4IM3A

Structure of tank-binding kinase 1
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
659
structure length
605
Chain Sequence
GSMQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNRPVDVQMREFEVLKKLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGMNHLRENGIVHRNIKPGNIMRVIGEDGQSVYKLTDFGATVDLWSIGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITGKPSGAISGVQKAENGPIDWSGDMPVSCSLSRGLQVLLTPVLANILEADQEKCWGFDQFFAETSDILHRMVIHVFSLQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQELIYEGRRLVLEPGRLAQHFPKTTEENPIFVVSREPLNTIGLIYEKISLPKVHPRYDLDGDASMAKAITGVVCYACRIASTLLLYQELMRKGIRWLIELIKDDYNETVHKKTEVVITLDFCIRNIEKTVKVAAELGEISDIHTKLLRLSSSQGTIETSLQDIDSRLSPGGSLADAWAHQEGTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLAYNEEQIHKFDKQKLYYHATKAMTHFTDECVKKYEAFLNKSEEWIRKMLHLRKQLLSLTNQCFDIEEEVSKYQEYTNELQET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Tank-Binding Kinase 1
rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase TBK1
total genus 194
structure length 605
sequence length 659
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-01-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF18394 TBK1_CCD1 TANK-binding kinase 1 coiled-coil domain 1
A PF18396 TBK1_ULD TANK binding kinase 1 ubiquitin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4im3A02
1.20.1270.420 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4im3A04
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4im3A03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4im3A01
3E8NA 4O38A 4TNBA 1H24A 2WHBA 4BCKA 4YLKA 4GK4A 3WE4A 3RPOA 5ANIA 3BHUA 1J3HA 4FTUA 4IB3A 3R7EA 4R7BA 3W10A 4BL1A 5BUIA 3ZO3A 5L2TA 1E8XA 5CSXA 4D2RA 2KDFB 4A3OA 2GFCA 4AAAA 4EZ3A 4ZMEA 5IA3A 1PXLA 2PTKA 4QYYA 1CMKE 5EW8A 1IEPA 2C6EA 3MSSA 2XA4A 1PMEA 2J51A 2R3HA 4V04A 4DEGA 5J5SA 3EQGA 2BKFA 5BNJA 5HORA 4MF1A 2Z59B 3EECA 4G11A 2YDIA 2EB3A 2UZVA 2QR7A 1XH7A 3ZO1A 4P7IA 5FR6A 3QC9A 4D2TA 4DHZE 4EK8A 3NLBA 2XM8A 5FRIA 3EN9A 4FTNA 2PU8A 3C1XA 1U5RA 3RK5A 4LJOB 2R7IA 3Q5IA 3U55A 3C4EA 5D9HA 5D12A 3RNIA 1Y8GA 3VBWA 1FQ1B 2QKRA 3NDMA 4PUZA 4Q9ZA 3MWUA 2AL6A 1L2NA 3O71A 3SKCA 2JDRA 2Z7QA 3QTZA 3SV0A 4GG7A 4WJPA 1ZRZA 3B0AA 2YHVA 3DJ6A 2BKRB 4WD5A 3U8WA 2KHWB 3RPSA 4ANNA 4Z9LA 2I0EA 1Q3DA 2G45B 2O2VA 3FMDA 5AX9A 4IX6A 3VTUA 3FXZA 4IAIA 2RKUA 2CGWA 1RLFA 2PULA 4PDYA 2SRCA 2C69A 3JXWA 3ORZA 2WPAA 4AGCA 3C0RB 1TZ1A 4X3JA 3MYGA 3M1SA 4NAWA 4DF3A 1V0PA 2ZJDA 1PY5A 2M4NA 2VO0A 3FL5A 3ZEPA 4DBXA 4AW0A 4KDIC 1A9UA 5HBHA 3GOKA 2KMAA 2WNTA 2WEIA 3LIJA 4A4LA 4IWOA 5L3AA 5BUEA 4E4LA 2J0MA 5BO4B 2WMAA 2YABA 4DH8A 3ACJA 4HPTE 4UMQA 5F94A 4AW2A 4DITA 1UD7A 2VTNA 3EZRA 3VUIA 2YDJA 5IDPA 5KMNA 4GFOA 2C47A 4WG5A 2KC1A 4MF0A 3WIGA 4I5PA 2DZIA 4JX3A 4OAVB 3FMJA 5IA1A 2PVKA 2LVPA 1OVEA 3FXWA 2PJHA 3EQRA 3FUPA 4IAFA 5C8MA 1CMXB 2O3PA 4YSMA 5AEPA 1WBWA 5JQ5A 3TIXA 1IA9A 4BOZB 4B99A 3SD0A 4OTWA 3OJ4B 2GBNA 3IW7A 3BBTB 1R4MI 1X1MA 4L52A 2W5BA 3EQBA 1FBNA 2UZWE 4RG0A 4A4XA 3BRBA 3VW8A 4ITIA 2CNVA 3DGKA 1YKRA 5ACBC 2BVAA 1Q5KA 2XNNA 4BBNF 4KIPA 4W8EA 4YHTA 1FINA 3VF9A 5C1QB 5HNBA 2XBJA 3GOPA 1ZYCA 2CDZA 4FTTA 2CKHB 4BTJA 3O96A 4W9WA 3HAVA 4XBUA 2VZ6A 4ZSJA 1WX8A 4DN5A 1OL2A 2UW5A 4JVGA 2YCQA 2B54A 4GU9A 4IBMA 4D0WA 4OAUC 4RVMA 4TYHB 2LGXA 5DYJA 4N0SA 2C68A 2Y9QA 3A61A 4EQCA 3EC8A 4BCMA 5C27A 2ITUA 3KVXA 2N9PC 2WIHA 3GBZA 3ZO2A 4ANBA 4U79A 3KY2A 1W0XC 4X0MA 1UELA 4BKTA 3VRYA 1JWHA 1TQMA 3UPXA 3F61A 3UO6A 3R9OA 2FCMA 4L3LA 3C5IA 2BIKB 5KE0A 5HTBA 5DWRA 4BDIA 3SW7A 3AU4A 3DY7A 3F3UA 1DAYA 4RIWA 2QCSA 5CVGA 4NEUA 1NI2A 4AGWA 5IMEA 4ANWA 4FIFA 5I9XA 4FT0A 3LM5A 4RX7A 3ZMMA 2XIKA 1K3AA 4AACA 1TGZB 5E6OA 3O8UA 3QALE 3BHVA 1OL5A 2QONA 1CDKA 4YO6A 2FCNA 4FTCA 3RINA 3VQIA 2W4KA 5CQWA 2NO3A 1P0RA 2BILB 2P33A 4FSQA 1OKVA 4UEUA 2FB8A 3RPVA 4CFMA 3UIOB 1UZXB 5IDNA 1PYXA 5J9ZA 4GV1A 3GC0A 4KD1A 4XX9A 5HBJA 3HMOA 5HLWA 4W9IA 4CMOA 5M08A 4C02A 1KE8A 3PV1A 4QNAA 3SGCA 3KYDD 4O1OA 3NZ0A 1Y6BA 3RAWA 4IC7B 4UB7A 3EHVA 3W32A 3PLVA 5CYIA 5AR3A 2PUNA 3HRFA 3HP5A 4X6RA 5AR8A 2WEVA 5CF5A 4S2ZA 4EEWA 2UW0A 2PMNX 2C7MB 5EHOA 4FE2A 2VTAA 1ZY5A 3EH9A 3LJ2A 4FV5A 4GVJA 4FL1A 4YBKA 3Q5ZA 3Q4ZA 5EW3A 3UC3A 4EC9A 3UQFA 3POZA 3NY5A 4E6DA 5TKDA 4JIOU 4O84A 4NJ6A 4XV2A 1WJ6A 1PYEA 4E6AA 2JXXA 4DG2E 2XNGA 3JYAA 3QJZA 3ULIA 3NUUA 5HKHA 4G6NA 5BVKA 2KDEB 2KMCA 2KTFA 2H34A 4MX9A 4QTBA 3DBQA 4C57A 4G5JA 4LUEA 4C34A 3IW5A 4ZJJA 3RAHA 2JIIA 3ZBXA 1XKKA 1WH3A 1GIIA 2RGPA 4C35A 3K9OB 1P98A 3ZCLA 2X8IA 3RBWA 3ORMA 4KS8A 2XKCA 2JZ3B 3R9HA 3H1UA 4DLJA 2X1NA 4IDTA 3BYOA 4DH3A 4WOVA 4BKSD 1MP8A 4PY1A 4RIOA 4DEEA 5EM7A 4B0GA 3SXRA 2HY0A 3TZ8A 4CCBA 2UWQA 4E4MA 4RM9A 4H58A 5ICPA 5BVDA 2J9MA 2R7BA 3DZQA 3ZSGA 2L00B 3UF8A 3EIDA 3Q96A 3ZRLA 3FBVA 5J87A 2FO0A 2W1CA 4YJSA 3TL8A 4ERKA 4ZJVA 5CASA 1Z5MA 3ORPA 4EHEA 2HXQA 3NAXA 4PDSA 3R7QA 1Q8YA 5LVPA 3KMWA 5AP7A 2ZZPB 4WJNA 2XB7A 4MBJA 2JIUA 3D14A 5LXIB 3OEFX 4M84A 3S1HA 4LI5A 3LXNA 3RK9A 2LVQA 4JQ8A 1WX9A 3PREA 3MVLA 3BI6A 3A4OX 3P4KA 4EOOA 4BY9E 4BDBA 2VWBA 4XC2A 4FT3A 4GDKB 2YA9A 1CKIA 3OXTA 5JZEB 4OTQA 3THBA 5EYMA 3ID6C 3QTWA 1KE6A 3IG7A 2WMTA 3EQCA 3W2OA 2FAZA 3VUWA 3L8VA 3SRVB 3T3UA 2EMSA 5CLPA 5EI6A 4ANXA 2BFYA 2G2FA 3F3WA 3N4UA 4EC8A 1M14A 3AMYA 4O6LA 1V80A 2FCQA 3U54A 1NT2A 5I9UA 3WF6A 1GJZA 1H1PA 5EKNA 2BZJA 4H39A 1UU8A 5CSWA 5CAQA 4HWIB 3P86A 3VS3A 4AFEA 4CTBA 3FI8A 4XV9A 2JBOA 4IZYA 2C5XA 3ZXTA 4ITHA 1LM8B 3DBRI 3VULA 4CMTA 2UZUE 3FQEA 3B08A 2IBIB 3HHMA 5CWZA 4EH4A 2KNBA 3CQEA 4LDTD 2KN5A 3I6WA 2NPTA 2QO9A 2WTDA 1ZZ2A 4LG4A 2QHOA 5EDRA 5HD7A 3O7LB 5TF9A 3BGPA 1YIWA 3IK3A 4MXZA 1U46A 3KVFB 5C01A 1WX7A 1I44A 1WMKA 3LCDA 4KRDA 4AOIA 1ZKHA 3KW5B 2NP8A 4OBOA 4IZAA 4FTOA 3OOGA 2YIYA 4MXYA 1WFYA 3K3IA 1UNGA 1WBVA 3FZOA 3PP1A 4NZWB 3OJ3A 3KXGA 3OTUA 2ZM3A 2XF0A 5H9BA 1YWNA 3NNUA 3OW3A 3M42A 5AUYA 3PHWB 5L83A 4MD9E 2VTQA 4QYFA 1WJNA 2WFYA 4O7ZA 2A5UA 4IE9A 4FLHA 3L9NA 4AJYB 5GINE 4I23A 4JRVA 3TG1A 4TKSA 3RCJA 3ALOA 3ZLZA 2JVCA 4PMTA 1WGYA 3CC6A 2X6EA 3UZTA 1TQIA 3E3BX 5KKRB 2ZVOA 5FP5A 4EZKA 3QHWA 5DT3A 2QHNA 4CZUA 5EQYA 1A06A 1YXSA 1PKGA 3PRPB 5DPTA 2OI4X 4PWNA 2C3IB 1E7UA 3KFAA 5FEDA 2D07B 4XV1A 4RWIA 1XH6A 2XK6A 3D5UA 3Q04A 3DK7A 1D3ZA 4NYEA 5B2LA 2GSFA 5J18A 2PYWA 3ZC5A 3FC1X 5LXMA 5FM2A 4ZRIA 1J1CA 4F65A 4FF8A 2RR9A 3BU6A 3HECA 4A9SA 3NWWA 3KXZA 3N9XA 4DGGA 3RCZA 4E93A 3V6CB 1OIRA 5JGBA 3QHTA 2VTLA 4RA4A 4QQJA 5ETCA 2ERZE 1U5QA 3O51A 4AUAA 3DDQA 4HVGA 1YX6B 3A9JA 4DFZE 5F9EA 3PPAA 4FULA 3FMMA 3QTUA 3PY3A 5LMKA 3DNEA 1HCLA 5M44A 3G51A 4PP7A 3IDBA 4D2SA 3QQKA 2GS2A 2MW5A 2G15A 4NNJB 4JRNA 3W55A 2PHKA 2YISA 3BLHA 2UYZB 5IUGA 2KD0A 3DPDA 4BR3A 4OTIA 5LMBA 5K5NA 4HNIA 3V60A 3BHHA 5IQIA 2MLBA 4W9EA 4FV7A 1YDSE 4KUJA 5L8JA 2FNJB 3QD0A 3MJ2A 2XUUA 2X9EA 4K11A 3TNHA 1WZ3A 3VF8A 3W2SA 5IA0A 5AZHA 3DXQA 4XNEA 3TUBA 1VJYA 4FSYA 4XLIA 3NYOA 4XOZA 1XH9A 1PXPA 3HUCA 3NPCA 4FTKA 4G3EA 5HLPA 1M94A 4GL9A 3OXZA 2PL0A 2BAJA 4IFCA 2W9FB 1JSUA 1MQBA 4HJKA 4HK2A 3RPYA 2F2UA 2WMRA 3FMNA 2JZZA 3PLAE 2PE2A 1U54B 3NHEB 4LL5A 5GNKA 3R7UA 4NCTC 3WYYA 3W1SA 3PZDA 3E8EA 3LAUA 4AOTA 2K39A 2LVOA 1X8BA 3P08A 3O2MA 2K8HA 5J9YA 5M53A 2WWZA 3IVFA 4ASZA 4M15A 2LJ5A 4M8NA 3P1AA 5C1ZA 1Q4LA 1ZZLA 1K8RB 4KV2A 5IQGA 4TWPA 2ZB0A 3CS9A 5JGAA 2MBOA 4ALWA 3QX1A 2QURA 3UINB 5FUTA 3KULB 4PTGA 2OIDA 4U8ZA 4EZ5A 4DT8A 4C3RA 4FV0A 3DZOA 2OGVA 1UKHA 3R9NA 2KTRB 2LGYA 5D11A 2WMSA 3QCXA 5IISA 2R3GA 4X2GA 2NPTB 4KA3A 3BE9A 3EOCA 5B2KA 5CT7A 2ETMA 1SZMA 5BVEA 1P1AA 1T0YA 1JKSA 4ZDVA 4CZTA 3SU8X 4YSJA 1SYKA 1GAGA 3ZFMA 4RMZA 4AOJA 4QTEA 2HTHA 3APDA 1PXOA 1BYGA 2WMUA 2NS5A 3A4RA 4V0GA 2CR5A 3LDZE 3BE2A 4NW5A 3ZO4A 1WR6E 2YDKA 2OO8X 4LQMA 4X2FA 3RGFA 1E5WA 2P0CA 1IP9A 2BCJA 3DA6A 3P7AA 4QO9A 5TE0A 4YUQA 5M57A 1YD8U 1OECA 4RFYA 2ZB1A 3HYHA 2IY1B 2KX3A 2MBEA 2WX0A 2MBQA 4G17A 4L46A 4FNWA 4QOXA 5JZJA 3ZDIA 3LOKA 5A4TA 3VDZA 3FKNA 4K18A 2IO1B 3A7JA 5HEZA 4PTCA 5JFXA 1XH8A 5EM5A 2HZ0A 4D58A 3FY2A 5CEMA 2F7XE 3I7BA 3MY5A 3VQHA 1BX6A 3FL4A 3OROA 2UVXA 4X2NA 2X2MA 4F6SA 5J2RA 3NOBA 3JSVB 2N9EB 2RFNA 4GIVA 3KC3A 4W9LA 3WE8A 4L01A 4OTDA 3UIXA 4DTAA 3FWQA 2PUIA 3TDVA 5CNOA 4Y8DA 5AUWA 4GUEA 3HRCA 5FM3A 1Q3WA 4WHZA 2Z2WA 2GQGA 2KLCA 5IA7A 1KE9A 3ZUNA 3K3JA 3G6HA 4O6EA 1EF1A 1RDQE 5M4UA 3VUHA 1B38A 3LCSA 3CQWA 4LM5A 3DBCA 3MPMA 4M3QA 2KJHB 3DS6A 3L17A 2CCIA 2JDOA 3COMA 1YQBA 4XLVA 4TYHA 4HDQA 3LHJA 5IUIA 1NY3A 3VHKA 4BF2A 1Q5WB 2OJIA 3DXNA 3N3KB 3MFTA 4ZSEA 5AFVA 3WAMA 3MVMA 1UU9A 3DLSA 4I21A 2REXA 2QD9A 2Z7LA 5H8GA 2HE7A 3KK9A 2J0IA 4NQLB 3ODZX 5H8BA 5FXQA 4URKA 4Z3VA 3IONA 4MAOA 5AR2A 4G3XB 1XBAA 3TI1A 5TR5A 2DYBA 4BFMA 2VWXA 1PF8A 2YM3A 5HLNA 4K6ZA 2XK9A 1Q41A 3QWZB 5IQFA 4AP7A 5L2SA 5K0XA 1PMUA 2P3GX 2ZPYA 3OTVA 2HXLA 3QTIA 4UYNA 4RM8A 4FHJA 1R0PA 2DUVA 4O0VA 4GOCA 3HK0A 2C1AA 2XNMA 4LCDE 4X2JA 2LXAA 4YO4A 2XCKA 4KIQA 1K2PA 4CXAA 1J7IA 4G6OA 2G2HA 3VS1A 5IQEA 3OY3A 4RSSA 4ICUA 2Y6OA 3QTQA 4YPDA 4FTAA 3D2IA 4EZJA 4U3YA 5IU2A 1Q8ZA 4W9DA 3RULA 1BI7A 2ZMCA 3UPZA 4J8NA 2QODA 4NH1A 4JDIA 3ORTA 4YZDA 5TO8A 1YWVA 4R8QA 3TV7A 5KX8A 4NUSA 4Q5HA 2WOTA 1AGWA 5ANOA 3FPQA 5FDPA 5I4NA 1E1XA 4ZRJA 3A8WA 3BQRA 3LLTA 4FMQA 2C1BA 5L2WA 1CKJA 2WQBA 4XG6A 5AM7A 3KYCD 4FSUA 4JNWA 4O27B 3E62A 3PE2A 5FTOA 3OW4A 3PG3A 3R9DA 1TVOA 4F9WA 3TL5A 3ZVVA 4USDA 2XMYA 2I1JA 4QP4A 3R0TA 3E64A 4YTFA 3WAOA 2JRIB 4BCPA 4CFXA 1G5SA 2IZVB 3F5XA 5CF8A 4I5MA 4E26A 4GYIA 4H1JA 5KMKA 3D9VA 5I5ZA 5DPRA 2UZBA 4DFXE 4CKRA 5IEXA 5ANDA 3NW6A 3IDPA 3OVVA 5KCVA 4EK3A 3KUDB 2WTVA 4PNIA 3PSCA 3KA0A 4UWBA 4RIXB 3KXXA 3ZYAA 3TJDA 1R3CA 4DTKA 4KZ0A 4NL0A 4HYSA 3GU5A 3VS2A 2I0VA 4XRLA 4K7WA 3JR1A 2ITVA 4TPTA 5JK3A 2B9HA 2JDSA 2K8CA 1VYWA 2BRMA 4L43A 3W18A 1GOLA 5JSMA 1EUVB 4O21A 2BKZA 2W9ZB 3B2WA 3F82A 4RWKA 3U6HA 2J5EA 2CLXA 1SNUA 3QQLA 1MRVA 4MK0A 3ZU7A 4ZRKA 4KIOA 2BRGA 2XIRA 5BYZA 3SXFA 4EOSA 3LXPA 5J7BA 2YM5A 3FC2A 3R7YA 3VBYA 3WAPA 3JS2A 3MTLA 3PIYA 2PMOX 2OWBA 2R3PA 2WU6A 4AN9A 4APPA 3ZKJC 3HV7A 1YI4A 5KHOA 3WZDA 3D5WA 4CG8A 3FSKA 1ZY4A 3IKAA 2PVMA 3E88A 3HAMA 4MQ1A 5I9YA 4IX5A 2LASA 3FE3A 2H8HA 5ETFA 5EM6A 4M69A 4M13A 2BKKA 4F9AA 4RIWB 3QZFA 5LMAA 1YJ1A 4JQEA 4K9YA 2IZTA 4WAAA 3KRLA 3CP9A 4QP8A 1QZEA 3Q52A 3D83A 4FKSA 3MJWA 4EH5A 5LOHA 4MGYE 4BI1A 3R63A 2OH4A 3QGWA 1ZMUA 4O96A 4TTHB 4A9UA 3AD5A 2Z0DB 4F0FA 1P5EA 3MPAA 5KBRA 1HE8A 2ERKA 4CRLA 3UQBA 4JXFA 3OWLA 2IN6A 4J53A 4WBBB 3TIYA 2C0IA 3NIZA 4F6WA 4ASWC 4YNOA 4E4XA 4AWIA 3FMHA 4L45A 2QC6A 5CU4A 4YC3A 3G0EA 2OF4A 2R2PA 5EDSA 4FUXA 3BV2A 3H10A 4J7BA 4BOSC 1QPJA 3WARA 1U54A 2R3FA 3LXLA 2YIQA 3KH0A 3RHXA 3FMLA 5EHYA 4HOKA 4EH7A 4Y46A 1L3RE 3EFLA 3IGGA 1YW2A 1I35A 5EDQA 3WALA 1JPAA 3D7TB 2LI5A 4O22A 4ZYNA 4EQUA 5JQ8A 4ENYA 4NTTA 3F3ZA 2O8YA 4XCUA 2A2AA 2BDJA 3RZFA 2Y5BB 2XJ0A 4WBOA 5L4QA 3O7LD 4ZS4A 4RX8A 4ZZMA 3QZHA 3RNYA 1RQQA 4FSMA 4C2VA 1FXTB 3QKLA 3BKBA 5IUHA 3SDLC 5AUXA 1KE5A 3OF0A 4NKAA 4PTEA 1F9JA 2RGFA 5I9WA 3MPTA 4UN0C 2WQMA 1IYFA 3ORLA 3R7RA 1PRYA 3DAKA 4R5SA 3V5LA 4ZTQA 1L7YA 3PLUA 4ZJIA 5DA3A 3S0OA 3PP0A 3FAAA 3ZLWA 4P4CA 3R7VA 2IY0B 4PYZA 3A99A 3FYJX 2GQRA 2A19B 2GQSA 2ZDUA 1YHWA 3UP2A 3D94A 5F95A 3ROCA 3AMBA 3F6XA 4NW6A 3NUAA 3D15A 4YTIA 2B3AA 3A60A 2WMQA 5D7VA 5C8KA 3UVQA 2CKEA 2O2UA 1B6CB 3DAJA 2HOGA 3EYGA 3QGYA 4EH6A 4GCJA 2JKMA 4GDLB 3TCAA 3BU3A 3EYHA 3M3JA 5FXRA 4FBXA 3F5PA 2YCRA 2CSNA 3CJFA 3HDMA 3B1LX 3ZRKA 4FJVB 1JBPE 4FT9A 4ARKA 2G9XA 4GSWA 4FEWA 5JEBA 2IPXA 4NJ3A 4CKIA 4RFMA 3U8ZA 4MVFA 4DINA 2G3QB 4PMSA 2YFXA 5KHXA 3P7CA 1H08A 4IX3A 3RAIA 2PWLA 1XD3B 4D1ZA 5E1EA 2FYSA 4G2FA 4YL8A 1SVHA 3RALA 2IW6A 2VTJA 3CD3A 3SC1A 2VV9A 5F1ZA 3UGBB 4CVAA 4MGZE 4U80A 4MJSB 5CF6A 5EW9A 4BDHA 4DBNA 1YX5B 3MA6A 4E1ZA 3IG3A 3VBXA 4IVBA 2XK4A 4GIIA 3T8MA 2WZJA 4PRJA 3ULZA 4PNKA 1JSVA 3U4WA 4QMXA 4C4IA 4ZLZA 4YZMA 3I60A 5AV3A 5AIKA 2VNYA 1V1KA 5IH5A 1OKZA 3DBEA 3ZTXA 1VYZA 3PG1A 2R2QA 3AC1A 3HV5A 2R4BA 4LMUA 4IG7B 4DA5A 3P2BA 2DWBA 2PK9A 3DKCA 3KK8A 3DB8A 5A9UA 1M52A 2C7HA 4DG0E 2JDTA 4GB9A 4L6QA 4O82A 5DEWA 2AWTA 5I3OA 2V22A 3QARA 2KANA 2B9FA 4FA2A 3UIUA 4QP3A 2A0CX 5CNNA 4DGLC 1J8CA 2ONLC 1E8YA 3BPRA 4HYIA 3ACKA 4KKHA 4YURA 2KWCA 2BROA 4U42A 3WZJA 4ZK5A 4EBWA 2HD5B 1B39A 3RZWC 3IO7A 4DDGD 1Q8TA 5M4CA 1GZ8A 4QP1A 5AP2A 2DQ7X 5HG8A 1SE9A 3PRFA 3QLGA 1WF9A 3ALBA 3AXWA 5IQBA 1LEWA 2LWPA 3MS9A 3R1NA 3KKVA 3QXOA 3WZEA 5CSPA 2OSCA 4Y72A 2YLFA 4YC8A 5HO7A 4XG8A 1GC6A 4JBVA 3WYXA 1GNGA 4FK3A 4JT3A 1H4RA 2UW3A 4WA9A 5T3QA 5EDPA 5L6WL 1E90A 3E63A 3QK0A 3BV3A 2ZJWA 1GIHA 3CQUA 3VS6A 4L7FA 3UIMA 5E8UA 3ZFXA 3C0HA 1OGUA 4JDKA 5DHJA 4AZSA 4EHGA 5CF4A 3S00A 3QBNA 4FIHA 2CLQA 5EG3A 4BICA 4CG9A 2VWIA 1Q62A 2ZV7A 2XJ2A 3UC4A 2EKEC 3E5AA 4KB8A 4NM7A 2CN8A 4JAIA 3I1AA 4BDKA 4BIDA 4KDLB 2UW8A 2BAQA 3OBJA 4BTMA 5KZIA 2YCFA 4K8AA 3DBDA 4RWLA 2VTRA 4MD7E 3ML8A 4JG7A 4H1MA 3UZPA 3UGCA 4O7TA 3OY1A 3KL8A 3TNIA 2DYOA 4GT4A 2W4JA 3O65B 4M7IA 4ACCA 5DPVA 5M06A 5HG7A 3EN5A 3DKFA 5HZNA 4TY1A 5M07A 5DPWA 2KK8A 2VTSA 2EUFB 2L3ZA 4PPCA 3L1SA 4WG4A 1Q99A 3RT3B 4HZRA 4RGJA 3ZTDA 4FR4A 5HIDA 3NUYA 3UYTA 1W84A 5CEKA 2IO3B 4L8MA 3RZBA 3E87A 4G5PA 4ICVA 5BYLA 3WIKA 3WIMA 2X4FA 4FGRA 3KRRA 3M11A 3T9TA 3R1SA 4O7NA 4PV0A 2CNUA 2VN9A 5EI2A 2XP2A 1CTPE 3RCDA 3TJCA 5JKGA 5CTRC 3Q9YA 3GQIA 4KSLC 5AEKB 4PDPA 4CV8A 3QRTA 3BYUA 4AW1A 4QTAA 1H1SA 3E7OA 4YMJA 2GPHA 4X3FA 1RJBA 5HG5A 3GT8A 1R39A 3VHTC 1R1WA 4B8MA 3BU5A 2WTWA 5LCJA 4WT6A 1UV5A 3GC9A 4Y95A 3S4QA 1G6JA 2PVYA 5HX6A 1KJTA 1Y8YA 2CNQA 4FV8A 4E20A 4EHVA 1YDRE 3MVJA 4H36A 4FKIA 5K4IA 3SG8A 1FOTA 3LFQA 3QTSA 5D7GA 2F49A 2VRRB 2IO2B 2K1FA 3AXCA 1ZARA 3R1QA 5HCYA 4ERWA 2JUOA 4GUBA 4AJWA 2AC5A 3HL7A 3H6NA 3PJ8A 3EZVA 4W4VA 3SD5A 2VTTA 3L8XA 1U4DA 4FKGA 3UQCA 3FJQE 1M2RA 2ZV8A 3PSDA 3TNWA 3PVLA 3H0ZA 4EONA 4MJSA 3V04A 4FT7A 4OT6A 4UBAA 5DRBA 5IA4A 3OCBA 4YZBA 5LWMA 2X4ZA 5A4LA 3DJ7A 1KLVA 4KKEA 2W1DA 4EYMA 2ONLA 4ZZOA 3VH3B 4I6HA 2WQOA 4HCVA 1KOAA 4M12A 5HE2A 3R02A 1XO2B 1XHAA 4M67A 5AP5A 3O50A 4XG3A 3TKHA 5HICA 4YZNA 4F0GA 3ZZEA 5AX3A 4XYFA 3I3TB 3F2NA 2V3SA 4CKJA 3GNIB 2B1PA 1XBBA 3WZUA 2JRHA 2O6VD 5C4LA 3OD6X 1ZMWA 3LFNA 5L6OA 3Q2JA 2WXVA 2ZV9A 2K8BA 3PRMB 4IVAA 3EN7A 3QA0A 4NQKE 4USEA 4O0SA 5FD2A 2O0UA 2KOXA 2W1HA 2J50A 2XBAA 4Q9SA 5J5TA 3U7DA 3ZO5B 4AUQC 4HPMB 4MEMA 1UBQA 3EFKA 5CEQA 4NJDA 5HESA 1YI6A 2VRXA 4KRCA 4FSNA 4A20A 4ANVA 1U59A 3G0FA 4BCGA 3QYZA 5C8NA 2GNGA 2O6VA 3ZW3A 4AT3A 3UQAA 3TNQB 3BWJA 3COHA 5HCZA 2FSTX 4G3DA 2KO3A 3WZKA 3V8WA 3TNPC 4AZVA 4KZCA 4I94A 5M09A 2KC2A 2HELA 3OCTA 4B7TA 3PIZA 3ERKA 1WGHA 1H1QA 3IDCA 4AX8A 2C5VA 4EL9A 2ZM1A 3TIZA 1LR4A 3HA8A 1ZOGA 3UE4A 2XRWA 3F7ZA 4UWYA 2CHWA 5BVNA 1H00A 2YM7A 1Z9XA 3VO3A 4MH0E 1ZOEA 3UTOA 4UZHA 2M8SA 3UQGA 2DX5B 3F5GA 3V01A 4CYIA 2GHMA 2XYUA 5LVNA 4BKGA 2HW6A 1WM3A 3Q53A 3RVGA 2OF2A 5DGZA 4O0XA 4XG7A 2JAVA 4YNEA 4BDCA 3MV5A 5AAEA 4F1TA 4HYUA 3TKIA 4NWMA 3HA6A 3EKNA 4U9AA 5HOAA 3RAKA 2KVRA 3G90X 4IQ6A 4PQNA 3HNGA 1WGDA 5AJQA 5A4EA 4M8MA 5IQHA 5AP1A 3DU8A 5A54A 5K4JA 3OT8A 3KRXA 2MWSB 5CAUA 1WCCA 3E8CA 4L44A 1YHSA 1GG3A 1V9JA 1R78A 4WO5A 2KFKB 4QMMA 3N4VA 2X0GA 3ZHPC 3M2WA 1YXUA 2C0TA 4FOBA 4GMVA 4EJNA 2WTKC 3KF4A 2NBWB 3KN5A 2KTYA 3OCGA 3S3IA 1GNUA 1M7NA 5CAVA 1WE6A 3W1YA 3MTFA 3I81A 4IH8A 4UALA 5EYCA 1JKLA 4FIIA 3D0EA 4U5JA 3W2QA 4DEAA 3QAQA 3VVWB 3LW0A 3F69A 4H3PA 2PMIA 1WY8A 4X3FB 5LJJA 1KV2A 4IEBA 4MXXA 4U43A 2WU7A 3UOHA 5JFWA 2RD0A 2WX1A 3OS3A 1XR1A 2HWPA 4IJ9A 4KSPA 3DQWA 3DBHI 4YHJA 3KQ7A 3QA8A 2ITNA 4ZIMA 2GNIA 5FTGA 4JQWC 3CGOA 4A9YA 2WD1A 4AQCA 4DLIA 2YZLA 3R7GA 3FZPA 3A7GA 2VTMA 4FKUA 3CXWA 4WIHA 2QNJA 3DDPA 4J95A 3R6XA 4DFNA 4FTQA 4IWQA 5GZAA 3M63B 4FBJB 3W2RA 4BWXA 4KSQA 2NBVB 3I5NA 3VAPA 2HCKA 2XIYA 2HJ8A 3Q6UA 3A1QA 2V7AA 3A33B 3RM7A 3KRWA 2RFEA 2NPQA 3E8DA 5FP6A 4FV2A 3PXZA 4E74A 3RMFA 3NYXA 3PPZA 2B9IA 2IG7A 4TT7A 5CQUA 1KE7A 4FTIA 4EUTA 2V1YA 3REPA 4TQ1A 3NEWA 3KXMA 1OKYA 3L9PA 3F5UA 3NIEA 4FKOA 3UIBA 4GN1A 4MGIE 4FKPA 3SXSA 1M7QA 3PY0A 2OJRA 4FI1A 3ZM4A 3FLWA 4ANMA 3MH2A 5E6PA 1PMNA 3U87A 3VNTA 3JVZX 3OC1A 3PXFA 5HO6A 4GH2A 5KKRC 3KEXA 2WQEA 5IA5A 4F64A 4WNOA 3KCFA 1PJKA 3W8QA 4OVUA 2I0HA 4F9BA 2VGPA 3AT2A 4TYEA 1OEYA 5F4NA 5GIPE 4BCNA 4FV4A 5FQDC 2ZAZA 3U6IA 2JWZA 3R9RA 4RX9A 5IG1A 4ASEA 4KBKA 4YJQA 2R3LA 1MG8A 1V6EA 4D2WA 4NIFA 2J7QB 2KJ6A 4F7JA 3DT1A 5LVLA 4YP8A 4IADA 2J90A 2UZOA 4D55A 5AUTA 3KMUA 3V5WA 1MRYA 3D7ZA 4ALUA 4HCTA 4YJOA 2PZ5A 4CZYB 4UYAA 4NM5A 4JDHA 5B2MA 1SMHA 2F2CB 4K0YA 3DB6A 4RFZA 3RHKA 2DZKA 2FCSA 2B9JA 5E91A 3SOAA 1XH4A 3BWFA 3NW7A 4PPBA 3CPBA 3KULA 2PVFA 3HVCA 3MIAA 4BN1A 2IO6A 1OBDA 3NUSA 1Z5SB 3PVUA 2QOKA 3LMIA 4ZTNA 4FSZA 4EHZA 2XIZA 4QMOA 5CVFA 4CD0A 2Q0NA 1V0OA 3Q32A 5FBNC 2JDVA 2MCNB 2MBBB 3JYUA 1H4LA 3B8QA 3EFUA 3CSVA 4JIKA 4RIXA 3AMAA 3CD8A 5E8TA 1Q24A 2XKDA 2G4DB 5JH5C 4BCJA 4XX5A 4TRLA 1UWHA 4FZ6A 3R8ZA 3TEIA 4BBNC 2IVVA 3CY3A 4HYHA 3QD4A 4JBPA 4RJ8A 4JR7A 2WQNA 3RKBA 3VVHA 4RQVA 2AC3A 4Z7HA 5E8XA 2PPHA 2YAAA 2XEZA 4O0UA 3QRUA 5EQEA 4ANUA 4MDKE 2R5TA 3MH0A 5KBQA 3NVMB 5HE0A 4C7TA 2Q83A 2QG7A 3C7QA 4FN2A 2PVLA 4NM3A 4I0SA 4D5HA 3V61A 5CENA 4K7SA 3N30A 1QL6A 4QT1A 3U30A 4AA4A 1Z2MA 1STCE 2VWUA 3CTHA 2O6VB 2GNFA 4BTFA 4W9JA 5HIEA 4EOYA 1XWSA 1H07A 2X2LA 4X7QA 4PS8A 4AU8A 2CGUA 5JFVA 4W9CA 2V5QA 2B7AA 4L42A 4EOQA 4LV5A 2QO2A 2UUEA 1XJDA 3DKOA 4QMPA 5D7AA 2LGCA 4C4FA 3EMGA 4GXBA 3IGOA 3EL8A 3UODA 5BYYA 1C3TA 1YRPA 2G1TA 4MWHA 1Q8UA 1J91A 4S32A 4MGKE 4IB0A 4CGAA 2OW3A 1Q0WB 2Y4IB 4A4OA 2XZSA 2R3MA 3GFWA 5M4FA 4R1YA 4TN6A 3CTQA 4FTLA 4F4PA 2ZCBA 4DG3E 3PTGA 4XBRA 5G2NA 4HVSA 1O6KA 3TM0A 4YLJA 2BZKB 3KN6A 3U51A 1QPEA 5KUPA 2EVAA 4ZSAA 4GT5A 5KO1A 4HZSA 4IW0A 4XV3A 5JRQA 3I0QA 3VWAA 1ISNA 3MGYA 3NUPA 5KHWA 3AOXA 2C6KA 4ZZNA 5IA2A 5J95A 3SRVA 4BGGA 4AE6A 4O0YA 4EWQA 5TOZA 5LQFA 2J0JA 2JFLA 2WB8A 4KAOA 4BDAA 2LUEA 2YWPA 4HPLB 1LQBA 3AGLA 1O6YA 3ZSHA 2LXCA 4O7SA 2DAJA 2ITZA 3R3MA 1JAMA 4E73A 3ZSIA 3SQQA 2OLCA 3ONSA 2OJFE 1SVEA 5IQAA 3CY2A 3QKMA 5CU0A 2VTIA 4Y85A 3PWYA 2HZ4A 3PWDA 4YJUA 3GCPA 4FV3A 4CV9A 1XT9B 2BDFA 2P4IA 3PA5A 3PYYA 1YXTA 4MNEB 3SVVA 4O81A 4E3CA 4RMAA 3MESA 4A9RA 4H3QA 3DVGY 2GMIC 4U7ZA 3QRIA 2BALA 3UNKA 2CGXA 3LFFA 1ZWSA 3HX4A 5TR6A 3WBLA 1WVYA 3QC4A 3F2RA 2B52A 5BVOA 3MA3A 2J6MA 3CCNA 5FEQA 4AG8A 2HWOA 4KINA 2EXEA 3FMKA 2HAKA 3VFKA 3QU0A 1UU3A 4YJRA 3UG1A 4C59A 3H9DA 1WE7A 3TMPB 1JRUA 4BBFA 3IBEA 4QP9A 3TZ7A 2PY3A 4X2KA 5FEEA 3S95A 4E7WA 3RWPA 3CEKA 2NCNA 5M51A 3C0IA 1ZMVA 3LFDA 4CRSA 4UMRA 4NT4A 2N7EA 4R3CA 5CEPA 1FVRA 4EWHA 2ZDTA 1HOWA 4EOLA 5EHLA 2EXMA 3C4ZA 3QWJA 5A46A 1W83A 3SHQA 5AA8A 4BDEA 3VUKA 4AF3A 1H1RA 3U6JA 3RD2A 3FLQA 4JLCA 1WBTA 3QQ8B 4HCPB 3FSFA 3DAEA 4ZP5A 2W0JA 4JJRA 3VRZA 3FI4A 3EFWA 2WTCA 4EH3A 4IAZA 4FEVA 2ITYA 4I0RA 4PX6A 1BL7A 3I4BA 3PXYA 4YGAA 5A6NA 5DRDA 2PUUA 5G1XA 2QOQA 4U81A 3SG9A 4FTRA 2V7OA 2YM8A 3IQ7A 4UXLA 5K5XA 3L8SA 1OM1A 3QC8B 4DFBA 3V3VA 3OZ6A 4IFGA 4BDJA 3A2CA 2JAMA 3DCVA 2W1GA 2WAJA 4JBQA 4R5YA 5D1JA 1ZW7A 4EZLA 3HMIA 3PPKA 5L2QA 2NVUI 4IB1A 3TTIA 5FXSA 4CLJA 1OQYA 5CAPA 3UMWA 2WYQA 1IG1A 1YHVA 2WMBA 4W9KA 3CGFA 4F1MA 3H9OA 4ZLYA 2W7XA 1KV1A 3AG9A 4A9TA 4X6QC 4BZOA 2L05A 4EOMA 4F7ZA 3NNWA 3TUCA 3Q3FA 3VTVA 4FNYA 3UO4A 4I3ZA 5HU9A 3Q9XA 1J7UA 2C3LA 2OFVA 2X7OA 4BZNA 4LRKA 4ANSA 3IOKA 2XK5A 3GZNI 4ZTHA 5CEIA 4U41A 2FSLX 2WIPA 2A4ZA 2GNJA 3PE1A 1YDTE 3GI3A 3JY9A 2J0MB 4KVGB 4RVTA 3VBQA 4D9TA 3BQCA 3TUDA 1IAHA 1SM2A 4JOAA 2WMXA 2KWUB 3KXHA 3A62A 3GCQA 1C1YB 1ERKA 5FDXA 3C0GA 3E3PA 2LZ6A 3AC8A 1PKDA 4MH7A 5K3YA 1RFAA 4N4SA 4LDTB 4DGOA 1OPLA 1UKIA 1YWRA 3R01A 5HBEA 4AGDA 4C61A 5AAGA 4C37A 4BVUC 5CXZA 3WA0A 4F1SA 5EQPA 1VR2A 3MI9A 3CSTA 1UBIA 3HM6X 2O65A 2XJ1A 5CHWA 4O7RA 4IC8A 4RVKA 5KZ0A 3I0OA 5HNGA 5DCNA 2BR1A 2JC6A 2IWIA 2X9FA 1ATPE 3I7CA 1JKTA 1SNXA 2VAGA 3Q4CA 4FYOA 1KM7A 4B9DA 2KQSA 5CSVA 4K33A 5JMSA 4EK5A 2K6DB 4OTHA 3H7SA 2W4OA 4W9XA 5TT7A 3VC4A 4BVUA 3CE3A 5CEOA 5E8SA 3M62B 4FZ7A 4G34A 4B4LA 4B8LA 1OZ1A 3U9NA 1ZYSA 4YBJA 3BEGA 3JVSA 5A4CA 4ANOA 1LP4A 3IW6A 3LMHA 4RIYB 2VTOA 5E4HA 3NMUF 4GIHA 1PXKA 4R6VA 4PYUA 4MKCA 1OIQA 3FLZA 3GU4A 3LZBA 5DN3A 4F7LA 2JPHA 4EOIA 2GBKA 2MRPA 1ND4A 5J79A 4LFIA 3QF9A 4I5CA 1RW8A 4IC7A 3DJ5A 2V0DA 1ZGUB 4G3GA 1J19A 1WFCA 1Y8RC 3GCUA 2PPQA 4BHZA 2VO3A 4HLEA 4XHKB 3R1YA 2KULA 3AQVA 4I6LB 3BHYA 5EM8A 1JNKA 2GTNA 2RF9A 2XNPA 5D2MB 1MUOA 4DHJD 4DC2A 3GCSA 3QCQA 5G55A 4CT1A 2VUWA 4BIBA 4LMNA 3Q4TA 3HUBA 2I40A 3COKA 4ANLA 4DBGA 3DTWA 3W2CA 4APCA 1JLUE 3VW6A 3VS5A 4R3RA 2YACA 3BLRA 4IM3A 4EUUA 2W96B 2WTKB 3KB7A 4J99A 4XZ4A 4OBQA 3ZNZB 2QI8A 4WRSA 4F1OA 3ALNA 4O7WA 4EJ7A 4DH5A 3EQPA 3OBGA 2O5KA 3R2BA 3BEAA 2JFMA 3C4FA 3HRBA 4HGLA 3TN8A 4YZ9A 4EBVA 1V0BA 3G5DA 5AP6A 3WF9A 2LD9A 4FEUA 3ANQA 3QL8A 3KXNA 2OU7A 4GJ3A 2MA9B 5D94A 4HJOA 2OXXA 1UNLA 3WANA 2YWVA 3E93A 3DCGA 2GHLA 3DVNU 3S2AA 2I1MA 4P5ZA 5M56A 2V62A 3GB2A 3PTFC 3LXKA 4DGNA 2R3KA 3MB6A 1KUTA 4GYGA 5E90A 5GZ8A 4FJYA 3ZONA 4II5A 3DBLI 3RYTA 1PXJA 2WMVA 2X2KA 3DVGX 3GOEA 1ZAOA 4I93A 4GDLA 2M17A 3GQLA 5AAFA 4PPAA 3ZFYA 5D6JB 3UMXA 1JVPP 2C6DA 3E7VA 3PJ2A 1LEZA 4XUFA 1T46A 5EYDA 4ZTLA 4AZEA 5HNIX 4UZDA 5FGKA 4AW5A 2D10A 2R3IA 3IHPC 4TYGA 1XQQA 3N51A 1IA8A 4IX4A 3ZH8A 3D7TA 4EH8A 4F08A 3UVRA 4DHFA 2PE0A 4MQ2A 4XP2A 5CU6A 4C4GA 2KTRA 4G3FA 3ZUVA 4YU2A 4YPSA 3UJGA 4HXDA 4GFMA 4C2WA 2UW4A 4CT2A 1Z57A 4E6QA 5DBXA 4D4YA 3UO5A 2CKQA 4C38A 2LRWA 1GC7A 3V5PA 5IH4A 3LPBA 3H9RA 3JY0A 1WXAA 4D1SA 4F6UA 3BGQA 4GK3A 4N6YA 4V0GB 2JKOA 5JFSA 2CKOA 5EOBA 2BWES 4CCUA 1A5RA 1VEBA 4IJPA 3VS0A 3V5QA 4QYHA 2VWZA 5C26A 2ZPNA 1H8CA 2VWYA 1S1QB 3QAME 1T45A 3ZLXA 2X7FA 2IZSA 4JG8A 3WOWA 2L7RA 5K9IA 4N57A 2PSQA 3ATTA 2W9NA 2MX2A 3P23A 3UP7A 3HMPA 3NVKI 3TZ9A 2GBRA 2L0TA 4H05A 2I7QA 3F88A 4NU1A 3FI3A 4ASDA 4O0WA 4IM2A 2KFKA 2P55A 4ZLOA 3VUXA 3BIZA 3FYKX 3IS5A 3LM0A 3P79A 5E8ZA 5BMMA 2G01A 5EH0A 3ZOSA 4E5BA 2FA2A 3P7BA 3OUNB 3MB7A 3HMMA 4NJ7A 4TUUA 4I22A 4R7IA 2CJMA 5AUZA 3VUGA 4EK4A 2GOWA 5DPSA 3C51A 4RJ4A 2DYMA 3TWJA 2I1KA 2XK3A 2A27A 3OWPA 5A3XA 4EEVA 2X8DA 4O2PA 5GJDA 4A07A 3D32A 5K0KA 3X0WA 4FZFB 4MYGA 3QX4A 2NR2A 2GBJA 3HIZA 4JR3A 5HGIA 4WQOB 3R66C 1YQJA 2UVZA 4II2B 3NAYA 4DT9A 2C5OA 1VCBA 2XKFA 2YJRA 4DCAA 5E1SA 1CSNA 2JEDA 3T8OA 4KABA 3H7PA 1IPGA 4D4SA 4M0WB 2JF5A 4RIYA 2IZRA 4IUMB 3FMEA 3HDNA 2GBMA 4KBCA 1OITA 5AV2A 4QMSA 3SOCA 3ZUUA 2M1MA 2H96A 3EL7A 5J1VA 4USFA 1V49A 3A1QB 3PT2B 4WJOA 4RC2A 2ZCCA 1OI9A 1PXIA 4GEOA 3O0GA 2IVSA 4LRMA 2C6LA 1UWJA 3R8LA 4IWPA 1S9IA 4FX3A 3Q2MA 3T3VA 5EI8A 1KSWA 3EHAA 4OTGA 4WNPA 5CZHA 3CR0A 5CALA 4F99A 1AD5A 5IEVA 1IAJA 3VJNA 4F70A 1RE8A 3UG2A 4BZDA 4FSWA 3RWQA 3UOKA 1NVQA 3VUDA 4MTAA 4FIEA 1EH4A 2NBUA 1PHKA 3FZTA 2FH9A 2W1IA 3QFVA 4AP4C 4DEDA 1GZKA 4D4VA 4DFYA 4G16A 5AP0A 2IVUA 3UOJA 2JT4B 2KQ7A 3ROYA 4JG6A 4PL5A 1FGKA 4GU2A 3LQ5A 1NW1A 4TW9A 4F09A 5IKWA 3N4TA 2Y7JA 2FGIA 2XCHA 4FKQA 3AC2A 4G31A 4DH1A 4FG8A 3KU2A 2CHXA 4OBPA 2BTSA 2OXDA 3AT3A 4OT5A 4UMTA 3RJCA 4RZWA 3R73A 3VS4A 4CNHA 4HVHA 1WXSA 4EKUA 1J1BA 2OZAA 2EXCX 2ZYBA 3BX5A 3ENHA 3F3VA 4I5HA 5DFPA 3QQUA 4FV9A 4JBOA 4XP0A 3RP9A 2VWWA 1I42A 3FV8A 4IB5A 4KBAA 2LRUA 4U97A 2IVTA 3R04A 3WF7A 3VUTA 4QP7A 2GDOA 3FEGA 1URCA 4ONAA 2GU8A 4A7CA 5BVFA 2XEWA 4JIAA 4Y5QA 5BVWA 2C6IA 5IQDA 1J0GA 4P7EA 1P4OA 3MVHA 3ETAA 4CTCA 1WVWA 2HY81 4PS3A 4BKYA 5FLFA 3NR9A 4WSYA 5BMSA 2XNEA 1JQHA 2VO6A 5DE2A 4TYIA 3CMMB 3CLYA 1XBCA 3DK3A 4XRJA 3AU5A 4LYNA 4M66A 3GP0A 2R3NA 2L0FA 2N1VA 1BI8A 2Y4PA 2C30A 2AEHA 2XNBA 4QPAA 4RJ6A 3KMMA 4Y5HA 1AARA 3SA0A 4HGSA 4FG7A 3A9KA 3FDNA 2YN8A 3LJ1A 4HGEA 4LOPA 5GJFA 1F0QA 3MHSD 1Q1OA 4IZ5A 4OTPA 3BHTA 2FSOX 2VU3A 2KDIA 4CHKA 2WKMA 4FZDB 4GG5A 2ITTA 5B0XA 3ZXZA 3MFSA 4RQKA 3HGKA 1JKKA 1YVJA 2WOUA 3R7OA 1LFDA 2YM6A 5J17A 4E4NA 3QLFA 5JGDA 2JBPA 4CEGA 2C9WB 3H0YA 4J1RA 3ZIMA 1O9UA 4WG3A 3SDJA 4K81A 4HNFA 2XK5B 2VTHA 2P2IA 5HVJA 5LVMA 3EQFA 2E9UA 2W5HA 4V05A 2E9VA 5DH3A 4EOPA 2B53A 3X23A 2UW7A 3FLYA 4XJ0A 5JZNA 1H26A 3GU6A 3Q9ZA 3QCYA 2RSVA 4J97A 4OTRA 5JRSA 3KUCB 1WZ0A 4TQ0A 3QQFA 3SAYA 4QMZA 4A3PA 4XG4A 2PE6B 3D2KA 1KWPA 4JS8A 2W17A 3NCZA 5E7RA 5HE3A 3H4JA 4N70A 1JOWB 4TL0A 4D0XA 3UVPA 5HQ0A 3BYSA 3FY0A 3NUNA 3QTRA 2N9XA 2N4FA 3BELA 4DAWA 3QKKA 3LFEA 1IRKA 2E2BA 3U9CA 2QU5A 1WBOA 4XEYA 2UVYA 5T68A 3OFMA 4M0ZA 5EYKA 2KXJA 3A4PA 4BCHA 5AZGA 4O83A 4FZAB 3AULA 2HYYA 3JSVA 4FNXA 4IACA 5AV4A 2K25A 4TWOA 3K2LA 3O8TA 5AV1A 3E92A 3C9WA 4E71A 2A4LA 2UW6A 3C4WA 2OJGA 3EWHA 4FKVA 4XS2A 4Y73A 3FHRA 1V2YA 4HCNB 3V6EB 3ATSA 4NY0A 2QOIA 4KSKC 4ACMA 3HLLA 3QUDA 5HU3A 1REKA 2W05A 3LMGA 4PL4A 3UDBA 2OZOA 2R3RA 5HVYA 1MQ4A 3PUPA 4AN3A 3ZDMC 4EH2A 1DS5A 4HVIA 1TBEA 1WR1A 3DVNV 2JKQA 3PFQA 2C6TA 1TTNA 3SX9A 5D41A 5DG5A 1Y57A 5F20A 2XKEA 4NFMA 4LUDA 4CFNA 4UX9A 4A06A 4QQCA 1OB3A 2ZVNA 3TKUA 4C4JA 4HPUE 1GUAB 1UH6A 4BI0A 5IAAC 3HM3A 4CSVA 5E9EA 3TT0A 4D1XA 5CXHA 1DAWA 2J0LA 1BUHA 3FXXA 3Q4UA 4FVQA 4FIJA 4GK2A 2V4LA 4WJQA 3WI6A 4AZWA 4I0TA 3OP5A 3W1FA 2Y4IC 4FA6A 2DYLA 1OL7A 1WIAA 5CX3A 5JHBA 5AR4A 3AI5A 4GT3A 2W5AA 2GTMA 4HGTA 2D11A 1QPCA 3CIKA 5CS6A 1WYWB 2ZMDA 4BTKA 1E7VA 5ANKA 2IJMA 4WRGA 5E92A 5FWKK 2ZEQA 3IFWB 4R77A 3ZLSA 4ID7A 5KNJA 3TZMA 4W9GA 4LOQA 5HD4A 3TCPA 2REIA 3H3CA 3V5TA 2ETRA 2GNLA 3A7HA 1WXMA 2EMTA 4RLKA 2E9OA 3K9PB 2BMCA 4CQEA 2PEAA 4DHZB 2KWVB 4AZTA 1UNHA 5KMOA 5BX0A 2Z0EB 3R83A 5CANA 3MW1A 5CT0A 3NS8A 3QUPA 4L3JA 4FKWA 4OLIA 2DENB 2WDTB 3I79A 2QOFA 1R0EA 5I9ZA 5AP3A 1ZOHA 2UZDA 4TKNA 4F9YA 5DNRA 5H2UA 3FHIA 3F66A 3FLNC 1BMKA 4IXPA 2XVDA 4B9KA 1R4NI 5EOLA 5CY3A 4I6PA 3UNJA 4YJVA 2BYFA 3RM6A 1WRDB 3PSBA 3OAWA 4II3B 1Y91A 2JLDA 3PJ1A 2ESMA 2H6DA 5L95C 3DNDA 2UZNA 3II5A 4G3CA 4P2KA 4D2VA 4C0TA 4GS6A 4RBLA 3PXQA 5IH6A 3ET7A 3ZM9A 2YVCA 4AN2A 3C50A 4S31A 4ANQA 2C3JA 3DFAA 4NPNA 2UW9A 2AL3A 3LLAA 4D9UA 5J8IA 3L8PA 2BDWA 4I24A 5CSHA 4YZCA 4MBIA 1EF5A 4CQGA 3ZRFA 4ITJA 1OTRB 2R64A 3Q9WA 2R2OA 3ZRMA 3NZUA 3ZDTA 4O7YA 2KKCA 1OIUA 1TKIA 2ITPA 4FV1A 2F4JA 4I6QA 4MNFA 3PVGA 5I3RA 3EKKA 4E5AX 2WELA 4FTMA 4HCUA 2JITA 1GY3A 4HVDA 2UV2A 4S33A 3A4SC 4XP3A 4LGDA 4CMUA 2VX0A 2W1FA 3K5VA 2C7NB 3FZ1A 4C8BA 2QOBA 4C4HA 3A7FA 5J1WA 4L68A 4R1VA 2R3JA 1H0VA 4X21A 4RVLA 5CI6A 5DI1A 5M55A 3LKMA 3P78A 4YTHA 2RG6A 2XIXA 4WKQA 4YLLA 4QTDA 4J52A 4FKJA 3OEZA 2VTPA 3SLSA 4YTCA 1OUYA 1NDDA 3L10B 2ZM4A 1G8AA 1PMVA 1UVRA 2X6DA 3LFCA 3VQUA 2EWAA 2FUMA 4XG9A 4JGHB 1KOTA 4AXAA 5KMMA 1APME 1NVSA 2VX1A 5G6VA 4ORKA 3FI2A 2QVSE 2RL5A 3LFAA 4L67A 3DQVA 3MFRA 1OEYJ 2F7EE 4QYEA 1SIFA 5H8EA 4DEHA 5AUUA 4MXAA 3ZNID 4Z7GA 2CPKE 4ZS0A 3R8UA 4D28A 3DOWA 3VH4B 5DLSA 4H3BA 3VUMA 1PXNA 3R71A 4MD8E 4U40A 3VBTA 3P0MA 5CX9A 4IDVA 4MSQB 3TXOA 1RAXA 3BZ3A 2PZRA 5IPJA 5HO8A 3PRZA 3V8TA 4OUCA 3MY1A 2VWVA 5IZFA 4IHPA 4G1WA 2V55A 1OGWA 2Y6MA 5E8VA 4BGHA 4C62A 4J6IA 4UV0A 2D3GA 3D5XA 4IMYA 2HENA 2MP2A 1WBNA 1F5QA 2RPQA 2HK5A 5FTQA 1OL1A 4FK6A 2VX3A 3NYVA 4J71A 1H0WA 2EU9A 3EN4A 5B7VA 1G8SA 4TZRA 3MN3A 3FQSA 4BYIA 4JX7A 4DGMA 3RUIB 4FVRA 3Q3BA 4IAYA 5LVOA 3A8XA 5HVKA 4Y83A 2FVDA 4AT4A 2Z7RA 4I4FA 4QMLA 5DVRA 4ZXTA 4BB4A 2Z7SA 3L9MA 4WWOA 4FV6A 3NX8A 4BCQA 4OTFA 4BIEA 3NNXA 3JPVA 4U3ZA 2GNHA 3BCEA 5LXHA 4MM3A 4PF4A 5JHAA 2C5LC 5CI7A 3TDWA 2F7ZE 4Z16A 3TV6A 5M4IA 4FEQA 3ORKA 2YCSA 4I6BA 4F7SA 4EH9A 1H8FA 3MIYA 4OVVA 4PS7A 4BKZA 4KIKB 1YOJA 4UY9A 5AUVA 1WGGA 2KLGA 4O7LA 4LGGA 2FUHB 3PXRA 4RJ3A 2PVRA 1IR3A 3NGAA 4NKSA 4PP9A 3GENA 4QNYA 2WO6A 4L9IA 4GRBA 1ZXEA 3GFEA 4K2RA 2A1AB 5HE1A 1H27A 3VS7A 2DS1A 1V5TA 5ETIA 4B95A 4K1RB 4AE9A 4M0YA 4GFGA 4ZSGA 3IOPA 2PZIA 2W1EA 1VZOA 5L8KA 2E9PA 5DMZA 3FZSA 1H1WA 2QU6A 3LFBA 4QMUA 1UU7A 5KHQA 5CHFA 4IWDA 3B8RA 5AR5A 3R8MA 4GVAA 4QMNA 4RJ7A 1YXVA 4IVCA 4YR8A 1OMWA 4FOCA 4I41A 5L6PA 4O7VA 2OFUA 3HKOA 1WAKA 4EOKA 5GIOE 3V62A 5KMJA 5LARA 3UOLA 3P9JA 3UNZA 3F2AA 1WM2A 2MBHA 3L54A 1YXXA 2NRUA 2OBJA 4C3FA 4Q2AA 5CAOA 2UZLA 3NS9A 3HV3A 3OG7A 4MEDA 3ML9A 3VN9A 4FKLA 3QZGA 4W4WA 3GEQA 5ANEA 5FG8A 4YHFA 2LAVA 2XYNA 2R3QA 2WGJA 1FVTA 3LJ0A 4RPVA 3FKOA 2JY6A 1FMKA 5IEYA 3QCSA 4EOJA 5CTPA 2YIWA 2BTRA 3C5UA 1XQZA 5AV0A 3EQHA 3FQHA 4CO7A 4NSTA 1NA7A 2GCDA 3O17A 4W8DA 4P90A 4M8TA 3PLSA 2C6OA 5DR9A 5C03A 5BQ0A 5GMVA 2BRBA 2QHMA 3ENMA 3IECA 3NRMA 2BAKA 3POOA 5EKOA 3TV4A 3LJ3A 5ETAA 4W9HA 2JKKA 3G6GA 2R9SA 3T9IA 4FTJA 3I6UA 3ZNGC 1OIYA 1DI8A 4QRCA 3LE6A 2YJSA 4DXAB 5L8LA 3GCVA 4FEXA 2PE1A 4BC6A 1NVRA 4EKKA 5GJGA 3KRJA 3EQDA 3KCKA 2DZJA 1G3NA 3I5ZA 3V6SA 4QPMA 5CHVC 4FVPA 3JW0X 3D5VA 2B4SB 1YOLA 2OG8A 2I0YA 5DOSA 5HHWA 4HDOA 3VXWA 4X57B 3BYMA 3OMVA 4BDFA 3ZDUA 4MELA 4ZY4A 4LOOA 2C3KA 5AA9A 4L3PA 1I09A 2BYEA 3NZSA 4FKTA 3T9LA 2BUJA 5DEYA 2XNOA 3OWKA 1F3MC 2C0OA 4YJTA 4BGQA 4HW7A 2QOOA 3AGMA 4M68A 4C33A 1WXVA 3DBSA 4J96A 4L00A 4MBLA 2ITQA 3UIPB 4DFUA 4DWFA 2KZRA 4DFLA 2F57A 5HI2A 3OHTA 2BHHA 4DEIA 4EK6A 2CHLA 2OJJA 5BPYA 5JH6A 1FMOE 5KMLA 1RRBA 4NAWB 4QMQA 2PUPA 3EQIA 4MXOA 4RJ5A 4AA5A 4B6LA 3F7WA 4JQ7A 4Z55A 3G15A 3TTJA 3KF7A 3MY0A 2P2HA 3PGEA 2PVJA 3O23A 4DDID 1DM2A 2HIWA 3QRJA 4EQMA 3DV3A 2OJ9A 4OGRA 3GXLA 4RZVA 1WMHA 3NW5A 5I0BA 4NIFB 3CSFA 1SVGA 4L53A 1Y6AA 4AOFA 2J5FA 3G9LX 1S3SG 4AFJA 3NNVA 2QLUA 1OKWA 3OCSA 1Q61A 3PVWA 4MXCA 4QMVA 5HKMA 4FIGA 4MNEA 4QYGA 4O86A 1GJOA 5J7HA 3PJ3A 2BZHB 4CFFA 3B2TA 3PVBA 4O1PA 4QQ5A 1TQPA 2RFSA 4R78A 3RI1A 4TV3A 4WWPA 4IVDA 2XRUA 2VGOA 2VO7A 4CLIA 4WSQA 3RPRA 2N1WA 4XG2A 4U44A 5AIRA 4N9F4 4FKRA 4UXQA 1WMHB 3V51A 3CJGA 2DZMA 2CKPA 3IPHA 4ZSLA 4F63A 4RX5A 2XEYA 4RC3A 2Y8OA 5ANJA 3L9LA 2YEXA 4ALVA 1H25A 3C13A 3P5KA 4D2PA 4FICA 4EKLA 3L16A 3DBFA 3DQXA 2QR8A 3V6RA 2BYVE 4AS0A 5LWNA 2OIBA 3G9NA 3QWKA 4G9CA 4GJ2A 2FIDA 1OBGA 4K1BA 2PZPA 4XH6A 4O2ZA 4NM0A 1YOMA 4G9RA 5FBOA 2G4SA 3KUZA 4BFRA 2ZNVC 4U45A 4F8CB 5JT2A 4WUNA 2RG5A 3VBVA 3LFSA 4S34A 3PY1A 3AC5A 3KGAA 4QMWA 4RC4A 4CFVA 2J2IB 3QX2A 4KS7A 4EI4A 5GHVA 2CCHA 1Q8WA 2YERA 3VHEA 2OOBB 3WILA 5AADA 4G0NB 3QRKA 4EZ7A 3U4UA 4D5KA 5A14A 1H01A 2UZEA 4IAKA 4FHKA 3TJPA 5HG9A 4LGHA 3LQ3A 1M2PA 4FODA 1WVXA 1GIJA 5AWMA 2BF8B 4V01A 3W16A 3F9NA 2X81A 3JUHA 3H9FA 4FUYA 4MCVA 3H30A 1HCKA 3LCOA 4N6ZA 4WNMA 4YC6A 4JDJA 3CPCA 5CVHA 2BGFA 2LGDA 5AZFA 3DTCA 4UMPA 2BRHA 4CFWA 4S30A 4MHAA 4BCFA 1QPDA 4TWCA 2ITWA 4YJNA 3ZLYA 3ZZWA 4BKJA 2IYDB 2J0KA 3BYVA 3G2FA 4E5WA 4WWNA 2ITOA 3G33A 4C3PA 2GS6A 2GS7A 2JGZA 2Z8CA 4IM0A 3ZUTA 1QMZA 4M69B 4DH7A 4F7NA 3DKGA 2X7GA 4JAJA 2YIXA 3LCTA 3ORIA 4I92A 4QP6A 5LMKC 5C23A 3LVPA 4IIRA 2KJRA 2VNWA 4ENXA 4MWIA 3OLMD 4DE4A 4ZY6A 3R7IA 4W4XA 3UZRA 4NCTA 3BY4B 2PZYA 3HZTA 3NSZA 3OT3A 3JVRA 3PZHA 1FPUA 3Q60A 5CU3A 3DLZA 2CN5A 1GZNA 2Z02A 2J4ZA 3FKLA 5AMNA 3QXPA 3CBLA 3RTPA 3HP2A 3WF5A 1AQ1A 3Q6WA 4BWPA 2ZNVB 1W82A 4BDDA 2QOLA 3F3TA 4QMTA 1UGMA 1O6LA 2IW8A 3ODYX 2KDBA 1M2QA 2OH0E 3MDYA 1WGRA 3VAWA 5A6OA 3VJOA 5ITAA 1CM8A 3NYNA 4EORA 2ETKA 3W33A 1ZYLA 3GC7A 2OICA 4DYMA 3TBLD 1MRUA 2Y0AA 2CU1A 4YJPA 1OL6A 4GKHA 1S9JA 3PS6A 3VTWA 2BRNA 4ZAUA 1BLXA 1V81A 5J9LA 3MFUA 2PVHA 3MH1A 2MQJA 4PMMA 4JI9A 4XMOA 2YIRA 3IW8A 3ZC6A 2KX0A 1QCFA 3W8LA 4W9FA 5EFQA 3EFJA 4LRJA 4U0IA 4RT7A 2OK1A 4QD6A 2CMWA 4LV8A 4ZTSA 3W2PA 4QQTA 3L13A 4LJPB 3Q3JA 3R00A 2ZV2A 3R8PA 2VD5A 1V86A 1CKPA 3C4CA 2RIOA 5LLIA 4O0RA 3R21A 4D4RA 4BKSA 3QHRA 4AZFA 4UMUA 2I6LA 4BHNA 1U4AA 2ASQA 4E6CA 4NFNA 3MBLA 3L08A 5L2IA 2JIVA 1JSTA 4B6WA 4Q5EA 1E8WA 4U6RA 1ZLTA 2E9NA 4BBEA 4MSMB 1PQSA 4IZ7A 3LCKA 3H7PB 4DHJB 5IF1A 4DK5A 1W8CA 4X3FC 2N7DA 2X8EA 4BI2A 4F9CA 3PRIA 1EO6A 3MTNB 3N32A 3GU7A 1J7LA 2NRYA 3WF8A 4PDOA 2L8JA 2IO0B 3ANRA 4GW8A 3SHEA 1UA2A 3EJ1A 2R0IA 1YI3A 3R28A 1WJ4A 5I9VA 3QCAA 3ORXA 3DK6A 5ACKA 3AD6A 4ACGA 3ZTCA 1PXMA 4CYJA 2OKRA 4F0IA 2DHZA 2G2IA 1A48A 4ZMFA 3DDCB 1GZOA 3QIJA 3AC3A 4TWNA 2C5YA 3QUEA 1H28A 5ANGA 2IZUA 3HEGA 3PA4A 2ZOQA 2BWFA 2WMWA 4IANA 1FVVA 2FSMX 4GSBA 3BGZA 4TYJA 5LCKA 2W06A 2HZNA 3PIXA 4L7SA 4K77A 5IMXA 3A9JB 1WZYA 4AWJA 5C4KA 2X39A 2BPMA 2XM9A 4FT5A 4FYNA 4FL2A 2GMXA 4RWJA 5AP4A 2IW9A 2FIFA 4LL0A 3AC4A 4EYJA 3RK7A 4JL9A 2WTJA 4FNZA 2HZIA 4M14A 1P3QU 3W1SC 1P9DU 4O0TA 5DR2A 1WBPA 5D10A 5CU2A 4BBMA 1BKXA 4BYJA 3QTXA 2B0QA 1XH5A 2YITA 3PZEA 2DAFA 2W1ZA 1E9HA 4ZY5A 2L76A 1M17A 4KNBA 3PDTA 2QLQA 3HV6A 4QPSA 5A4QA 3QD3A 1WJUA 2KFJA 3ZBFA 3COIA 3ORNA 3OOMA 4KKGA 4NK9A 3UYSA 3EB0A 3S2PA 3GVUA 4UWCA 5DT0A 1URWA 3O8PA 3R8VA 3ITZA 3MH3A 4GDKA 2Q0BA 2O63A 5HTIA 1P4FA 2AYPA 5EK7A 2XK7A 3DOGA 3SW4A 3L0WB 3GUBA 4P5QA 3A9KB 4DTBA 1E1VA 4BDGA 2QO7A 2XS0A 5DT4A 3DFCB 3VIDA 4O91A 4GGQA 4HVBA 3NUXA 2BFXA 3FZRA 3ZRCA 4PMPA 3OUKA 3M95A 4I20A 3R2YA 2PVNA 1NBFC 3R22A 4WNKA 3AD4A 4GMYA 4E8AA 2EB2A 4K7UA 3BLQA 1Q97A 3QZIA 3ZEWA 3V5JA 3VUYA 1LPUA 3IW4A 2O2VB 2PMLX 3HMNA 1P2AA 1WBSA 2OZAB 5AR7A 3PXKA 3EN6A 4BCOA 3OWJA 5JN2A 3TACA 1SGHA 3MJ1A 3QYWA 2BZIB 4RLLA 2BPSA 2ZVAA 1PW2A 2OIQA 3PHXB 3A7IA 4FSRA 1P14A 5KMIA 1V5OA 1WI0A 1DI9A 3ENEA 4EFOA 2NNWB 5DIAA 1L8TA 1NXKA 3AT4A 2QG5A 2C60A 4CYEA 2GFSA 3CTJA 1BT0A 4AA0A 2C4GA 2MSED 5CZIA 4RRVA 2PE9A 4BCIA 4ZOGA 3PA3A 2WTIA 2O64A 4C36A 3D4QA 2BHEA 3BBWA 4OR5A 4R7HA 5HTCA 2UZTA 4IAAA 4BWKA 2XH5A 5E8YA 2QOHA 3CKWA 1ZYJA 3PJCA 3QQHA 2Z60A 3GU8A 5E8WA 2ITXA 3K54A 1REJA 3CKXA 3PPJA 1E8ZA 3APFA 2YAKA 4KWPA 4J98A 3KREA 2HW7A 2BIYA 3NCGA 3ECIA 4AGUA 2C5NA 1BL6A 2C6MA 3DXPA 2B55A 3FLSA 4KIKA 4GU6A 2ACXA 4I4EA 5HX8A 2MP2B 4I6NB 4FC0A 2YLEA 2RFDA 5GZ9A 4ZEGA 4FGBA 4M97A 5BUJA 3APCA 4FJZA 1LUFA 3ZNHB 4C4EA 1KOBA 1IASA 3GGFA 2OXYA 4FSTA 3C4XA 4ASXA 4BRXA 2AUHA 3OXIA 2AYOB 3R30A 4QMYA 2D2QA 4AT5A 4R3PA 2M0XA 4GKIA 4FL3A 4OW8A 3QD2B 2JD5A 3ELJA 4QTCA 1LXDA 4QP2A 5T6KA 4DCEA 1FGIA 4ACHA 2YLMA 3BINA 4PL3A 3CF6E 2R3OA 1OPJA 4W4YA 1K9AA 3QQJA 2QQ7A 4CFUA 1OPKA 1OUKA 4DEBA 3DPKA 2CHZA 2J7TA 2QOCA 4C58A 2CS4A 1W7HA 3K5UA 4I6FA 5HCXA 2QKWB 2GHGA 2W99B 4XOYA 4RA5A 5C9CA 1ZYDA 3UBDA 2CGVA 3FPMA 2XK8A 3PSEB 4ACDA 5DR6A 3KVWA 3QQGA 5H3QA 4FADA 2YM4A 5E6NA 4NTSA 3V8SA 1W98A 4FG9A 4I1ZA 4WUAA 5AM6A 2F9GA 2YZAA 3GC8A 4J8MA 3ZS5A 3LQ8A 1VD2A 2K6QA 2RSUA 4G50A 5IQCA 4ZTMA 2R0UA 3HV4A 2XBBC 4ZTRA 2H9VA 4TNDA 4TXCA 4G6LA 5HIBA
chains in the Genus database with same CATH superfamily
4O38A 5EE1A 1H24A 2MHJA 3RPOA 4FTUA 4AAAA 5EW8A 2C6EA 2XA4A 4DEGA 2BKFA 3HAHA 5BNJA 3DWMA 2PMVA 2YDIA 1XH7A 1J7CA 3QC9A 4DHZE 4EK8A 3NLBA 3C1XA 3C4EA 5D12A 3RNIA 2AL6A 3MWUA 2Z7QA 4WJPA 1R5EA 1ZRZA 3B0AA 4WD5A 1ZP0B 2I0EA 1ZDXA 3FXZA 2CGWA 3ORZA 1TZ1A 4X3JA 3MYGA 1PY5A 3ZEPA 4KDIC 5HBHA 3HVZA 1CZPA 2WEIA 4A4LA 4IWOA 2YABA 5F94A 2VTNA 2YDJA 5KMNA 4GFOA 2KC1A 4XDDA 4LDTA 1LQ7A 1OVEA 3FUPA 1CMXB 2O3PA 5AEPA 2JNKA 3TIXA 1IA9A 4RG0A 4A4XA 1FFUA 4ITIA 2CNVA 3DGKA 2BVAA 2XNNA 4BBNF 3VF9A 2CDZA 4XBUA 2VZ6A 4DN5A 1E2UA 2UW5A 4TYHB 4EQCA 5C27A 3KVXA 3KY2A 1W0XC 1JW9D 1UELA 4KGSA 4EZQA 1TQMA 3UO6A 2D4CA 4C4VA 3AU4A 1DAYA 4RIWA 2QCSA 1NI2A 3W0RA 4AACA 1OL5A 3Q84A 4FTCA 5TKYA 3RINA 2W4KA 2BILB 4FSQA 4UEUA 3NUHB 3RPVA 4O4FA 5J9ZA 1KH0A 3AEAB 3GC0A 4W9IA 5M08A 4QNAA 4AZBA 4UB7A 4Q2JA 5AR3A 2PUNA 5FLEX 2ZW0A 1TQWA 5EHOA 1ZY5A 2PMRA 4FV5A 3LXFA 3UC3A 4O84A 3POZA 4E6DA 3OWEB 4UDUC 4C34A 4LUEA 3MC0B 3UGBB 4C35A 1P98A 4KS8A 3H1UA 2X1NA 4RIOA 3SXRA 2HY0A 4CCBA 2J9MA 3DZQA 3EIDA 3Q96A 3FBVA 2FO0A 4ZJVA 2HXQA 4PDSA 1Q8YA 4WJNA 2JIUA 3OEFX 1QOAA 3LXNA 3RK9A 1WX9A 3MVLA 3P4KA 4GDKB 1CKIA 3OXTA 3EQCA 3W2OA 2GA9D 3VUWA 5EI6A 4ANXA 1M14A 3AMYA 2FCQA 4REZA 1H1PA 3GZNB 4H39A 1JRPA 3IXSA 1I4DA 2C5XA 1XMLA 2IBIB 4EH4A 4LDTD 2NPTA 4TMAB 4ZYSA 3O7LB 1YIWA 3IK3A 2QIEB 3OG5A 2XF0A 3NNUA 4O7ZA 4FLHA 3L9NA 4AJYB 4I23A 4TKSA 3UZTA 3E3BX 5FP5A 3PRPB 3KFAA 4RWIA 1XH6A 5J18A 5LXMA 5FM2A 1J1CA 4A9SA 3RCZA 1L4DB 5JGBA 3QHTA 4RA4A 3P4RB 2ERZE 4HVGA 4DFZE 3QTUA 1HCLA 3G51A 3IDBA 2N0SB 3BL7A 2G15A 4JRNA 3W55A 2UYZB 5IUGA 2KD0A 4BR3A 5L8JA 2FNJB 1KLGD 2XUUA 4K11A 1WZ3A 1PDXA 2Y5CA 3D2FA 4JNFA 1VJYA 4XLIA 1XH9A 1PXPA 4FTKA 2PL0A 2BAJA 2F2UA 3FMNA 4N59A 1U54B 3NHEB 3WYYA 3W1SA 3LAUA 1HTOA 2K39A 1X8BA 1BMLC 4M15A 1K8RB 4KV2A 4TWPA 2ZB0A 5JGAA 1AWDA 3QX1A 4ALWA 5LNK1 1RWSA 1XLPA 2LGYA 2KTRB 3AKLA 4KA3A 3BE9A 1T0YA 4YSJA 4QTEA 1GAGA 3ZFMA 4RMZA 2RPVA 1PXOA 2NS5A 4RNAA 1XCTL 4NW5A 4LQMA 1E5WA 2ZB1A 4G17A 2JYEA 4LNOA 1NYQA 3LOKA 5A4TA 3VDZA 3E56A 3FKNA 1FM0D 4K18A 5HEZA 2QKWA 4D58A 3OROA 4H2AA 3DDGA 5J2RA 2KMMA 3AKKA 3KC3A 3ZJTA 3WE8A 2X0PA 5CNOA 4Y8DA 4WHZA 1KE9A 1NYRA 5M4UA 1B38A 3CQWA 4LM5A 3DBCA 3COMA 2F7QA 4HDQA 4EZXA 3WCQA 3N3KB 5AFVA 4I21A 2REXA 4AVMA 2WXJA 3BWUD 3KK9A 3ODZX 4URKA 3IONA 4MAOA 5AR2A 4BFMA 4FJVA 2P3GX 2HXLA 3QTIA 3BVZA 3HK0A 2C1AA 2XNMA 4LCDE 2LXAA 4KIQA 4G6OA 3J9CA 4JWCA 4YPDA 4EZJA 4U3YA 5IU2A 1BI7A 3UPZA 4JDIA 3ORTA 4YZDA 4ZDVA 1YWVA 4NUSA 5I4NA 3LLTA 1CKJA 2WQBA 1SSNA 4JNWA 3E62A 5FTOA 3R9DA 4F9WA 4USDA 2I1JA 2WXMA 3O3NB 4BCPA 5CF8A 2LJIA 4E26A 3DX0A 4GYIA 5KMKA 5ANDA 4EK3A 3KUDB 4PNIA 3KA0A 4RIXB 3KXXA 4DTKA 1WDZA 4HYSA 4A9AA 1VYWA 4L43A 5JSMA 1GOLA 2XK5A 3F82A 4RWKA 1YJIA 4KIOA 2XIRA 3WAPA 3JS2A 2PMOX 2WU6A 3D5WA 3IKAA 1SIJA 3CIRB 2LASA 4RIWB 3OHXM 4JQEA 1TS4A 3D83A 5LOHA 3R63A 4O96A 1ZMUA 1SE2A 4F0FA 5KBRA 4XWWA 2ERKA 3RNAC 4OZCA 4I1QA 4J53A 4KX6B 4ASWC 4L45A 5FKAC 3BV2A 3H10A 1U54A 1V1OA 4FM3A 4NSWA 3FMLA 5EHYA 4YWGG 1YW2A 1JPAA 4XCUA 2BDJA 3O7LD 1FXTB 4NKAA 1F9JA 4UN0C 3ORLA 3R7RA 4R5SA 3V5LA 4ZTQA 1TQSA 4ZJIA 5BYRA 3S0OA 3PP0A 3FAAA 3R7VA 3FYJX 3ROCA 3AMBA 3F6XA 1FIQA 2B3AA 3A60A 5C8KA 2WYIA 3UITA 3UVQA 2CKEA 2OZNB 4GCJA 3TCAA 5FXRA 1SEBD 3B1LX 2CSNA 3ZRKA 4EZTA 4DINA 2YFXA 1H08A 2PWLA 1Y2OA 3RALA 4CVAA 1G8JA 5CF6A 5EW9A 3B2FA 3IG3A 2XK4A 5HHDG 3DX3A 5AV3A 5IH5A 3DBEA 3PG1A 2R2QA 3AC1A 2R4BA 4LMUA 2PK9A 3DKCA 3KK8A 2C7HA 4DG0E 4GB9A 3ERCC 2AWTA 5CNNA 1KLUD 4K3BA 3ACKA 3RZWC 3WZJA 4DDGD 1GZ8A 1WF9A 1EU3A 3KKVA 3WZEA 5CSPA 4Y72A 5HO7A 4XG8A 1GNGA 3QK0A 4WA9A 5EDPA 2ZJWA 1GIHA 3VS6A 4DQOC 4L7FA 5E8UA 4AZSA 3C0HA 1OGUA 4EHGA 5CF4A 4P16A 5EG3A 2VWIA 3E5AA 4NM7A 2WDQB 2CN8A 2BAQA 3DBDA 2VTRA 3ML8A 4JG7A 3UGCA 2W4JA 1TFFA 4TY1A 5M07A 3L1SA 3RZBA 3E87A 3WIMA 4FGRA 3M11A 3R1SA 1MI0A 4KGTA 2VN9A 5CTRC 3TJCA 3GQIA 4PDPA 4CV8A 4AW1A 1H1SA 3Q2AC 1R39A 3P4QB 4WT6A 4Y95A 1ZDVA 1ZXHA 3SG8A 2F49A 4GUBA 4D2KA 3L8XA 3UQCA 3PSDA 2X0QA 3PVLA 4EONA 1HQRD 4OT6A 1DYQA 1KLVA 3VH3B 4I6HA 2X8XX 1XO2B 1E0ZA 4F0GA 4YZNA 3ZZEA 2QDFA 5AX3A 3F2NA 4CKJA 2B1PA 1XBBA 1ZMWA 2ZV9A 3PRMB 3QA0A 4FXCA 1NI3A 2O0UA 4Q9SA 3ZO5B 4HPMB 1UBQA 1YI6A 1GJZA 5C8NA 3UQAA 2GNGA 4AT3A 3TNQB 3BWJA 3Q8CA 4I94A 1VZ7A 4R3DA 3ERKA 3IDCA 4EL9A 2CHWA 5BVNA 3RI7C 1ZOEA 3UQGA 3AN1A 3RVGA 4XG7A 4NWMA 3HA6A 3G90X 4PQNA 5A4EA 4M8MA 5AP1A 5K4JA 1CK1A 2MWSB 4L44A 1V9JA 2X0GA 2IPKD 3M2WA 4GMVA 3NFGB 1V1PB 3KF4A 3OCGA 3S3IA 1GNUA 1M7NA 4PP7A 4DEAA 4U5JA 3QAQA 3W2QA 3F69A 4H3PA 2RD0A 1NEKB 3KQ7A 1UUPA 2PKOA 3W2RA 2NBVB 3A1QA 3A33B 3Q6UA 1FMAD 2Q5WD 5D3DA 3E8DA 1ZUD2 4IKGA 4E74A 5D3IB 2V1YA 3REPA 4TQ1A 1OKYA 3NIEA 4FKOA 3SXSA 3U87A 3VNTA 4F64A 1PJKA 4F9BA 4BCNA 4FV4A 2ZAZA 4RX9A 4ASEA 4YJQA 2J7QB 5LVLA 4D55A 3V5WA 5E4HA 4YJOA 4LNFA 2B9JA 3BWFA 3CPBA 4BN1A 3PVUA 3LMIA 4ZTNA 2XIZA 1TS2A 1V0OA 3Q32A 5FBNC 2MCNB 3EFUA 4JIKA 5JH5C 1Q24A 2XKDA 2G4DB 4BBNC 2PPHA 2XEZA 5HE0A 3V61A 4D5HA 4I0SA 5CENA 1H07A 4W9CA 2B7AA 4EOQA 5D7AA 4C4FA 4GXBA 4MWHA 1J91A 1W2CA 4FTLA 4XBRA 5G2NA 2BZKB 5JRQA 3VWAA 3MGYA 5KHWA 5IA2A 3SRVA 4BGGA 5TOZA 2LUEA 4BDAA 2YWPA 1N62A 1JAMA 2OJFE 2VTIA 4YJUA 1XT9B 2BDFA 2P4IA 4MNEB 1YXTA 4AZ6A 4E3CA 1TQTA 3DWGC 4RMAA 2BTEA 3UNKA 3LFFA 1ZWSA 1TQUA 1WVYA 3QE6A 2J6MA 4AG8A 3UDSA 3QU0A 1UU3A 3H9DA 1WE7A 4R5KA 1JRUA 4BBFA 3IBEA 2BB5A 3D51A 4E7WA 4R3CA 2ZDTA 1HOWA 5EHLA 2EXMA 3QWJA 3SHQA 1DKXA 3VRZA 4PX6A 3PXYA 4YTMB 5DRDA 4U81A 4FTRA 3IQ7A 2J4XA 5K5XA 3V3VA 5D1JA 2W1GA 2WAJA 4EZLA 3HMIA 5FXSA 5CAPA 1IG1A 1YHVA 4W9KA 3CGFA 3AG9A 4A9TA 3UO4A 3Q9XA 5HG2A 3IOKA 3GZNI 5CEIA 2FSLX 2WIPA 3JY9A 3KIOC 2J0MB 4RVTA 1IAHA 3W5VB 4CQNA 3FAHA 2KWUB 3GCQA 1ERKA 1R34A 4MH7A 4LDTB 1OPLA 1YWRA 5HBEA 4C61A 4BVUC 4C37A 5EQPA 3WA0A 1UBIA 1M4VA 3HM6X 4O7RA 5DCNA 2X9FA 4FYOA 5JMSA 2W4OA 5TT7A 5CEOA 3M62B 5A4CA 4ANOA 3LMHA 4RIYB 4PYUA 4MKCA 2JPHA 1ND4A 2MRPA 1FNVA 4G3GA 1J19A 3GCUA 3R1YA 2LHDA 5EM8A 1JNKA 2GTNA 5D2MB 1MUOA 2QMTA 4LMNA 2I40A 4ANLA 3DTWA 3VW6A 2YACA 5KBPA 3N1YC 3KB7A 2QI8A 4WRSA 4EJ7A 2ZW1A 3HRBA 3TN8A 4FEUA 3WF9A 2LD9A 1BUIC 4GJ3A 4HJOA 2OXXA 5M56A 4DGNA 1KUTA 4JMQA 4II5A 4BNEA 4HR1B 3GOEA 1A70A 5AAFA 4NJCA 3C8YA 4XUFA 1T46A 5EYDA 4UZDA 2R3IA 4TYGA 4IX4A 3D52A 4DHFA 4JWIA 2D5GA 3NVZA 4HXDA 1GC7A 5IH4A 4F6UA 4V0GB 5JFSA 2CKOA 5EOBA 4CCUA 5C26A 1Q10A 1H8CA 2VWYA 1S1QB 1K53A 3WOWA 2L7RA 2W9NA 3NVKI 2L0TA 3F88A 2P55A 3FYKX 3LM0A 3ZOSA 4DYLA 3MB7A 1STEA 4AZ5A 5AUZA 4RJ4A 2XK3A 2X8DA 4O2PA 5GJDA 1RM6C 3D32A 3X0WA 3AB5A 3R66C 5BMHA 3NAYA 2XKFA 2YJRA 3T8OA 3EJTA 4IUMB 3FMEA 2CJOA 5AV2A 4O7LA 3R8LA 4IWPA 1S9IA 3NMUF 4WNPA 5CZHA 1C77A 2NYAA 5IEVA 4BZDA 3RWQA 3VUDA 1EH4A 5IKCM 2FH9A 1FGKA 3LQ5A 4R5LA 4G31A 3AC2A 4OBPA 3AT3A 4OT5A 4CNHA 1J1BA 2EXCX 1F2RC 5DFPA 4XP0A 3RP9A 1I42A 3FV8A 4IB5A 2DWQA 4QP7A 1JWBD 1HZ5A 1P4OA 5TSSA 5BMSA 3CLYA 3AU5A 3RMKC 2KHOA 4QPAA 1AARA 4WQMA 3SA0A 4HGSA 4IZ5A 2FSOX 4CHKA 1EWCA 4GG5A 2ITTA 3MFSA 4RQKA 3HGKA 2WOUA 3R7OA 4E4NA 2JBPA 4CEGA 2B76B 2C9WB 3ZIMA 4WG3A 2VTHA 2P2IA 2W5HA 2E9VA 2B53A 4XJ0A 5JZNA 3GU6A 3KUCB 4A3PA 4JS8A 4TL0A 4N70A 1JOWB 4D0XA 4I6LA 2N4FA 3BELA 4DAWA 1IRKA 3OFMA 2KXJA 3A4PA 3AULA 3JSVA 2K25A 3E92A 2A4LA 2OJGA 3EWHA 4NY0A 2QOIA 3UDBA 2OZOA 4EH2A 1TBEA 3DVNV 2JKQA 3PFQA 5D41A 5DG5A 1N61A 4CFNA 4LUDA 4QQCA 4BI0A 4CSVA 3TT0A 5CXHA 5C2TB 3AI5A 1QPCA 4BTKA 1E7VA 2IJMA 4WRGA 1W2DA 4LOQA 5HD4A 3TCPA 2ETRA 3K9PB 4CQEA 2PEAA 4AZTA 5KMOA 5BX0A 3NS8A 3MW1A 5CT0A 4KKJA 4OLIA 2QOFA 1R0EA 3VRAB 5DNRA 3FHIA 3FLNC 1BMKA 4YJVA 1QQRA 3PJ1A 2ESMA 2H6DA 5L95C 1FXIA 2UZNA 3BLBA 4P2KA 5IH6A 3ET7A 3ZM9A 3C50A 4S31A 2UW9A 2AL3A 3LLAA 4I24A 1EF5A 4B0EA 4CQGA 3ZRFA 4UDYX 3NVWA 4ITJA 2R2OA 3ZRMA 3NZUA 1OIUA 2PW9A 4FTMA 2JITA 2UV2A 3LB8C 4S33A 1E7PB 4CMUA 2W1FA 2C7NB 4C8BA 2QOBA 3A7FA 4L68A 4X21A 5M55A 5CI6A 5DI1A 4NPHA 3SLSA 1G8AA 2X6DA 4JGHB 2G1EA 2VX1A 4ORKA 3W0QA 4L67A 3LFAA 3MFRA 4ZS0A 3DOWA 3VH4B 3VUMA 4MD8E 3VBTA 4IDVA 2MJ3A 3V8TA 2PTLA 2V55A 4C62A 2MP2A 1WBNA 1F5QA 5FTQA