2IA 2LGXA 2N1WA 2FAZA 2X4FA 3FLWA 3Q52A 3UJGA 2WMWA 3ORKA 3W8LA 3EFUA 4IVDA 4E6AA 5C1ZA 4RA4A 2AC5A 3HX4A 3DDCB 4E73A 2UZNA 3C1XA 2I0VA 2GS6A 2X6EA 4IBMA 4QO9A 2RD0A 3TIXA 4WO5A 3D5VA 3VVWB 3DFAA 4ZY6A 3F2RA 3QD0A 5AUXA 4FC0A 2GBKA 3NIZA 1R4NI 3MJ1A 4F0IA 3ZSHA 1IR3A 3QTQA 2G4SA 5IH4A 1G6JA 5JGAA 2XK9A 4YC8A 5IU2A 2G2FA 2L76A 4F7SA 4YC3A 3FZSA 2YCRA 1Q3DA 3HDNA 4JIKA 5GJDA 2QOIA 5CSHA 4S30A 2JZ3B 2R3FA 1ZYDA 4HWIB 3QD2B 2JXXA 1V81A 4E5WA 4XG7A 2O64A 2YVCA 4CZYB 1WMHA 3UIUA 3R8ZA 4RIXB 2WWZA 4J95A 3OXZA 3ZDIA 4YZNA 2LXAA 4WT6A 5LOHA 3HV7A 4ANLA 5CWZA 3RZBA 3VBVA 3R73A 3DOWA 4FGBA 4ENYA 4PS7A 3H6NA 4FV8A 4F09A 4IEBA 3IOPA 4KINA 5EM6A 3CLYA 1YDRE 1OPLA 4K2RA 3MH1A 3ERKA 1SGHA 1E8YA 4XV1A 4W9KA 1QMZA 4RRVA 3EN9A 2YN8A 2X39A 4NWMA 3TXOA 2BZJA 5DR6A 4PRJA 2GNJA 4IDVA 5I3OA 1KOAA 2I40A 2CSNA 3D0EA 4BGQA 1JWHA 4IVBA 2OZAB 2K25A 3COIA 3V6EB 1W83A 3CGFA 4HGEA 4XHKB 1Z2MA 2JDRA 3BYSA 2G2IA 3TKUA 3GFWA 3VO3A 1A06A 2GNIA 2NO3A 4DDID 4NZWB 2WTCA 3GC0A 3R8LA 3KREA 3QKMA 4DXAB 5JRSA 2X8EA 3QRUA 2O2VA 4GU9A 3TTIA 4KZCA 3HA8A 3A4RA 4YJRA 1V5TA 3P5KA 3NAYA 4RJ3A 4XV2A 1KSWA 4KAOA 3OT8A 3DA6A 2CMWA 2YJSA 5IA0A 2JGZA 1KJTA 2GBNA 3A1QB 2XNNA 2XBAA 3MIAA 4KIOA 2O2VB 3M1SA 4NQLB 3U8WA 5JRQA 4W9IA 2LZ6A 4TQ0A 3UQBA 5CALA 3APCA 2O6VB 3CQUA 5EDRA 2HE7A 4TW9A 3CQWA 5KE0A 5CEQA 3VBQA 5CNNA 4DEBA 5GINE 3BHHA 3FZ1A 2GU8A 4FSTA 2YLMA 4BCGA 3GCUA 4I21A 2AUHA 4FJVB 4RT7A 3IG7A 3NNXA 2R2QA 5GZAA 2VTLA 4PPBA 5IQFA 5AA8A 4ANXA 4RWKA 2WTIA 3U4UA 1APME 3W33A 1WAKA 5AEKB 3F61A 4G6LA 2C4GA 4DEEA 2KX0A 5TOZA 4BBNF 1XH5A 2ZPYA 2L0FA 3LJ2A 2YITA 3N51A 4B95A 4I6BA 1GZNA 3OTUA 5IMEA 3ECIA 3ZNHB 3LQ5A 3QCXA 2V62A 4O0UA 3RKBA 5EM8A 3D94A 4O82A 2IO1B 4ZDVA 5EM5A 1Z5SB 1VZOA 3QUEA 3O7LD 5HBEA 5ICPA 5I9VA 2CS4A 3H4JA 2C0TA 2BAJA 2IVSA 1ND4A 4QMNA 4A20A 1LUFA 3VHKA 2CCHA 4FKSA 3W55A 5EYKA 2DAJA 2B54A 4G0NB 4JBQA 4AA4A 4F4PA 2PY3A 5LARA 2BWFA 3KXNA 2VGPA 3KF4A 3AXCA 2WDTB 4WNPA 4PL5A 2EB3A 5D41A 4ZSLA 3Q60A 2CNUA 2WMXA 3R1QA 4ARKA 2OI4X 5IPJA 4JI9A 3L9MA 2BROA 3R01A 4FKGA 4F9BA 2JWZA 2X4ZA 4EZ5A 1OEYA 3P7CA 4HLEA 4GDLB 1Z5MA 4LL5A 4OTQA 3ZUVA 4BDGA 3A61A 5AR5A 2DYOA 3ZO3A 2F49A 1NVSA 3TKHA 4G5JA 1WIAA 3IW4A 5CENA 4IZ7A 3GGFA 2Z7LA 4CGAA 2BYFA 3VWAA 4EK4A 4DEHA 2X7FA 4BCNA 2N9EB 4YSJA 4RVKA 3E3BX 1G5SA 4N57A 3KQ7A 1SYKA 4F0GA 3TG1A 2LAVA 4FOBA 4GIIA 2IJMA 3QUPA 2W96B 2BMCA 3HM6X 3R8PA 4L43A 2OJ9A 5CAOA 4EBWA 3VQIA 3FQHA 2C47A 5J17A 5JSMA 2R3PA 2A19B 3FMDA 4FF8A 3FLYA 3QCQA 4WBOA 5CZIA 3ZRKA 2BWES 4G3DA 4U81A 4E6CA 5CHVC 3JW0X 1IAJA 4QMWA 4FSRA 2BHEA 1TZ1A 4PYZA 4FTNA 5IQBA 4M69A 2FO0A 4IM3A 3A8XA 4AGDA 2QO2A 3RI1A 4IC8A 4IZAA 2QHNA 2Y6OA 4E26A 4WWPA 3U51A 4FT9A 2YDJA 1RLFA 4YPDA 2MA9B 2F9GA 5LVMA 4H05A 4E6QA 4RZVA 4EUUA 3NW5A 4HCPB 2BFXA 4EZKA 4F6WA 3N32A 3UG2A 4F63A 2N9XA 3M11A 3MPMA 3NEWA 4OTGA 4DBNA 4FNYA 4WG3A 3B2WA 4JX3A 1OBGA 1L8TA 1F9JA 4FR4A 3MA3A 3TEIA 3SXSA 4HYHA 3PPJA 3D5WA 2FUHB 4FEVA 2QLQA 3GCSA 3ZFXA 3FLQA 2QG7A 2FIDA 1LEWA 3QU0A 3HMMA 3OCGA 1GIHA 5E8UA 2R3JA 2VO6A 5AIKA 5J18A 3A7JA 4H3QA 1KOTA 1JKSA 4FSNA 4GW8A 5FM2A 2I0EA 4WG5A 2MWSB 4ITIA 2J7QB 3E63A 3DBHI 4CYJA 1UNHA 4AT4A 2YA9A 4RGJA 3Q6WA 3CTHA 4A3PA 2LVOA 2MW5A 3K2LA 3SDLC 5HO7A 4E74A 3MVMA 3KA0A 5AP5A 3BU6A 4CNHA 1IYFA 3BHUA 3NX8A 1HCKA 3IDPA 2W4JA 2WTDA 3OXTA 3I60A 5LCKA 2MBEA 4OBQA 3R7YA 1SVGA 2QO7A 2KDBA 2Y6MA 4KABA 3P4KA 2EU9A 1ZYLA 1H4LA 2A1AB 4DG3E 3U6IA 2PPHA 2CKOA 3H9DA 4O1OA 1OUYA 2XIZA 4FV9A 5JK3A 3T8MA 3ORIA 4A7CA 2N1VA 1H1PA 4QPAA 3MJWA 4IB5A 2BUJA 1YX5B 3PA3A 2YAKA 4WBBB 4BICA 2HY81 5ANOA 1E8XA 5CU3A 3NUUA 5B2MA 4N9F4 1SM2A 4GT3A 3ORLA 4GU2A 5A6NA 1BMKA 5HNIX 2YABA 3ZC6A 4RLKA 1H26A 3HMIA 5TKDA 1FOTA 2HWOA 2JLDA 2CNVA 4YHJA 4MM3A 4AGWA 2P33A 2UZBA 3LVPA 3AU4A 2Z0DB 4I3ZA 4GCJA 3N3KB 2C3JA 4O0RA 5E8SA 3GU5A 4JR3A 5K9IA 2VWBA 3COMA 4R1VA 2KTFA 2R3LA 5BVFA 4USDA 5H8BA 4U0IA 3E8EA 1OM1A 4L6QA 3ZUUA 4MXYA 3F3WA 2R2OA 1JSVA 2H34A 4LYNA 5EDSA 3ORPA 4KIKB 4CEGA 1J0GA 4CD0A 5BX0A 4W8EA 5HLWA 3I6WA 5EW3A 4IAAA 5IA7A 2YM3A 3BCEA 4FKLA 2YCFA 2X2KA 2VNYA 5BNJA 2AYOB 3KRWA 2WHBA 5DT0A 1MG8A 4GK3A 4PX6A 4BBNC 2UW5A 2QOBA 3FKOA 2LRUA 3CJFA 4I92A 2XCHA 4FV1A 5LXMA 4XRJA 1CKJA 3IONA 2BPSA 3MJ2A 4F1MA 2N9PC 1MRYA 2B55A 3MFTA 4QMQA 3V01A 2O0UA 4DYMA 3PVUA 3KMMA 3OD6X 3AGLA 4O81A 3OW4A 4CFNA 4IJPA 4AG8A 5ETCA 2QONA 3MI9A 1SMHA 4TL0A 5JFVA 5CEOA 2RR9A 4C37A 5LVOA 4J97A 3UQAA 4ASXA 2UW4A 3VUDA 5EKNA 5HG7A 5JHAA 3GU6A 5ANJA 4FTKA 2EMSA 2HJ8A 3PREA 4CO7A 2RPQA 1M2QA 1J19A 3AC2A 4Z16A 4EH9A 2MBHA 2GSFA 4IAZA 1YI6A 4DHJB 1EH4A 3H0ZA 3SD5A 1Y57A 4IB1A 4Y85A 5IQHA 4Z55A 4D28A 2JRIB 4KBKA 2RIOA 4DGGA 5AZGA 3OY3A 4JG6A 3ZKJC 1NW1A 1Z9XA 4G9CA 4ZJVA 5IF1A 4WIHA 2IPXA 2JIUA 1W98A 5HOAA 4NTSA 1FQ1B 1VYZA 5IUIA 4EUTA 1L2NA 1QCFA 3O71A 4FIGA 2P2HA 4R77A 3DKFA 3N4UA 3IG3A 2XNEA 4OUCA 3I5ZA 2PJHA 3BV3A 3QX2A 3D7TA 1GNUA 4W9WA 3HUCA 3R7IA 4GOCA 2OXDA 2DYMA 3EHAA 4WA9A 4ANQA 5FR6A 4CTBA 3KK9A 3UQGA 3R7QA 5AM7A 3R0TA 4LG4A 3UIOB 3RUIB 1PW2A 3PT2B 4DE4A 3DU8A 3IOKA 4J71A 2HXLA 3R1YA 4Y46A 2BF8B 5AAFA 2RFEA 2X7OA 1WM2A 1OL6A 4ALWA 5EHYA 4RFYA 4DG0E 3UO5A 1R3CA 5IAAC 4HNIA 3M62B 5GJFA 4FVQA 1DS5A 4NIFB 4DINA 3RK7A 4FV3A 4P7IA 2C3LA 2ZDTA 3ZXTA 3UE4A 3VF9A 4FGRA 2WTWA 1IP9A 4FKOA 2PVRA 4QYYA 4BWXA 3LKMA 4CHKA 1YIWA 5DHJA 2D3GA 2P0CA 1FINA 3KXZA 3I7BA 3WBLA 2R3IA 4RX9A 5E8VA 3H7PA 4MF0A 4UXQA 2R9SA 3EFWA 3P08A 5C4LA 4JDIA 3F5XA 3QCSA 2FIFA 2Y4IB 4EZ3A 4OTRA 4FG7A 3A99A 3JY9A 4X7QA 3MPAA 3H7PB 4QRCA 1YW2A 4AXAA 5FLFA 5CT0A 4JRVA 3ZOSA 3CSTA 3OBJA 4R78A 3UC3A 3T9LA 3RPRA 1RAXA 3QBNA 2V22A 2ZVAA 4O2PA 2I0YA 3FLSA 1ZYCA 4QYEA 2ITOA 1LEZA 4FTCA 4OAVB 3U87A 5BUEA 4QMZA 4FKUA 1Q3WA 2XK6A 5JH6A 4FTAA 4EQUA 2H6DA 3VBYA 2KDFB 3WIGA 4HPUE 2BYEA 3BPRA 5IG1A 3UTOA 4WOVA 4V01A 3VUGA 1GC6A 4MGKE 3A4OX 4YNOA 1QPJA 3PPKA 1U46A 5EG3A 5BQ0A 3BE2A 4BDCA 4UXLA 4AAAA 3TNPC 1Q5KA 4XC2A 2KX3A 2LI5A 3QQUA 2J7TA 3NIEA 4PS3A 4GFOA 3M95A 3ML9A 1TQPA 4RWJA 3ULZA 4EOQA 2BTRA 1XH7A 3CC6A 4BHNA 4BC6A 3DDPA 3BYOA 3Q2MA 1JLUE 2WX1A 2KO3A 4U97A 2PMLX 3FAAA 3KN6A 1GC7A 4KDIC 2FCQA 1WFCA 4IAYA 2H96A 3BYVA 3HV5A 4YZ9A 3VTUA 3LJ1A 3TCPA 1ZMWA 4C8BA 4G5PA 4BCQA 4G3GA 3PSDA 3T3UA 3BLRA 3KUCB 2X9FA 3SLSA 4YURA 2HK5A 4II5A 3QQLA 4CCUA 3MFRA 3P2BA 5C8MA 4UV0A 1JOWB 4BDHA 1CSNA 2IZUA 4GSBA 5HIDA 3QXPA 5FEDA 5I0BA 2KJ6A 4B6LA 5L6OA 4W9FA 2ACXA 3PP0A 1OKVA 1TBEA 5LMBA 3A8WA 3W18A 3I6UA 4IWOA 4E4MA 3OZ6A 4PL4A 4I93A 3UIPB 4RLLA 3MIYA 5BVNA 2ZCCA 1I09A 1QPEA 1PMVA 5E4HA 3HV6A 2VTNA 3OCSA 2FNJB 4RX8A 4NU1A 4YHTA 4EOLA 3DV3A 5KMLA 5C8KA 2DZIA 2RFSA 1UGMA 1XBCA 4TTHB 4LV8A 4BCMA 2R3KA 4DLIA 2RSVA 2ONLC 3E64A 4S32A 3V8TA 2DZKA 1I44A 3I0OA 3GXLA 4FKQA 1OQYA 5EW9A 4JLCA 2L05A 3M63B 2C6EA 3N4TA 4YJQA 1KE7A 3EFJA 1S9JA 1M2RA 1FMOE 5ETIA 4EKKA 3OXIA 2ZVOA 3B2TA 2P4IA 4NKSA 2NBWB 2OJGA 1R0EA 1J3HA 5LMAA 3NUSA 3GQLA 2KXJA 3R9HA 2AL6A 3SV0A 4DH7A 1WX8A 4ZIMA 4MD7E 5A4LA 3ZLXA 3PA5A 3ZS5A 2PVMA 5M07A 4GEOA 4ASWC 4BWKA 4RFZA 3WAOA 2J50A 4BOSC 3AC1A 2HIWA 4PDOA 4ACDA 5BVOA 3ONSA 1JAMA 3UOLA 4PPAA 1E8WA 3DK3A 3QC9A 4HPTE 5T3QA 4QT1A 4TXCA 3W1SA 2VNWA 3EFKA 4YBKA 1KM7A 3WARA 2OICA 2CLXA 1ATPE 1T0YA 3K9OB 5FQDC 1RW8A 2LVQA 4IC7B 3EYHA 1CKPA 4U40A 3V8SA 3MBLA 3KKVA 1H8CA 2QLUA 3U30A 1GAGA 3CP9A 3K3IA 2C69A 1MP8A 4K1RB 3TV4A 1X8BA 2XK8A 4ZJIA 3K5UA 1RJBA 3FV8A 2DENB 3Q5IA 5ANGA 2JC6A 3FXXA 4ZLOA 5JGBA 1WBTA 3Q53A 5AP4A 3ZRLA 3QAME 3AXWA 3WYXA 1U54A 4B6WA 1JKTA 5DNRA 5ANEA 4N4SA 4M66A 5DIAA 5LLIA 4MH7A 4PTGA 4W8DA 4GG7A 3JSVA 1DAWA 3AD5A 4KSQA 1U54B 3KYDD 4BDJA 1WCCA 5BMMA 3FLNC 4KS7A 4J7BA 3E5AA 4NJ6A 3HV4A 3TV7A 3U54A 3SXFA 3PHWB 1DAYA 1KV2A 3JSVB 4J1RA 3T8OA 2XRWA 5J7HA 3FY2A 2ZNVB 2FUMA 3A9KB 2FB8A 3ACJA 3ORNA 5J2RA 2UZEA 3CKXA 2C6TA 3RPOA 4ORKA 2WMRA 3I0QA 2UW7A 1UNGA 2IO6A 3MN3A 4YJUA 3KCFA 4O7NA 3GOPA 5CU6A 2UYZB 2NNWB 2XRUA 3SG8A 4KNBA 1WJNA 5AR7A 2R3QA 2D11A 1U5RA 3NYOA 3DT1A 4F9CA 3OLMD 1OGUA 4A4XA 1WRDB 5J5SA 1REKA 2GS2A 4YJNA 5KUPA 4BCKA 4BKJA 4Q5HA 4EHZA 2VWWA 4AFEA 3ZSIA 2VO3A 4ZMEA 2C6IA 3ZZWA 2ITUA 4IM2A 2GNHA 3QRTA 4G34A 4ZLYA 4FZ6A 4GKIA 4K9YA 5G6VA 3QF9A 2IN6A 4K33A 1WBOA 4HZSA 2BIKB 4XEYA 2VTHA 3FI2A 3NSZA 3NHEB 4O84A 3LFNA 1C3TA 3KRXA 4MEMA 2WMSA 3ATTA 4AQCA 3NNWA 4CV9A 4U6RA 3ML8A 4K1BA 1FXTB 4QP7A 4XG2A 3F5PA 1XJDA 4I6NB 3WF7A 4AS0A 4FVRA 2XK4A 4USEA 5CZHA 2PVNA 1SZMA 3SG9A 3P23A 2D10A 4ZOGA 3EQIA 2BVAA 3TIYA 2AEHA 4ANWA 4NM7A 3U9CA 2R64A 4PY1A 4DCEA 2VX1A 3TWJA 2JEDA 4UY9A 2XM8A 2Z7SA 3ENHA 5HGIA 1IRKA 3N30A 1ZGUB 4AGUA 1OKYA 3D5UA 3DBCA 1PQSA 4YSMA 4QP8A 3VBXA 1PF8A 5M4UA 4BDAA 5D12A 4KA3A 4C4GA 3B8QA 3V8WA 2K8CA 3ZNID 2BILB 5CHFA 4BZOA 2OO8X 4FBXA 2K6QA 3CCNA 1T45A 5D7GA 3OWLA 2XUUA 5EYCA 3ROCA 4AA0A 1OL7A 2KQ7A 2VTAA 3FL5A 1H8FA 4JAIA 3ZVVA 1WH3A 4AJWA 4GMVA 5EYMA 3V62A 2VAGA 2VTSA 3PLSA 4B8MA 3PSEB 5AJQA 2CDZA 2DUVA 4EYJA 3ZBXA 3LHJA 1AARA 4RIOA 2XVDA 5CSWA 4BFMA 2EUFB 3CJGA 4FYOA 5TR5A 3EZRA 2QKRA 4F7JA 4FSZA 4ITJA 2IO0B 3GFEA 2C7HA 3GCVA 4U5JA 1WJUA 4AW1A 4FBJB 1J7LA 4AZSA 4C35A 5E6PA 3QRIA 3R2YA 4YJTA 4EYMA 5TE0A 4FZAB 1BX6A 2Z8CA 2MP2B 5AV4A 4X57B 3ODYX 4DCAA 4PUZA 3NR9A 3LMHA 4XG3A 5I5ZA 3SXRA 5IDNA 4JG8A 3X23A 5C9CA 3NLBA 4JXFA 4U8ZA 5J5TA 4MKCA 3SHEA 2BRGA 3QKLA 1SVEA 2RSUA 4M0WB 4EC8A 2K8BA 4R7IA 4KSLC 4XMOA 3EQDA 5CQWA 3OOGA 3C0IA 3MV5A 4DGNA 2PVKA 2Y7JA 3BX5A 3TKIA 4ZSJA 3EN5A 3V6RA 3I81A 1KE6A 1KOBA 1JSUA 5DRDA 2BRHA 4BKSD 4NPNA 4P5QA 2BFYA 3FMMA 3Q4ZA 5L4QA 4JBOA 5CTRC 3F9NA 5CF5A 2X8DA 4O21A 2EMTA 3PE2A 2WTKC 4IZ5A 5L8LA 2C0OA 2VTPA 1H1QA 3TL8A 5HCXA 3ZHPC 2VTIA 2VO0A 4DEGA 3NZUA 5BYYA 1E1XA 4AW5A 3ENEA 3PRPB 5KO1A 3BWJA 4DGLC 4A07A 3FHIA 4E4XA 5IA4A 3RVGA 1KE5A 4LGGA 3AU5A 3VAPA 3BBTB 2B1PA 3JUHA 3UNZA 4DFXE 5LVLA 4OTIA 2FCSA 1XD3B 3PSCA 3FY0A 1OB3A 2QURA 2R7BA 1CMKE 4QTDA 3NUAA 3I5NA 4BCIA 4NQKE 3HM3A 3FL4A 3RM6A 3KMWA 4II3B 3BGZA 5J9ZA 2EKEC 4FJZA 3PSBA 3LCDA 4WUNA 4NFMA 4Z9LA 2JVCA 5IMXA 4W4XA 5HE1A 5HG5A 1EUVB 2XYUA 3DBQA 2GQSA 1SVHA 5M06A 4U3ZA 5HKMA 4QMOA 3GENA 3FYKX 4UMUA 2O5KA 4YMJA 2IZTA 5FM3A 4D2SA 3RCJA 4JS8A 5JGDA 4XG4A 3EQPA 3VXWA 1O9UA 3E8NA 4USFA 1G3NA 2A0CX 3OJ4B 2CGXA 3MSSA 4G16A 2HOGA 3ZSGA 4AE6A 4JT3A 4DEDA 2JAVA 4W9GA 2YZLA 2KNBA 4AWIA 4M7IA 3AC8A 5FTGA 4NCTA 4Q2AA 2C68A 5EOBA 2VZ6A 2R3RA 4RMAA 3NVMB 3U7DA 2H9VA 3F5UA 2V1YA 4K11A 1PKGA 2G2HA 2WB8A 4FSUA 3MY1A 5G1XA 4PP7A 2C1AA 5ETFA 4R3RA 3V5JA 4HGLA 3FZOA 4RC2A 5AP3A 3GZNI 4IIRA 3JPVA 3TBLD 3VAWA 3CEKA 4O7YA 2NVUI 2OKRA 3H7SA 3FDNA 4C61A 1XBBA 2R4BA 4JQEA 3F3VA 4W9EA 2Q83A 5E9EA 1Y6BA 3FE3A 2BDJA 5AUWA 4XJ0A 4QNYA 4GUEA 3ZEPA 3R1SA 1MRVA 5L2WA 4A9RA 3CKWA 2R3OA 4FK3A 5AMNA 4A06A 3ORZA 5FBOA 3UIMA 3IECA 4C3PA 3CIKA 5A14A 2GTMA 1Q8UA 2ASQA 3PVBA 3C50A 3UPZA 5A4QA 2C5VA 2Z7QA 5K4IA 5IKWA 3B1LX 4E6DA 4EOSA 2VTMA 3AD6A 3CY3A 4O27B 4RQVA 2J5EA 3COHA 4ZY5A 4IWPA 1V5OA 2V5QA 4AUAA 4S34A 3O50A 2W9FB 4IB3A 3EOCA 3RD2A 3REPA 3UMWA 3PJCA 3CD8A 3BU3A 2C6OA 5M56A 5I9UA 3KVFB 2PZRA 4QMVA 4C0TA 3MY0A 4HPMB 4YU2A 5E8ZA 2RGPA 2KDIA 1TVOA 3W1SC 3KF7A 4HGSA 1NVQA 4H39A 4PDPA 5KMNA 2EXCX 4F65A 2R7IA 3UNJA 1RDQE 1P14A 4CTCA 3UOJA 1V2YA 3KVXA 2NRUA 2KKCA 3VRZA 4MXAA 5A6OA 3DKCA 3MVHA 4KBAA 4FA2A 5JFSA 2WMTA 1DI9A 3KULB 1B6CB 5AV3A 3V5PA 4RC3A 5GIPE 5HE2A 4EK3A 3KRRA 3FQEA 4PMTA 4BIDA 4QMUA 4GT5A 3P7AA 2LXCA 3ZEWA 3NNVA 4DHZB 4GSWA 1OL2A 1PYEA 3DJ5A 3CR0A 1Q97A 4RMZA 3G15A 2J0IA 2W1IA 2VWVA 5HX6A 3UNKA 4JDJA 3VS1A 1V9JA 5L83A 4ZTSA 1XQZA 1WI0A 2GQRA 4HPLB 2BALA 4R5SA 1BKXA 4IXPA 4YLJA 2ITNA 5M53A 1M17A 4BHZA 2XNMA 4IX6A 2ZNVC 1ZOEA 3KW5B 3KYCD 4GYIA 4BCHA 3I3TB 4LFIA 4WRSA 2C0IA 5LWMA 3HRBA 5DE2A 5AR4A 3VS2A 3OP5A 3VS3A 1WY8A 4AP4C 2XKDA 5A4CA 1YOLA 4RM9A 4TYGA 2IO3B 4F9YA 3TMPB 4UX9A 4D2TA 1HE8A 4BVUC 2MX2A 4CV8A 3DTWA 3ZZEA 4C2WA 2HAKA 2YWPA 4GIHA 4UN0C 2PVYA 3EQGA 4EOOA 2NPTB 2WMBA 4NNJB 2C6KA 4Z7GA 5E8TA 4PV0A 2QC6A 3Q9WA 5D11A 1WXAA 2WYQA 4F7LA 2NP8A 2F7EE 3GU7A 4MGYE 4EOIA 4D0WA 3V61A 3H30A 1M2PA 3LM5A 1OMWA 4PYUA 2VV9A 5C23A 5M51A 1L3RE 2WTJA 3UVQA 3LXKA 4ITHA 4YPSA 2WIHA 3PY1A 3QLFA 5HIBA 2XA4A 3ANQA 4XLIA 3RTPA 4ERWA 5HO6A 2SRCA 4I0SA 5DPVA 4UMRA 1ZYJA 3C4CA 1TQIA 4BI1A 3QFVA 5CF4A 3RPSA 1I35A 2X8IA 1VCBA 3LJ0A 3VS6A 5HVKA 3IVFA 3PXYA 4BBEA 4XYFA 3BHYA 3T9TA 2B0QA 4FSQA 3A33B 4FIFA 1WR6E 3DB6A 3DNEA 2BAKA 5HORA 4R7BA 1O6LA 4ERKA 3ZTXA 4M13A 2D2QA 3K3JA 3UP7A 2G45B 2C6LA 2W5AA 4M0YA 4FL3A 4FT3A 4GMYA 1WBNA 2R3HA 4OGRA 4UWYA 5AV1A 4FA6A 3OF0A 2FVDA 5ACBC 2XK5A 4G3XB 1GY3A 1BT0A 3NRMA 4IVCA 4QOXA 2UVXA 3NUNA 4JVGA 2YZAA 2XB7A 3PJ2A 4ALVA 3G51A 5JZNA 1WYWB 5BVEA 5HU3A 3VUYA 3SAYA 2EXEA 4NY0A 3ATSA 3W1YA 2VUWA 3ZRCA 2MRPA 4HZRA 3E7OA 3KXMA 3ZRFA 2A5UA 4C57A 1WZ3A 3G6HA 4TYEA 2GPHA 4IANA 3F66A 1D3ZA 3C7QA 2CNQA 1JBPE 4MXXA 5HCYA 4D1ZA 4G6NA 3BHVA 4UMQA 3QIJA 5L6PA 2J0MB 2F4JA 2JFMA 4NL0A 3QZGA 3O8TA 5M4IA 4RIWB 2HELA 2Z59B 5FWKK 3THBA 3PV1A 3TDWA 4ZSAA 4H36A 3UOKA 1YHWA 5K4JA 2PTKA 4EH4A 3ACKA 3CXWA 4JIAA 3I7CA 4QPSA 2R0UA 3NCGA 5B7VA 4EOYA 1OITA 5J9LA 2XNBA 4M15A 2BHHA 3UZTA 5JH5C 4XV3A 4BWPA 3HUBA 2J0KA 1VR2A 2EVAA 4EONA 5I4NA 4XRLA 4EI4A 3QUDA 3D4QA 3VS7A 3LW0A 4TYHB 5TO8A 4YJSA 4A9TA 3VVHA 2HZNA 3VUMA 3APFA 4V05A 3R1NA 3WANA 5HG9A 3FI8A 3HAMA 4N70A 2IVUA 5E91A 4R5YA 3LAUA 3R21A 3G9NA 2R0IA 4MF1A 2W4KA 4JQ8A 4EJ7A 1ZRZA 3CQEA 4E4LA 4IHPA 5HZNA 2RL5A 2OIQA 4P2KA 3FMJA 4O91A 3ULIA
chains in the Genus database with same CATH superfamily
3PTGA 3DXQA 3ZH8A 4MH0E 1KWPA 1ZXEA 1CJEA 1Y2OA 2Y0AA 3P78A 5IH6A 4BDKA 3ZW3A 1Q1OA 1YJIA 2KWCA 4AZWA 3FUPA 3PLTA 5EM7A 4I41A 3WIKA 3FI4A 1H08A 2XEYA 4FUXA 3DOGA 3EL8A 4Q9ZA 2R2PA 3ORXA 1OIYA 4BRXA 5ANKA 4EJNA 3MVJA 4B8LA 4C36A 4YC6A 4P7EA 2YLLA 3ZXZA 3BQRA 1F2RC 3CD3A 3VS5A 1XMLA 1SUFA 1FXAA 4ZZMA 3WE8A 4GT4A 2WU7A 2F7XE 2GNGA 2KWUB 4RIXA 4DCNC 4O0YA 4L01A 4X21A 3P42A 4XOYA 4FNZA 3ZLWA 2EKIA 5CQUA 4FTMA 3DJ6A 5EDQA 3A4SC 3EECA 1PS3A 1P2AA 2KFKB 5LMKA 1F52A 2KVRA 2IG7A 4QNAA 4QMXA 4APPA 3KCKA 2ZW1A 2JT4B 4L42A 3V5QA 3NVZA 4DFUA 2BGFA 2VRRB 3IDCA 2JKQA 3ZNGC 2EELA 2C30A 5CI7A 4K0YA 2ICIA 1WM3A 3A9JB 4QDEA 2OXYA 3Q8AA 4HJKA 4U41A 3MHZA 3CVRA 1YHSA 3GU8A 4C2VA 3MH0A 4MDKE 3PLVA 4N6ZA 3R28A 1WJ4A 3RV1A 3ZUTA 4DHZE 5G55A 3UG1A 3TEZA 1TQWA 3A4PA 3POOA 3E8CA 3HECA 3D5XA 2XARA 4PPCA 2OZAA 2VTTA 4WQOB 1ZW7A 3MH3A 3D51A 3KVWA 1WF9A 1R1WA 2REXA 4ID7A 2ZV2A 4F70A 4J96A 4FV2A 2WXGA 1FVTA 5H8EA 3LCTA 4DHIB 4DGOA 5FEQA 3B2GA 4KS8A 2OIDA 3PJ8A 4OVVA 3U8ZA 2NPQA 4I0RA 2DZJA 4L67A 3G2FA 4AT3A 4RBLA 1YI4A 1N60A 3OROA 4QQCA 2BVCA 2P55A 3R83A 1GZ8A 3GT8A 2INDC 4NCTC 3DX3A 3NZ0A 3V51A 4BBMA 4MJSB 4BNEA 3A1QA 1N5XA 3TL5A 5JT2A 1SIFA 4BZAA 4B7TA 2BDFA 4UZDA 3ORMA 3DK6A 4CYIA 1BLXA 3ZDMC 4RJ7A 4FULA 2J5FA 4BIBA 2O6VA 4I22A 2RGFA 3EJSA 1UU3A 1PKDA 2ERKA 4XUFA 4DF3A 5DWRA 4P5ZA 5BUIA 2XIKA 3HUIA 4YL8A 3A2CA 1WR1A 4D5KA 3TN8A 3L9NA 3JS2A 4JIOU 4KV2A 3WZDA 3W2QA 4F00A 4E3CA 4AXCA 3NWWA 2E9VA 3ERCC 3KN5A 5EOLA 3C0GA 1DGJA 1Y8YA 2L3ZA 5KMKA 4I0TA 4X3JA 3VUHA 4FXCA 3LLTA 1PMNA 3NS8A 5GIOE 4ZEGA 3JR1A 4C33A 4I6FA 1PXMA 1HXYD 3AH7A 4BYJA 2PVLA 2ELBA 3W2SA 4CXAA 2YDKA 4OZCA 2KJRA 3Q3FA 1T0RC 1YWNA 5BYLA 3KWVA 3UVRA 4DTKA 3AC5A 4NUSA 3HP2A 5KBQA 2AEGA 4IFCA 4QTAA 3VNTA 4NAWB 2MEKA 4GIVA 4O7RA 4HW7A 3SA0A 3DB8A 3R7VA 1WVYA 2V55A 4WAAA 2Z7RA 3F7ZA 2C7MB 4FV7A 4LNFA 1YQ3B 4IUMB 1NEKB 2W0JA 5AP1A 1TZDA 4U9AA 3RN9C 3PIZA 1OIQA 4MWHA 3NUXA 3AC3A 3AMYA 3RI7C 3RAKA 1J7UA 2KTYA 4UALA 3CS9A 3UVPA 2C1BA 5G5HA 4GGQA 4ZS4A 2PZYA 3MP9A 4WPEA 3FSKA 1NA7A 4FYNA 1RQQA 2A4LA 3DWMA 4P16A 1PXOA 2ITXA 2YDIA 3JYUA 1GJZA 4QMYA 1I4QA 2FCMA 1W84A 3QKKA 2CN8A 4EEVA 1EU3A 5F94A 5HE3A 3S1HA 1M4VA 5AV2A 2DX5B 3QQFA 3ALOA 3VBWA 2UW6A 1H1RA 4RWLA 4ZRIA 4EH5A 4ENXA 3HYHA 2QO9A 5EQEA 2QHOA 4P6VF 5HFYA 3GBZA 3Q6UA 2WMAA 1ZE3D 4M8NA 5M4FA 3DZOA 2YKTA 3MPTA 2LGDA 1V6EA 3QALE 4YSYB 3OOMA 4N0SA 2M0XA 5LVPA 4KSPA 3DHHC 2PE1A 4KD1A 4GDLA 2CHZA 4PNKA 1PXPA 2Z60A 2XIYA 5CU0A 1PXJA 4BR3A 4EBVA 5FTOA 2HZ4A 4JGHB 3PLUA 2YAAA 2NBUA 3HVDA 2YM4A 4XP0A 3D2FA 2W06A 5HI1A 3IKAA 4XG9A 2YLFA 3FBVA 3D52A 5HVJA 4FG8A 1ZPSA 5AR8A 4YTMB 1CTPE 3DCVA 4D4SA 2WO6A 5CYIA 4A9YA 5JHBA 4DFBA 3NY5A 3VS4A 3PWYA 3OT3A 4JQ7A 1TKYA 2L00B 4EQCA 4GV1A 4O0XA 3WZJA 4EC9A 4AZHA 3BYYB 2ZDUA 3QC8B 5FK9C 4BL1A 1R39A 4TMAB 3DKGA 2VWXA 4ZK5A 2FSTX 2C6DA 2W3SA 2PPQA 2QSDA 4MXZA 3EN6A 4CRSA 4K77A 3OG7A 4LUDA 1QILA 4JWUC 3FAHA 4DQOC 3MA6A 2XJ2A 3WF5A 3QYWA 4YUQA 2PMOX 3CSVA 1XCTL 4NW6A 2NR2A 2W1EA 4OAUC 4LDTD 1H0WA 1SF0A 2FSLX 4LI5A 4X2GA 3ZYYX 3AB5A 1JPAA 5HCZA 2JDTA 3NCZA 4ZTNA 4O22A 4X3FA 2LEKA 4ZTRA 4MNEB 5AZHA 2ONLA 2QOHA 2YIAA 3TACA 1B39A 3AT2A 2V7OA 5A3XA 2B9IA 2O63A 4W9DA 5AP0A 3HAJA 2HENA 3W10A 3ZDTA 5AUTA 4X3FB 3C0RB 3WF9A 3P86A 2BRNA 1OBDA 1JSTA 4BCJA 2I2YA 5LCJA 3SFEB 5HIEA 3ID6C 3BVVA 4CMOA 2B52A 5KMIA 2B7AA 3VJOA 4TPTA 5EI8A 4AN2A 3P4QB 4I6LB 4E5BA 2RFNA 3IW7A 3H0YA 3JVZX 1YDSE 2BB5A 3DNDA 3QD3A 3W1FA 2C3IB 5HLNA 4DN5A 3RK9A 4LCDE 1FGKA 1TKGA 3GC7A 3ER8C 3Q2JA 2I0HA 2IW8A 2IDYA 4NSTA 3ZMMA 2FICA 3WAMA 4HY9A 2BCJA 1H1WA 4E8AA 1XXGA 3BVUA 3VTWA 3HAIA 2G3QB 2JF5A 2GAFD 1Z57A 2L83A 2XJ1A 2UW0A 1E7PB 4CQNA 2KT7A 4RSSA 3HKOA 3BUPA 5ANIA 2PHKA 4O6LA 3TV6A 4E7WA 4KKHA 2Y4PA 3OBGA 4FN2A 3QTZA 3Q04A 4W4YA 3IO7A 4Y8DA 5FXQA 2RG5A 5B2LA 3EL7A 4FLHA 4Y73A 1P4FA 3AC4A 2I6LA 4G2FA 4BKZA 4EOPA 2ZJWA 4FTRA 1VJYA 3PZEA 1ET6A 4GJ2A 3LYYA 4GRBA 3PS6A 4QTEA 2AYPA 2UZDA 4KRDA 1V0BA 4F99A 4Q2JA 5BMSA 4HROA 2YIBA 2LGYA 1V80A 1YWMA 3NG0A 1AQ1A 4L53A 1ZLTA 4FG9A 4HJOA 3KUDB 1LO5D 1GZKA 2L1AA 2YLEA 3AEFB 1Q5WB 4C34A 3DS6A 4DYLA 1XLOA 4GXBA 3HGKA 3QC4A 3UP2A 1H0VA 4I94A 4MD9E 3LMFA 1R34A 3LCSA 4TWPA 3ETAA 3UDZA 1BI8A 5AUVA 1FCCC 2Z0EB 3KGAA 2GFSA 2WOUA 4DLJA 2MQJA 4J8NA 3FI3A 3BLBA 1TQTA 3TUDA 4UEUA 3PPZA 3F6XA 3LFFA 3BK1A 4XG6A 3NGAA 3VR8B 4I5MA 3Q2AC 4OTPA 1DKXA 1J91A 5HE0A 5KKRB 5IEXA 2JWUA 2ON8A 2WXMA 4CKRA 2KJHB 3JYAA 4EL9A 4FKIA 4N59A 3JVSA 2G4DB 5DLSA 4YZDA 4ZRKA 1UZXB 3DQXA 2KFJA 3GQIA 1K2PA 4ZRJA 2QCSA 2WDRB 5HU9A 3PRFA 2WQBA 4H58A 2ITTA 4I6HA 3EQCA 2MHJA 3NW7A 2X8XX 5BPYA 3COKA 2CHWA 4LJPB 4Y83A 4W9XA 2BPMA 3DVNV 1V0PA 3TJPA 4ONAA 3NAXA 2HYYA 3E92A 3VN9A 2GNLA 5FDXA 3PVWA 2WPAA 5ETAA 3WALA 4S0RA 2OW3A 1LQBA 4BN1A 1ZOHA 3GEQA 4KIKA 3FMKA 5KHXA 3IW8A 1M94A 1QPDA 4BCOA 1UU9A 5FTQA 3QTXA 3SC1A 1OQRA 3EJRA 1MQBA 4YZMA 1URWA 3UGCA 5I3RA 4QD6A 3EWHA 2J6MA 2G1TA 3OHXM 1F5QA 3SX9A 4K7UA 1E7VA 2J51A 5I9ZA 1UKHA 2GOWA 1UKIA 1CKIA 2ZMDA 2ZXQA 4WIPA 2LJ5A 3D32A 5IUGA 1XHAA 3BVTA 3KLSX 2X1NA 4RJ8A 5AEPA 1FRRA 1SNXA 2J2IB 3CV5A 3HAVA 4DDIA 5HBHA 4U7ZA 2JY6A 1EWYC 1YJ1A 2XJ0A 3OCBA 5KZ0A 1TQMA 1ZUD2 3LJ3A 4D2WA 3TIZA 4F9AA 1LXDA 2DZMA 3PHXB 3DX2A 2XNOA 2GBMA 3KUZA 3VHTC 4H1MA 3ZXRA 3QLGA 1ERKA 3A62A 1ZMVA 3ZDUA 3QQ8B 4EZJA 2IBIB 2WXVA 5FRIA 4M8MA 4LMNA 4FZDB 3D2EA 1KTKA 2I7QA 3NFGB 4WNOA 1W8CA 4Y95A 3PRMB 2ZVNA 1H1SA 3ZNZB 2XMYA 3BIZA 2XNGA 2FE8A 4N6EB 1MI0A 4YR8A 2OOBB 2JIVA 2XKCA 3EUB2 5GMVA 3B08A 2K3UA 4OTHA 4UWCA 5FG8A 4L00A 2FCNA 3IDBA 5IA2A 5EE1A 2MSED 4YJOA 5H3QA 1WE7A 1ZZ2A 2UW9A 4I4EA 3ZTCA 3MTFA 4YO4A 3N1XC 3O65B 3KIOC 2IVVA 3EQHA 1DOXA 2R3MA 5KMOA 5BVWA 1UNLA 4IQ6A 3IAM1 1R4MB 4DXGA 3TDVA 3OWPA 1QPCA 4FV6A 4EZNA 2OBJA 3FMNA 4ANOA 1FFVA 2XBBC 4RG0A 4J52A 5LMKC 1PMUA 3MS9A 4GFGA 2GMIC 3MTLA 5I9WA 3VKHA 3KEXA 3OMVA 4EH2A 1TS5A 4HEA1 2DYBA 3I4BA 4CSVA 3QQGA 4LUEA 4Z3VA 3NZSA 2CGUA 4XDDA 3P63A 1NT2A 5JFWA 4DEAA 5JEBA 3P4PB 2VWZA 4M3QA 4TQ1A 3K5VA 1OIRA 4GJ3A 5AUYA 2V3SA 2ITZA 3ZQ4A 5M44A 2L8JA 5AR3A 3R00A 3ZFMA 4I6QA 2OJRA 2CJMA 2DS1A 4K6ZA 2PL0A 2ACZB 3LLAA 2GCDA 3R71A 3IGGA 5TSSA 1R78A 5TR6A 3BQCA 4I4FA 2F7RA 1SU6A 4EH3A 3P9JA 1VZ8A 3T9IA 5FBNC 2PUNA 2YIXA 2NBVB 2UZUE 3GOEA 5DN3A 5EQYA 5LNK1 3O7LB 4H3PA 3F5GA 4LMUA 2ZZPB 1FXIA 4HCTA 4YTHA 3Q6BA 5G5GA 3MWUA 4FZ7A 2N0SB 3GU4A 5EHOA 1P98A 2UW8A 4O7LA 5M4CA 4G9RA 3VRYA 4CFMA 3Q84A 2PVHA 2BTEA 4F7NA 4EZRA 3OEFX 3EJUA 5IUHA 4FE2A 1Y6AA 4I6PA 4PMPA 3SRVB 2K9XA 2UW3A 2CGVA 3EQFA 4F0FA 2PWLA 3RM7A 2C3KA 4IH8A 2J0LA 3PXZA 1IA8A 1Q8YA 1WJ6A 3KRJA 5AZFA 1OGYA 3DY7A 3E62A 2Z2WA 4EK5A 3PIYA 4NIFA 3R63A 2INCC 2PZPA 1P0RA 4UYAA 5DYJA 5H9BA 5AAGA 2FBWB 4YWGG 2ZW0A 3ZUNA 2XK7A 2E2BA 4QP9A 3RULA 4ZLZA 1GNLA 3MC9A 3VFKA 5JZJA 4KKGA 3PJ3A 5AP2A 2FYSA 4BZNA 2JUOA 3BUQA 5A4TA 2A4ZA 1ZY5A 4HKZE 5LXIB 2ZB1A 4QMPA 3FSFA 2WNMA 1YXSA 3FJQE 1ZMUA 4W9HA 3QWJA 2LUEA 4L23A 5AAEA 4FTOA 3RNIA 4HDQA 4Z7HA 4DXFA 4FL2A 5E8XA 1PXNA 4FV5A 3MDYA 4US9A 3PFYA 1Q24A 4WSQA 5A46A 1SE2A 3TUBA 3Q4UA 3Q9XA 1FVRA 4C4HA 3IK3A 3A7IA 3TCAA 3TI1A 4WAFA 1MJGA 4EH6A 4QP1A 1Q4LA 3ZO4A 4HVHA 4G17A 4NSWA 1ZOGA 4S33A 1QT9A 3C4ZA 3TSSA 3VF8A 3BLHA 4E1ZA 4YTCA 2DHZA 4UYNA 2UVYA 4ZYNA 1PXLA 3UIXA 2V3PA 4DA5A 1VYWA 4L46A 1O6KA 5DPTA 3GC8A 4O0TA 2CU1A 4LDTB 4ZTMA 4F08A 1ZOYB 3GOKA 1WGRA 4RA5A 3VQUA 1FEHA 4YTIA 3TNQB 2AL3A 2J4XA 2FA2A 2RMMA 2LASA 1OVEA 5CEPA 3PXQA 3D15A 4AP7A 4DGMA 4DAWA 4K3BA 3CMMB 4MVFA 1WMHB 2OWBA 2BZHB 5E6OA 2WMQA 4O7ZA 2NRYA 3C19A 1A48A 3U6HA 3UINB 2YJRA 5BUJA 4BDFA 3F2NA 3BY4B 2WHIA 1PRYA 1WXQA 4FIHA 5E84A 2R5TA 4MTAA 5HO8A 3C4FA 3FD9A 1NI2A 2ITQA 3PG1A 3NVYA 3I04A 3URYA 3R9NA 2WU2B 2MBBB 1EF1A 4W4WA 1RFAA 2W1DA 2JAMA 1T46A 4DG2E 4DT9A 4GYGA 3QA8A 3BELA 2YL5A 3IS5A 4M68A 3L3PA 4JJRA 2HZIA 5DPSA 3VC4A 5EHLA 2UVZA 4IJ9A 4HVBA 2ETRA 4AZTA 5TF9A 3RHKA 4MYGA 3EKNA 2BYVE 1W9MA 4UWBA 4G6OA 3R8UA 2WXFA 5CY3A 4BAXA 4YSZB 2QODA 5LJJA 3TZ8A 4P1BC 4LOPA 3IHPC 2CKEA 4AZ5A 1WGGA 1URUA 3I1AA 3DVNU 3QQJA 5CAUA 3EYGA 1G8JA 4AWJA