4FM3A

Crystal structure of a duf4398 family protein (pa2901) from pseudomonas aeruginosa pao1 at 2.47 a resolution
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
95
structure length
95
Chain Sequence
GDPAPLEQMRLTEQALEQAKAVGATDDVAELKLAQDKYAAAQIAMTAESYKKARLLAEQAELDARLAESKVLTQKSKDQLGELDKSLKRLRKQLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized hypothetical protein
publication title Crystal structure of a hypothetical protein (PA2901) from Pseudomonas aeruginosa PAO1 at 2.47 A resolution
rcsb
source organism Pseudomonas aeruginosa
molecule tags Structural genomics, unknown function
total genus 40
structure length 95
sequence length 95
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14346 DUF4398 Domain of unknown function (DUF4398)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.390 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4fm3A00
4FM3A
chains in the Genus database with same CATH superfamily
3SYVA 4EZPA 2X3VA 3LLLA 2WYIA 3EJQA 3RV0A 3I39X 3DDFA 4EZVA 3D50A 3ACOA 5FLEX 3ZEDA 3VEAA 4R5IA 4F00A 4B9QA 2NCZA 4NSWA 5KBPA 4FZPA 4WPEA 2V0OA 1Y2OA 4EZZA 3BUPA 3CZNA 1I4TA 4KIKB 4PO2A 4AZGA 3GI7A 3UITA 4HR1A 3F7WA 2F7PA 3B53X 2MI7A 4JNFA 1TQUA 1E1DA 3FD9A 3CAZA 2OW7A 2LM0A 2YL5A 2OW6A 3RPMA 1QWUA 2PY6A 4JN4A 4IWQA 1ZWWA 3BVTA 4EZRA 3BVUA 4UDXX 1TQSA 1I49A 1DKYA 3D4ZA 4EZOA 1R33A 1GN9A 4H6IA 3OHXM 3D51A 2YKTA 4AZ5A 3LMFA 4D8JA 1HTYA 2YL8A 3CV5A 3D2EA 2RAJA 4AZ7A 2JNSA 4DYLA 1QX1A 2FYVA 1TQVA 2YIBA 1E9VA 3BUQA 2Q12A 3BVVA 4AZCA 3VEBA 3L3PA 3BUBA 2YLAA 2F7OA 3HAIA 1R5EA 2OBLA 5FIGA 1JQKA 3ER9B 3DX1A 3SOGA 1I4DA 3KAWA 2LXYA 2QFFA 4IM2A 4G6QA 4E81A 4F01A 2YLLA 3DX2A 4EZWA 3D2FA 4EZSA 2EFKA 1DKXA 3DPPA 2ELBA 2OBMA 2QXLA 3O3OB 3KAVA 3QNJA 4HR1B 3DDGA 2N3KA 3A98A 3Q84A 1WDZA 2C08A 2EX3B 1SU8A 3LVTA 3CKDA 4EZNA 3BVWA 4E3CA 3EJUA 1R34A 4HY9A 4AVMA 2GA9D 3D52A 3RV1A 3B51X 1SU7A 4AZBA 4H6HA 2JNKA 3I01A 2F1BA 2YL9A 4BNEA 2Z0VA 4JWIA 1OA1A 3CZSA 3DX0A 3QE6A 3T4AG 3PLTA 3D4YA 3T46A 3EJTA 3KDRA 4R5JA 3ERCC 4AZCB 3OWGA 4R5KA 1X04A 4H8SA 3L3OM 4IM3A 1YWMA 3CVRA 5TKYA 1W9MA 1OA0A 2ALWA 4JL9A 4AZIA 1U00A 2YL6A 4IWOA 3VKHA 3C7NA 3DYTA 3ABHA 1O7DB 4HYBA 3OK8A 1SUFA 3BVXA 2D1LA 1URUA 4UDYX 1HWWA 3HAJA 3Q0KA 3EJPA 3T49A 2F7QA 3BLBA 2GF4A 2EWFA 4JLCA 4AZHA 3QNIA 1X03A 2Z8YA 2F1AA 4FZSA 3I04A 5C5BA 2RAIA 1ZYLA 2F18A 2YI9A 3M3WA 2QKWA 4EZQA 2OO2A 2GAFD 4EZUA 1LQ7A 2F7RA 3B52X 2X3XA 1MJGA 3DX3A 1HXKA 3O3NB 4R5GA 1DKZA 4EZXA 2Z0OA 2FICA 2WINM 3ER8C 2Q13A 1OAOA 4IM0A 1PS3A 4NQIA 4WPCA 2KHOA 2OZNB 4KIKA 4DCNC 3I2WA 2EFLA 2RAKA 3DPQA 4JWCA 2ND1A 2YIAA 3T47A 2ND0A 4ATMA 3DX4A 3QA8A 4JWEA 1QWNA 4R5LA 4EZYA 1I4LA 2ZXQA 2YIVX 1O7DC 4JNEA 2O0I1 3G9GA 3O3MB 3BUDA 4NPHA 5E84A 3DPOA 3EJSA 2YI8A 4FM3A 4IW0A 4M0MA 1GNTA 1TQTA 4AKVA 1SU6A 4IWPA 3HAHA 2RT6A 4AZ6A 3EJRA 1TQWA 2Z0NA 3T48A 4JWDA 1UPXA 3BUIA 4FZOA 2X3WA 3QWEA 4I1QA 1GNLA 2PMRA 4EZTA 2WYHA 2D4CA 5C5BB 1E2UA 2X5CA
chains in the Genus database with same CATH topology
1OA1A 3O3NB 4R5GA 2YIBA 1DKZA 1E9VA 4EZPA 4EZXA 3T4AG 2WINM 3ER8C 1OAOA 3VEBA 3RV0A 4IM0A 3I39X 3T46A 4EZVA 5FIGA 2OBLA 2KHOA 1JQKA 5FLEX 3ZEDA 3VEAA 3ER9B 3KDRA 4R5JA 4KIKA 4R5IA 4F00A 3ERCC 4B9QA 2NCZA 3OWGA 4R5KA 3KAWA 3DPQA 4JWCA 3L3OM 2ND1A 2QFFA 2YIAA 4IM3A 4IM2A 3T47A 5TKYA 1W9MA 4G6QA 1OA0A 2ND0A 4EZZA 3QA8A 4E81A 4F01A 4KIKB 4JWEA 4PO2A 4JL9A 1U00A 3GI7A 4IWOA 4R5LA 3C7NA 3UITA 4EZWA 4EZYA 3VKHA 3D2FA 4EZSA 4HR1A 3F7WA 2YIVX 3B53X 4HYBA 4JNEA 3O3MB 1SUFA 4JNFA 5E84A 1DKXA 3DPPA 4NPHA 3DPOA 4UDYX 2YI8A 1E1DA 3FD9A 4FM3A 2OBMA 4IW0A 4M0MA 3T49A 2QXLA 1GNTA 2LM0A 3O3OB 3KAVA 3QNJA 4HR1B 2PY6A 2EWFA 4JN4A 4IWQA 2N3KA 3A98A 1SU6A 4JLCA 4EZRA 2EX3B 1SU8A 4IWPA 4UDXX 2RT6A 2Z8YA 4EZNA 4E3CA 3I04A 1DKYA 4HY9A 3T48A 4JWDA 1UPXA 1ZYLA 2YI9A 4EZOA 4EZQA 1GN9A 2GA9D 2GAFD 3RV1A 4H6IA 3B51X 1SU7A 3OHXM 4EZUA 4H6HA 1GNLA 4EZTA 3I01A 3LMFA 4D8JA 3B52X 3D2EA 1E2UA 1MJGA 2X5CA 2JNSA 4JWIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FM3 A; 
#chains in the Genus database with same CATH topology
 3SYV A;  4EZP A;  2X3V A;  3LLL A;  2WYI A;  3EJQ A;  3RV0 A;  3I39 X;  3DDF A;  4EZV A;  3D50 A;  3ACO A;  5FLE X;  3ZED A;  3VEA A;  4R5I A;  4F00 A;  4B9Q A;  2NCZ A;  4NSW A;  5KBP A;  4FZP A;  4WPE A;  2V0O A;  1Y2O A;  4EZZ A;  3BUP A;  3CZN A;  1I4T A;  4KIK B;  4PO2 A;  4AZG A;  3GI7 A;  3UIT A;  4HR1 A;  3F7W A;  2F7P A;  3B53 X;  2MI7 A;  4JNF A;  1TQU A;  1E1D A;  3FD9 A;  3CAZ A;  2OW7 A;  2LM0 A;  2YL5 A;  2OW6 A;  3RPM A;  1QWU A;  2PY6 A;  4JN4 A;  4IWQ A;  1ZWW A;  3BVT A;  4EZR A;  3BVU A;  4UDX X;  1TQS A;  1I49 A;  1DKY A;  3D4Z A;  4EZO A;  1R33 A;  1GN9 A;  4H6I A;  3OHX M;  3D51 A;  2YKT A;  4AZ5 A;  3LMF A;  4D8J A;  1HTY A;  2YL8 A;  3CV5 A;  3D2E A;  2RAJ A;  4AZ7 A;  2JNS A;  4DYL A;  1QX1 A;  2FYV A;  1TQV A;  2YIB A;  1E9V A;  3BUQ A;  2Q12 A;  3BVV A;  4AZC A;  3VEB A;  3L3P A;  3BUB A;  2YLA A;  2F7O A;  3HAI A;  1R5E A;  2OBL A;  5FIG A;  1JQK A;  3ER9 B;  3DX1 A;  3SOG A;  1I4D A;  3KAW A;  2LXY A;  2QFF A;  4IM2 A;  4G6Q A;  4E81 A;  4F01 A;  2YLL A;  3DX2 A;  4EZW A;  3D2F A;  4EZS A;  2EFK A;  1DKX A;  3DPP A;  2ELB A;  2OBM A;  2QXL A;  3O3O B;  3KAV A;  3QNJ A;  4HR1 B;  3DDG A;  2N3K A;  3A98 A;  3Q84 A;  1WDZ A;  2C08 A;  2EX3 B;  1SU8 A;  3LVT A;  3CKD A;  4EZN A;  3BVW A;  4E3C A;  3EJU A;  1R34 A;  4HY9 A;  4AVM A;  2GA9 D;  3D52 A;  3RV1 A;  3B51 X;  1SU7 A;  4AZB A;  4H6H A;  2JNK A;  3I01 A;  2F1B A;  2YL9 A;  4BNE A;  2Z0V A;  4JWI A;  1OA1 A;  3CZS A;  3DX0 A;  3QE6 A;  3T4A G;  3PLT A;  3D4Y A;  3T46 A;  3EJT A;  3KDR A;  4R5J A;  3ERC C;  4AZC B;  3OWG A;  4R5K A;  1X04 A;  4H8S A;  3L3O M;  4IM3 A;  1YWM A;  3CVR A;  5TKY A;  1W9M A;  1OA0 A;  2ALW A;  4JL9 A;  4AZI A;  1U00 A;  2YL6 A;  4IWO A;  3VKH A;  3C7N A;  3DYT A;  3ABH A;  1O7D B;  4HYB A;  3OK8 A;  1SUF A;  3BVX A;  2D1L A;  1URU A;  4UDY X;  1HWW A;  3HAJ A;  3Q0K A;  3EJP A;  3T49 A;  2F7Q A;  3BLB A;  2GF4 A;  2EWF A;  4JLC A;  4AZH A;  3QNI A;  1X03 A;  2Z8Y A;  2F1A A;  4FZS A;  3I04 A;  5C5B A;  2RAI A;  1ZYL A;  2F18 A;  2YI9 A;  3M3W A;  2QKW A;  4EZQ A;  2OO2 A;  2GAF D;  4EZU A;  1LQ7 A;  2F7R A;  3B52 X;  2X3X A;  1MJG A;  3DX3 A;  1HXK A;  3O3N B;  4R5G A;  1DKZ A;  4EZX A;  2Z0O A;  2FIC A;  2WIN M;  3ER8 C;  2Q13 A;  1OAO A;  4IM0 A;  1PS3 A;  4NQI A;  4WPC A;  2KHO A;  2OZN B;  4KIK A;  4DCN C;  3I2W A;  2EFL A;  2RAK A;  3DPQ A;  4JWC A;  2ND1 A;  2YIA A;  3T47 A;  2ND0 A;  4ATM A;  3DX4 A;  3QA8 A;  4JWE A;  1QWN A;  4R5L A;  4EZY A;  1I4L A;  2ZXQ A;  2YIV X;  1O7D C;  4JNE A;  2O0I 1;  3G9G A;  3O3M B;  3BUD A;  4NPH A;  5E84 A;  3DPO A;  3EJS A;  2YI8 A;  4FM3 A;  4IW0 A;  4M0M A;  1GNT A;  1TQT A;  4AKV A;  1SU6 A;  4IWP A;  3HAH A;  2RT6 A;  4AZ6 A;  3EJR A;  1TQW A;  2Z0N A;  3T48 A;  4JWD A;  1UPX A;  3BUI A;  4FZO A;  2X3W A;  3QWE A;  4I1Q A;  1GNL A;  2PMR A;  4EZT A;  2WYH A;  2D4C A;  5C5B B;  1E2U A;  2X5C A; 
#chains in the Genus database with same CATH homology
 1OA1 A;  3O3N B;  4R5G A;  2YIB A;  1DKZ A;  1E9V A;  4EZP A;  4EZX A;  3T4A G;  2WIN M;  3ER8 C;  1OAO A;  3VEB A;  3RV0 A;  4IM0 A;  3I39 X;  3T46 A;  4EZV A;  5FIG A;  2OBL A;  2KHO A;  1JQK A;  5FLE X;  3ZED A;  3VEA A;  3ER9 B;  3KDR A;  4R5J A;  4KIK A;  4R5I A;  4F00 A;  3ERC C;  4B9Q A;  2NCZ A;  3OWG A;  4R5K A;  3KAW A;  3DPQ A;  4JWC A;  3L3O M;  2ND1 A;  2QFF A;  2YIA A;  4IM3 A;  4IM2 A;  3T47 A;  5TKY A;  1W9M A;  4G6Q A;  1OA0 A;  2ND0 A;  4EZZ A;  3QA8 A;  4E81 A;  4F01 A;  4KIK B;  4JWE A;  4PO2 A;  4JL9 A;  1U00 A;  3GI7 A;  4IWO A;  4R5L A;  3C7N A;  3UIT A;  4EZW A;  4EZY A;  3VKH A;  3D2F A;  4EZS A;  4HR1 A;  3F7W A;  2YIV X;  3B53 X;  4HYB A;  4JNE A;  3O3M B;  1SUF A;  4JNF A;  5E84 A;  1DKX A;  3DPP A;  4NPH A;  3DPO A;  4UDY X;  2YI8 A;  1E1D A;  3FD9 A;  4FM3 A;  2OBM A;  4IW0 A;  4M0M A;  3T49 A;  2QXL A;  1GNT A;  2LM0 A;  3O3O B;  3KAV A;  3QNJ A;  4HR1 B;  2PY6 A;  2EWF A;  4JN4 A;  4IWQ A;  2N3K A;  3A98 A;  1SU6 A;  4JLC A;  4EZR A;  2EX3 B;  1SU8 A;  4IWP A;  4UDX X;  2RT6 A;  2Z8Y A;  4EZN A;  4E3C A;  3I04 A;  1DKY A;  4HY9 A;  3T48 A;  4JWD A;  1UPX A;  1ZYL A;  2YI9 A;  4EZO A;  4EZQ A;  1GN9 A;  2GA9 D;  2GAF D;  3RV1 A;  4H6I A;  3B51 X;  1SU7 A;  3OHX M;  4EZU A;  4H6H A;  1GNL A;  4EZT A;  3I01 A;  3LMF A;  4D8J A;  3B52 X;  3D2E A;  1E2U A;  1MJG A;  2X5C A;  2JNS A;  4JWI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...