4FM3A

Crystal structure of a duf4398 family protein (pa2901) from pseudomonas aeruginosa pao1 at 2.47 a resolution
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
95
structure length
95
Chain Sequence
GDPAPLEQMRLTEQALEQAKAVGATDDVAELKLAQDKYAAAQIAMTAESYKKARLLAEQAELDARLAESKVLTQKSKDQLGELDKSLKRLRKQLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a hypothetical protein (PA2901) from Pseudomonas aeruginosa PAO1 at 2.47 A resolution
rcsb
source organism Pseudomonas aeruginosa
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized hypothetical protein
total genus 40
structure length 95
sequence length 95
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14346 DUF4398 Domain of unknown function (DUF4398)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.390 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4fm3A00
4FM3A
chains in the Genus database with same CATH superfamily
3QE6A 2F1BA 3F7WA 2QFFA 4AZHA 3EJPA 3EJSA 2X3WA 3EJRA 3CZNA 4R5JA 3I04A 4NSWA 3LLLA 4JWIA 3D4YA 2OZNB 3KAVA 2YIAA 4UDXX 2X3XA 3BVVA 3CVRA 4R5KA 4IW0A 3T49A 4AZCA 3KAWA 3B51X 4AZ6A 1UPXA 2X5CA 2YL5A 2F7PA 2WYIA 4IWOA 2RAKA 3BUPA 1I4TA 2EFKA 2OW7A 4FZOA 2ZXQA 2ND0A 3BUBA 3ABHA 3QNJA 2GAFD 5C5BB 3BUQA 4EZRA 2KHOA 3M3WA 2MI7A 4IM0A 3ZEDA 3QA8A 4IWPA 3L3OM 3OK8A 4JL9A 3VEAA 2EWFA 1SU7A 3OHXM 4FM3A 3ER9B 1SUFA 3I01A 4H6HA 2D1LA 2QKWA 3RV1A 4M0MA 1HTYA 4IM3A 4EZPA 1YWMA 1ZYLA 2RT6A 1TQTA 2FICA 3B52X 2OW6A 2C08A 2O0I1 2YLAA 2EFLA 4AVMA 2YL8A 3FD9A 2YKTA 3VKHA 2WINM 3HAHA 3RPMA 4HY9A 2ELBA 3DPOA 3ER8C 3BVUA 1R5EA 4IM2A 4E81A 2EX3B 3QWEA 1HWWA 5FIGA 2Q13A 4KIKA 1TQVA 2FYVA 3DX3A 3EJTA 4JWDA 4HR1B 2GF4A 4AZBA 3O3NB 4EZWA 2F18A 4D8JA 3DDFA 3O3OB 4R5LA 4AZIA 1URUA 4R5IA 4HYBA 2Z0OA 5E84A 4BNEA 1DKYA 1TQSA 1W9MA 2YLLA 4FZSA 1GNTA 3CKDA 3D2EA 3Q0KA 4AZCB 2OO2A 2JNKA 2N3KA 2YI8A 2YIBA 2V0OA 1DKZA 2F7OA 4AZ7A 2YL6A 3HAJA 4E3CA 2RAIA 3G9GA 3A98A 4KIKB 4EZTA 4F00A 1I4DA 1R34A 1Y2OA 2ALWA 2JNSA 3BLBA 3DYTA 3CV5A 3D50A 4I1QA 3LMFA 4AKVA 2PY6A 2YI9A 3D51A 2Z0NA 3QNIA 1JQKA 1SU6A 3LVTA 1X03A 3DX0A 1O7DC 3DX2A 3DDGA 3PLTA 2F1AA 3DX1A 4JWCA 4R5GA 4EZNA 3O3MB 2D4CA 3C7NA 3ACOA 2F7QA 3BUDA 3D2FA 3BVWA 3Q84A 4HR1A 3D52A 4UDYX 4EZOA 1WDZA 4JLCA 1U00A 1QX1A 1I4LA 3KDRA 4FZPA 4AZ5A 2LXYA 3EJUA 3BVXA 2RAJA 2GA9D 1GNLA 2F7RA 2Q12A 2YIVX 3EJQA 4JN4A 4NQIA 3SYVA 2OBMA 4EZSA 4PO2A 1OA0A 3T47A 1LQ7A 1MJGA 3CAZA 3DPQA 4F01A 1GN9A 2LM0A 2PMRA 1E9VA 4EZVA 1SU8A 3I39X 1OAOA 4B9QA 4JWEA 4ATMA 4EZZA 1QWUA 3BUIA 4IWQA 5FLEX 4H6IA 3T4AG 1DKXA 4JNEA 1HXKA 4WPCA 3T48A 4EZQA 1PS3A 4AZGA 1TQWA 1OA1A 1R33A 3BVTA 4H8SA 4EZYA 4NPHA 4DCNC 1E1DA 3D4ZA 2WYHA 1ZWWA 5TKYA 3VEBA 2Z8YA 3B53X 3GI7A 3DPPA 3L3PA 2Z0VA 3SOGA 2ND1A 3T46A 3UITA 3CZSA 5KBPA 1I49A 3ERCC 2QXLA 3I2WA 4JNFA 2OBLA 1O7DB 4WPEA 1X04A 2NCZA 4EZXA 5C5BA 1QWNA 3DX4A 3OWGA 4DYLA 4EZUA 1TQUA 4G6QA 2X3VA 2YL9A 1E2UA 3RV0A 3HAIA
chains in the Genus database with same CATH topology
3F7WA 2QFFA 4R5JA 3I04A 4JWIA 3KAVA 2YIAA 4UDXX 4R5KA 4IW0A 3T49A 3KAWA 3B51X 1UPXA 2X5CA 4IWOA 2ND0A 3QNJA 2GAFD 4EZRA 2KHOA 3ZEDA 4IM0A 3QA8A 4IWPA 3L3OM 4JL9A 3VEAA 2EWFA 3OHXM 4FM3A 1SU7A 3ER9B 1SUFA 3I01A 4H6HA 3RV1A 4M0MA 4IM3A 4EZPA 1ZYLA 2RT6A 3B52X 3FD9A 3VKHA 2WINM 4HY9A 3ER8C 3DPOA 4IM2A 4E81A 2EX3B 5FIGA 4KIKA 4JWDA 4HR1B 3O3NB 4EZWA 4D8JA 3O3OB 4R5LA 4R5IA 4HYBA 5E84A 1DKYA 1W9MA 1GNTA 3D2EA 2YI8A 2YIBA 2N3KA 4E3CA 1DKZA 4EZNA 4EZTA 4KIKB 3A98A 4F00A 2JNSA 3LMFA 2PY6A 2YI9A 1JQKA 1SU6A 4R5GA 4JWCA 3O3MB 4HR1A 3C7NA 3D2FA 4UDYX 3T46A 4EZOA 4JLCA 1U00A 3KDRA 2GA9D 1GNLA 2YIVX 4JN4A 4EZSA 2OBMA 4PO2A 1OA0A 3T47A 3DPQA 1MJGA 4F01A 1GN9A 2LM0A 4EZVA 1E9VA 1SU8A 3I39X 1OAOA 4B9QA 4JWEA 4EZZA 4IWQA 5FLEX 4H6IA 3T4AG 1DKXA 4JNEA 3T48A 4EZQA 1OA1A 4EZYA 4NPHA 1E1DA 5TKYA 3VEBA 2Z8YA 3B53X 3GI7A 3DPPA 3UITA 2ND1A 3ERCC 2QXLA 4JNFA 2OBLA 2NCZA 4EZXA 3OWGA 4EZUA 4G6QA 1E2UA 3RV0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FM3 A; 
#chains in the Genus database with same CATH topology
 3QE6 A;  2F1B A;  3F7W A;  2QFF A;  4AZH A;  3EJP A;  3EJS A;  2X3W A;  3EJR A;  3CZN A;  4R5J A;  3I04 A;  4NSW A;  3LLL A;  4JWI A;  3D4Y A;  2OZN B;  3KAV A;  2YIA A;  4UDX X;  2X3X A;  3BVV A;  3CVR A;  4R5K A;  4IW0 A;  3T49 A;  4AZC A;  3KAW A;  3B51 X;  4AZ6 A;  1UPX A;  2X5C A;  2YL5 A;  2F7P A;  2WYI A;  4IWO A;  2RAK A;  3BUP A;  1I4T A;  2EFK A;  2OW7 A;  4FZO A;  2ZXQ A;  2ND0 A;  3BUB A;  3ABH A;  3QNJ A;  2GAF D;  5C5B B;  3BUQ A;  4EZR A;  2KHO A;  3M3W A;  2MI7 A;  4IM0 A;  3ZED A;  3QA8 A;  4IWP A;  3L3O M;  3OK8 A;  4JL9 A;  3VEA A;  2EWF A;  1SU7 A;  3OHX M;  4FM3 A;  3ER9 B;  1SUF A;  3I01 A;  4H6H A;  2D1L A;  2QKW A;  3RV1 A;  4M0M A;  1HTY A;  4IM3 A;  4EZP A;  1YWM A;  1ZYL A;  2RT6 A;  1TQT A;  2FIC A;  3B52 X;  2OW6 A;  2C08 A;  2O0I 1;  2YLA A;  2EFL A;  4AVM A;  2YL8 A;  3FD9 A;  2YKT A;  3VKH A;  2WIN M;  3HAH A;  3RPM A;  4HY9 A;  2ELB A;  3DPO A;  3ER8 C;  3BVU A;  1R5E A;  4IM2 A;  4E81 A;  2EX3 B;  3QWE A;  1HWW A;  5FIG A;  2Q13 A;  4KIK A;  1TQV A;  2FYV A;  3DX3 A;  3EJT A;  4JWD A;  4HR1 B;  2GF4 A;  4AZB A;  3O3N B;  4EZW A;  2F18 A;  4D8J A;  3DDF A;  3O3O B;  4R5L A;  4AZI A;  1URU A;  4R5I A;  4HYB A;  2Z0O A;  5E84 A;  4BNE A;  1DKY A;  1TQS A;  1W9M A;  2YLL A;  4FZS A;  1GNT A;  3CKD A;  3D2E A;  3Q0K A;  4AZC B;  2OO2 A;  2JNK A;  2N3K A;  2YI8 A;  2YIB A;  2V0O A;  1DKZ A;  2F7O A;  4AZ7 A;  2YL6 A;  3HAJ A;  4E3C A;  2RAI A;  3G9G A;  3A98 A;  4KIK B;  4EZT A;  4F00 A;  1I4D A;  1R34 A;  1Y2O A;  2ALW A;  2JNS A;  3BLB A;  3DYT A;  3CV5 A;  3D50 A;  4I1Q A;  3LMF A;  4AKV A;  2PY6 A;  2YI9 A;  3D51 A;  2Z0N A;  3QNI A;  1JQK A;  1SU6 A;  3LVT A;  1X03 A;  3DX0 A;  1O7D C;  3DX2 A;  3DDG A;  3PLT A;  2F1A A;  3DX1 A;  4JWC A;  4R5G A;  4EZN A;  3O3M B;  2D4C A;  3C7N A;  3ACO A;  2F7Q A;  3BUD A;  3D2F A;  3BVW A;  3Q84 A;  4HR1 A;  3D52 A;  4UDY X;  4EZO A;  1WDZ A;  4JLC A;  1U00 A;  1QX1 A;  1I4L A;  3KDR A;  4FZP A;  4AZ5 A;  2LXY A;  3EJU A;  3BVX A;  2RAJ A;  2GA9 D;  1GNL A;  2F7R A;  2Q12 A;  2YIV X;  3EJQ A;  4JN4 A;  4NQI A;  3SYV A;  2OBM A;  4EZS A;  4PO2 A;  1OA0 A;  3T47 A;  1LQ7 A;  1MJG A;  3CAZ A;  3DPQ A;  4F01 A;  1GN9 A;  2LM0 A;  2PMR A;  1E9V A;  4EZV A;  1SU8 A;  3I39 X;  1OAO A;  4B9Q A;  4JWE A;  4ATM A;  4EZZ A;  1QWU A;  3BUI A;  4IWQ A;  5FLE X;  4H6I A;  3T4A G;  1DKX A;  4JNE A;  1HXK A;  4WPC A;  3T48 A;  4EZQ A;  1PS3 A;  4AZG A;  1TQW A;  1OA1 A;  1R33 A;  3BVT A;  4H8S A;  4EZY A;  4NPH A;  4DCN C;  1E1D A;  3D4Z A;  2WYH A;  1ZWW A;  5TKY A;  3VEB A;  2Z8Y A;  3B53 X;  3GI7 A;  3DPP A;  3L3P A;  2Z0V A;  3SOG A;  2ND1 A;  3T46 A;  3UIT A;  3CZS A;  5KBP A;  1I49 A;  3ERC C;  2QXL A;  3I2W A;  4JNF A;  2OBL A;  1O7D B;  4WPE A;  1X04 A;  2NCZ A;  4EZX A;  5C5B A;  1QWN A;  3DX4 A;  3OWG A;  4DYL A;  4EZU A;  1TQU A;  4G6Q A;  2X3V A;  2YL9 A;  1E2U A;  3RV0 A;  3HAI A; 
#chains in the Genus database with same CATH homology
 3F7W A;  2QFF A;  4R5J A;  3I04 A;  4JWI A;  3KAV A;  2YIA A;  4UDX X;  4R5K A;  4IW0 A;  3T49 A;  3KAW A;  3B51 X;  1UPX A;  2X5C A;  4IWO A;  2ND0 A;  3QNJ A;  2GAF D;  4EZR A;  2KHO A;  3ZED A;  4IM0 A;  3QA8 A;  4IWP A;  3L3O M;  4JL9 A;  3VEA A;  2EWF A;  3OHX M;  4FM3 A;  1SU7 A;  3ER9 B;  1SUF A;  3I01 A;  4H6H A;  3RV1 A;  4M0M A;  4IM3 A;  4EZP A;  1ZYL A;  2RT6 A;  3B52 X;  3FD9 A;  3VKH A;  2WIN M;  4HY9 A;  3ER8 C;  3DPO A;  4IM2 A;  4E81 A;  2EX3 B;  5FIG A;  4KIK A;  4JWD A;  4HR1 B;  3O3N B;  4EZW A;  4D8J A;  3O3O B;  4R5L A;  4R5I A;  4HYB A;  5E84 A;  1DKY A;  1W9M A;  1GNT A;  3D2E A;  2YI8 A;  2YIB A;  2N3K A;  4E3C A;  1DKZ A;  4EZN A;  4EZT A;  4KIK B;  3A98 A;  4F00 A;  2JNS A;  3LMF A;  2PY6 A;  2YI9 A;  1JQK A;  1SU6 A;  4R5G A;  4JWC A;  3O3M B;  4HR1 A;  3C7N A;  3D2F A;  4UDY X;  3T46 A;  4EZO A;  4JLC A;  1U00 A;  3KDR A;  2GA9 D;  1GNL A;  2YIV X;  4JN4 A;  4EZS A;  2OBM A;  4PO2 A;  1OA0 A;  3T47 A;  3DPQ A;  1MJG A;  4F01 A;  1GN9 A;  2LM0 A;  4EZV A;  1E9V A;  1SU8 A;  3I39 X;  1OAO A;  4B9Q A;  4JWE A;  4EZZ A;  4IWQ A;  5FLE X;  4H6I A;  3T4A G;  1DKX A;  4JNE A;  3T48 A;  4EZQ A;  1OA1 A;  4EZY A;  4NPH A;  1E1D A;  5TKY A;  3VEB A;  2Z8Y A;  3B53 X;  3GI7 A;  3DPP A;  3UIT A;  2ND1 A;  3ERC C;  2QXL A;  4JNF A;  2OBL A;  2NCZ A;  4EZX A;  3OWG A;  4EZU A;  4G6Q A;  1E2U A;  3RV0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...