4FM3A

Crystal structure of a duf4398 family protein (pa2901) from pseudomonas aeruginosa pao1 at 2.47 a resolution
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
95
structure length
95
Chain Sequence
GDPAPLEQMRLTEQALEQAKAVGATDDVAELKLAQDKYAAAQIAMTAESYKKARLLAEQAELDARLAESKVLTQKSKDQLGELDKSLKRLRKQLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized hypothetical protein
publication title Crystal structure of a hypothetical protein (PA2901) from Pseudomonas aeruginosa PAO1 at 2.47 A resolution
rcsb
source organism Pseudomonas aeruginosa
total genus 40
structure length 95
sequence length 95
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14346 DUF4398 Domain of unknown function (DUF4398)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.390 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4fm3A00
4FM3A
chains in the Genus database with same CATH superfamily
3GI7A 2YL5A 2N3KA 3D52A 3L3PA 2O0I1 3VKHA 4FZOA 4JWIA 2Z0VA 1I4DA 4WPEA 1QX1A 3CVRA 1E2UA 4AZ5A 1YWMA 1X04A 2YL6A 1ZWWA 3O3OB 3Q84A 2JNSA 3VEAA 4AZHA 2FICA 3DYTA 1OA1A 3DX0A 3LLLA 4IM3A 1WDZA 2C08A 3I04A 3F7WA 1E1DA 3OWGA 2Z0OA 5KBPA 4EZSA 4F00A 2QKWA 3O3NB 4EZVA 1OA0A 3DPOA 4IM0A 3EJUA 3ER8C 4JNEA 4AVMA 3BUPA 1O7DC 2YL9A 3DX3A 2EX3B 5FIGA 2YL8A 3CKDA 4G6QA 3UITA 2V0OA 1URUA 3OHXM 2ND0A 1TQUA 4AZBA 4EZOA 4JL9A 3RV0A 3D2EA 4AZGA 4E81A 2OW7A 3ABHA 4DCNC 2D4CA 3KAWA 3B53X 3OK8A 4AZIA 3DDGA 3EJPA 3BUDA 4IW0A 2YIBA 2QXLA 2ND1A 2OO2A 3BVXA 2WYIA 1JQKA 4B9QA 3L3OM 4M0MA 2LXYA 3QNJA 4JLCA 5FLEX 3QNIA 1LQ7A 2OZNB 3EJSA 2RAKA 1I49A 3D4YA 1MJGA 3DPPA 2F18A 1R33A 3KDRA 2Q12A 1GN9A 3RV1A 4EZQA 2YLAA 4JWDA 3I01A 1HWWA 1TQWA 5C5BB 1TQTA 3BVTA 4R5IA 2D1LA 3T49A 3I39X 1X03A 3D2FA 2OBMA 3LVTA 4IWOA 5C5BA 2F1AA 1DKZA 2F7PA 4R5JA 3CZSA 3QWEA 3HAIA 3EJTA 1ZYLA 2LM0A 2EFLA 2RT6A 1HXKA 4FZPA 3T47A 1PS3A 4FM3A 2GAFD 4JN4A 3DPQA 2JNKA 3BVVA 2ELBA 2YIVX 3I2WA 2ALWA 4AZ6A 4WPCA 2X5CA 4BNEA 1O7DB 4R5GA 2F7OA 3QE6A 2PMRA 3BUQA 4ATMA 4EZWA 3VEBA 4IM2A 3FD9A 3BVUA 4HYBA 2NCZA 2WINM 2WYHA 1UPXA 2X3VA 2YI9A 3D4ZA 3BUBA 3HAJA 1SU6A 2EFKA 1DKYA 4KIKB 3EJRA 2F7QA 4EZYA 1R34A 3Q0KA 2GF4A 4UDYX 1OAOA 2YI8A 2Q13A 3D50A 3BUIA 4IWQA 1QWUA 2YKTA 3RPMA 2GA9D 1E9VA 3BVWA 3T4AG 4EZXA 4KIKA 2PY6A 3ZEDA 4PO2A 3SYVA 2RAIA 4AKVA 4H6HA 3DDFA 4H6IA 1DKXA 4EZPA 3DX4A 3D51A 4IWPA 2MI7A 4JWEA 2F7RA 2KHOA 4HY9A 3C7NA 2YLLA 3KAVA 3SOGA 4NSWA 1SU8A 2OBLA 5TKYA 3CAZA 3HAHA 3ACOA 2Z8YA 3ERCC 3CV5A 3T46A 2FYVA 4EZRA 4EZUA 3O3MB 4FZSA 1SU7A 4EZZA 2EWFA 4EZNA 5E84A 1GNTA 4JNFA 4AZCB 4R5LA 1TQVA 4EZTA 1HTYA 1Y2OA 1W9MA 2OW6A 4R5KA 4UDXX 2Z0NA 3B52X 1SUFA 3EJQA 4H8SA 3M3WA 2QFFA 4D8JA 4AZ7A 4NQIA 2X3XA 4AZCA 3B51X 2F1BA 2YIAA 4JWCA 4HR1B 1GNLA 4DYLA 1TQSA 1U00A 4NPHA 3DX1A 2RAJA 3T48A 3QA8A 1R5EA 3G9GA 3DX2A 3LMFA 3A98A 3CZNA 2X3WA 1I4LA 3PLTA 4I1QA 3BLBA 4HR1A 1QWNA 4E3CA 4F01A 3ER9B 2ZXQA 1I4TA
chains in the Genus database with same CATH topology
3GI7A 3DPQA 5TKYA 2N3KA 2YIVX 4IW0A 2YIBA 2QXLA 3VKHA 2X5CA 2Z8YA 4JWIA 2ND1A 3ERCC 3T46A 4R5GA 1E2UA 1JQKA 4B9QA 4EZRA 4EZUA 3L3OM 3O3MB 4M0MA 3O3OB 1SU7A 2JNSA 3QNJA 4JLCA 5FLEX 3VEAA 4EZWA 3VEBA 4IM2A 4EZZA 3FD9A 2EWFA 4EZNA 4HYBA 1OA1A 1MJGA 2NCZA 3DPPA 2WINM 4IM3A 1GNTA 1UPXA 4JNFA 4R5LA 5E84A 2YI9A 4EZTA 3I04A 3F7WA 1W9MA 1E1DA 3KDRA 1SU6A 4R5KA 3OWGA 1DKYA 4UDXX 1GN9A 4KIKB 3RV1A 3B52X 4EZQA 4JWDA 1SUFA 3I01A 4EZSA 4F00A 4EZYA 3O3NB 4EZVA 1OA0A 3DPOA 4IM0A 4UDYX 4R5IA 1OAOA 2YI8A 3T49A 2QFFA 4D8JA 3ER8C 3I39X 4JNEA 4IWQA 3B51X 2YIAA 4JWCA 3D2FA 1GNLA 4HR1B 2GA9D 1E9VA 3T4AG 4EZXA 4KIKA 2EX3B 2PY6A 1U00A 2OBMA 4NPHA 3ZEDA 4IWOA 4PO2A 5FIGA 3T48A 1DKZA 3QA8A 4R5JA 4G6QA 4H6HA 3UITA 3LMFA 4H6IA 3A98A 1DKXA 3OHXM 4EZPA 2ND0A 4IWPA 4JWEA 4EZOA 2KHOA 1ZYLA 4JL9A 2LM0A 3RV0A 3D2EA 4HY9A 2RT6A 3C7NA 4E81A 4HR1A 3T47A 4E3CA 4F01A 3KAVA 3KAWA 3ER9B 3B53X 4FM3A 2GAFD 1SU8A 2OBLA 4JN4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FM3 A; 
#chains in the Genus database with same CATH topology
 3GI7 A;  2YL5 A;  2N3K A;  3D52 A;  3L3P A;  2O0I 1;  3VKH A;  4FZO A;  4JWI A;  2Z0V A;  1I4D A;  4WPE A;  1QX1 A;  3CVR A;  1E2U A;  4AZ5 A;  1YWM A;  1X04 A;  2YL6 A;  1ZWW A;  3O3O B;  3Q84 A;  2JNS A;  3VEA A;  4AZH A;  2FIC A;  3DYT A;  1OA1 A;  3DX0 A;  3LLL A;  4IM3 A;  1WDZ A;  2C08 A;  3I04 A;  3F7W A;  1E1D A;  3OWG A;  2Z0O A;  5KBP A;  4EZS A;  4F00 A;  2QKW A;  3O3N B;  4EZV A;  1OA0 A;  3DPO A;  4IM0 A;  3EJU A;  3ER8 C;  4JNE A;  4AVM A;  3BUP A;  1O7D C;  2YL9 A;  3DX3 A;  2EX3 B;  5FIG A;  2YL8 A;  3CKD A;  4G6Q A;  3UIT A;  2V0O A;  1URU A;  3OHX M;  2ND0 A;  1TQU A;  4AZB A;  4EZO A;  4JL9 A;  3RV0 A;  3D2E A;  4AZG A;  4E81 A;  2OW7 A;  3ABH A;  4DCN C;  2D4C A;  3KAW A;  3B53 X;  3OK8 A;  4AZI A;  3DDG A;  3EJP A;  3BUD A;  4IW0 A;  2YIB A;  2QXL A;  2ND1 A;  2OO2 A;  3BVX A;  2WYI A;  1JQK A;  4B9Q A;  3L3O M;  4M0M A;  2LXY A;  3QNJ A;  4JLC A;  5FLE X;  3QNI A;  1LQ7 A;  2OZN B;  3EJS A;  2RAK A;  1I49 A;  3D4Y A;  1MJG A;  3DPP A;  2F18 A;  1R33 A;  3KDR A;  2Q12 A;  1GN9 A;  3RV1 A;  4EZQ A;  2YLA A;  4JWD A;  3I01 A;  1HWW A;  1TQW A;  5C5B B;  1TQT A;  3BVT A;  4R5I A;  2D1L A;  3T49 A;  3I39 X;  1X03 A;  3D2F A;  2OBM A;  3LVT A;  4IWO A;  5C5B A;  2F1A A;  1DKZ A;  2F7P A;  4R5J A;  3CZS A;  3QWE A;  3HAI A;  3EJT A;  1ZYL A;  2LM0 A;  2EFL A;  2RT6 A;  1HXK A;  4FZP A;  3T47 A;  1PS3 A;  4FM3 A;  2GAF D;  4JN4 A;  3DPQ A;  2JNK A;  3BVV A;  2ELB A;  2YIV X;  3I2W A;  2ALW A;  4AZ6 A;  4WPC A;  2X5C A;  4BNE A;  1O7D B;  4R5G A;  2F7O A;  3QE6 A;  2PMR A;  3BUQ A;  4ATM A;  4EZW A;  3VEB A;  4IM2 A;  3FD9 A;  3BVU A;  4HYB A;  2NCZ A;  2WIN M;  2WYH A;  1UPX A;  2X3V A;  2YI9 A;  3D4Z A;  3BUB A;  3HAJ A;  1SU6 A;  2EFK A;  1DKY A;  4KIK B;  3EJR A;  2F7Q A;  4EZY A;  1R34 A;  3Q0K A;  2GF4 A;  4UDY X;  1OAO A;  2YI8 A;  2Q13 A;  3D50 A;  3BUI A;  4IWQ A;  1QWU A;  2YKT A;  3RPM A;  2GA9 D;  1E9V A;  3BVW A;  3T4A G;  4EZX A;  4KIK A;  2PY6 A;  3ZED A;  4PO2 A;  3SYV A;  2RAI A;  4AKV A;  4H6H A;  3DDF A;  4H6I A;  1DKX A;  4EZP A;  3DX4 A;  3D51 A;  4IWP A;  2MI7 A;  4JWE A;  2F7R A;  2KHO A;  4HY9 A;  3C7N A;  2YLL A;  3KAV A;  3SOG A;  4NSW A;  1SU8 A;  2OBL A;  5TKY A;  3CAZ A;  3HAH A;  3ACO A;  2Z8Y A;  3ERC C;  3CV5 A;  3T46 A;  2FYV A;  4EZR A;  4EZU A;  3O3M B;  4FZS A;  1SU7 A;  4EZZ A;  2EWF A;  4EZN A;  5E84 A;  1GNT A;  4JNF A;  4AZC B;  4R5L A;  1TQV A;  4EZT A;  1HTY A;  1Y2O A;  1W9M A;  2OW6 A;  4R5K A;  4UDX X;  2Z0N A;  3B52 X;  1SUF A;  3EJQ A;  4H8S A;  3M3W A;  2QFF A;  4D8J A;  4AZ7 A;  4NQI A;  2X3X A;  4AZC A;  3B51 X;  2F1B A;  2YIA A;  4JWC A;  4HR1 B;  1GNL A;  4DYL A;  1TQS A;  1U00 A;  4NPH A;  3DX1 A;  2RAJ A;  3T48 A;  3QA8 A;  1R5E A;  3G9G A;  3DX2 A;  3LMF A;  3A98 A;  3CZN A;  2X3W A;  1I4L A;  3PLT A;  4I1Q A;  3BLB A;  4HR1 A;  1QWN A;  4E3C A;  4F01 A;  3ER9 B;  2ZXQ A;  1I4T A; 
#chains in the Genus database with same CATH homology
 3GI7 A;  3DPQ A;  5TKY A;  2N3K A;  2YIV X;  4IW0 A;  2YIB A;  2QXL A;  3VKH A;  2X5C A;  2Z8Y A;  4JWI A;  2ND1 A;  3ERC C;  3T46 A;  4R5G A;  1E2U A;  1JQK A;  4B9Q A;  4EZR A;  4EZU A;  3L3O M;  3O3M B;  4M0M A;  3O3O B;  1SU7 A;  2JNS A;  3QNJ A;  4JLC A;  5FLE X;  3VEA A;  4EZW A;  3VEB A;  4IM2 A;  4EZZ A;  3FD9 A;  2EWF A;  4EZN A;  4HYB A;  1OA1 A;  1MJG A;  2NCZ A;  3DPP A;  2WIN M;  4IM3 A;  1GNT A;  1UPX A;  4JNF A;  4R5L A;  5E84 A;  2YI9 A;  4EZT A;  3I04 A;  3F7W A;  1W9M A;  1E1D A;  3KDR A;  1SU6 A;  4R5K A;  3OWG A;  1DKY A;  4UDX X;  1GN9 A;  4KIK B;  3RV1 A;  3B52 X;  4EZQ A;  4JWD A;  1SUF A;  3I01 A;  4EZS A;  4F00 A;  4EZY A;  3O3N B;  4EZV A;  1OA0 A;  3DPO A;  4IM0 A;  4UDY X;  4R5I A;  1OAO A;  2YI8 A;  3T49 A;  2QFF A;  4D8J A;  3ER8 C;  3I39 X;  4JNE A;  4IWQ A;  3B51 X;  2YIA A;  4JWC A;  3D2F A;  1GNL A;  4HR1 B;  2GA9 D;  1E9V A;  3T4A G;  4EZX A;  4KIK A;  2EX3 B;  2PY6 A;  1U00 A;  2OBM A;  4NPH A;  3ZED A;  4IWO A;  4PO2 A;  5FIG A;  3T48 A;  1DKZ A;  3QA8 A;  4R5J A;  4G6Q A;  4H6H A;  3UIT A;  3LMF A;  4H6I A;  3A98 A;  1DKX A;  3OHX M;  4EZP A;  2ND0 A;  4IWP A;  4JWE A;  4EZO A;  2KHO A;  1ZYL A;  4JL9 A;  2LM0 A;  3RV0 A;  3D2E A;  4HY9 A;  2RT6 A;  3C7N A;  4E81 A;  4HR1 A;  3T47 A;  4E3C A;  4F01 A;  3KAV A;  3KAW A;  3ER9 B;  3B53 X;  4FM3 A;  2GAF D;  1SU8 A;  2OBL A;  4JN4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...