4FM3A

Crystal structure of a duf4398 family protein (pa2901) from pseudomonas aeruginosa pao1 at 2.47 a resolution
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
95
structure length
95
Chain Sequence
GDPAPLEQMRLTEQALEQAKAVGATDDVAELKLAQDKYAAAQIAMTAESYKKARLLAEQAELDARLAESKVLTQKSKDQLGELDKSLKRLRKQLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized hypothetical protein
publication title Crystal structure of a hypothetical protein (PA2901) from Pseudomonas aeruginosa PAO1 at 2.47 A resolution
rcsb
source organism Pseudomonas aeruginosa
molecule tags Structural genomics, unknown function
total genus 40
structure length 95
sequence length 95
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14346 DUF4398 Domain of unknown function (DUF4398)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.390 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4fm3A00
4FM3A
chains in the Genus database with same CATH superfamily
4JN4A 2OW7A 1YWMA 2V0OA 4R5LA 1GNLA 3ACOA 4ATMA 1DKYA 3DX3A 1U00A 1UPXA 3G9GA 3OK8A 2EFLA 3F7WA 4UDYX 1TQTA 3B52X 2Z0NA 3D4ZA 3DX4A 1TQVA 2YL9A 3I2WA 2LXYA 2YIVX 3EJUA 4EZVA 2ELBA 5FIGA 2GA9D 4FZSA 2F18A 1SUFA 3QA8A 1GN9A 2F7PA 3CVRA 1HWWA 3KAVA 3EJRA 4EZZA 3CKDA 1QWUA 3VEBA 4H6IA 5C5BA 3DPQA 3HAIA 3FD9A 4IWOA 3BVWA 3OHXM 4HYBA 1PS3A 5E84A 3B53X 4DYLA 3T47A 2ALWA 2YKTA 3RV0A 2F7RA 4IWPA 2YLAA 4AZBA 3HAHA 3LLLA 3QNIA 2D4CA 3O3NB 2YLLA 1LQ7A 3BLBA 3BUPA 4R5IA 4WPCA 3DPPA 4EZPA 4JWIA 1HTYA 2WINM 3VEAA 1R33A 3Q0KA 4EZSA 4EZNA 3VKHA 2YIAA 4AZCA 2F1AA 4H8SA 4I1QA 4FM3A 3LVTA 4JLCA 5FLEX 2Z0OA 4E3CA 2LM0A 4HY9A 4IM3A 3D52A 1W9MA 1TQUA 4E81A 2D1LA 1I49A 2JNKA 4AZ5A 3T48A 3GI7A 2YI9A 1E9VA 1DKZA 4H6HA 3T4AG 3BUBA 3DDGA 1OA0A 4JWCA 2YL6A 1OAOA 2EFKA 4KIKA 4IM2A 4AZIA 3DPOA 3O3MB 2QXLA 3DX0A 1SU6A 3PLTA 2FICA 4WPEA 4G6QA 4R5GA 4IWQA 3CZSA 4EZYA 3BVVA 4AZHA 3DX2A 3HAJA 3OWGA 1WDZA 3C7NA 2F1BA 4IM0A 2OZNB 2ND1A 3BVTA 4JNFA 2GAFD 3L3PA 4NSWA 3DDFA 2YL5A 1GNTA 4AZ6A 3D50A 2OBLA 3EJPA 2GF4A 2ZXQA 1O7DC 2OO2A 2C08A 4BNEA 4D8JA 5C5BB 4R5JA 1QX1A 2OBMA 2KHOA 3ERCC 2EWFA 2RT6A 2YIBA 4EZXA 4EZTA 4PO2A 4HR1A 4UDXX 1SU7A 4AVMA 3EJQA 1I4LA 2Z8YA 3UITA 2YL8A 3BUDA 3QWEA 3T49A 1I4DA 5TKYA 3EJSA 2ND0A 1ZWWA 3I39X 1JQKA 2QFFA 3BVXA 4JNEA 4AZCB 4FZPA 4M0MA 4NQIA 2F7OA 1MJGA 2MI7A 2NCZA 4JWEA 1URUA 4EZRA 4NPHA 3DYTA 4HR1B 3ABHA 1R5EA 3CV5A 3SOGA 3QNJA 2RAKA 2X3VA 4JWDA 2OW6A 1DKXA 2PMRA 1X03A 3D51A 1I4TA 3M3WA 2EX3B 1ZYLA 2X3XA 3O3OB 1QWNA 1TQWA 4IW0A 3L3OM 3KDRA 3A98A 3EJTA 2QKWA 4JL9A 1HXKA 1OA1A 3I01A 2FYVA 4EZWA 3D4YA 4KIKB 3LMFA 1E1DA 5KBPA 2N3KA 3T46A 3D2FA 3ZEDA 4EZOA 3B51X 2RAJA 4DCNC 3DX1A 2RAIA 1SU8A 3KAWA 3BUIA 3RPMA 2X5CA 3Q84A 4B9QA 2Q13A 2PY6A 3BVUA 4AZ7A 2X3WA 2F7QA 3D2EA 3I04A 2Q12A 3BUQA 2JNSA 1R34A 4EZQA 1X04A 1O7DB 2O0I1 3ER9B 1Y2OA 4F00A 2WYIA 2WYHA 4AKVA 3ER8C 3RV1A 4AZGA 2Z0VA 4FZOA 1E2UA 1TQSA 3QE6A 4R5KA 3CAZA 3SYVA 2YI8A 3CZNA 4F01A 4EZUA
chains in the Genus database with same CATH topology
4JN4A 4EZSA 4EZNA 2ND1A 4R5LA 3VKHA 1GNLA 4JNFA 2GAFD 2YIAA 2EX3B 1ZYLA 3O3OB 1GNTA 4IW0A 4FM3A 3L3OM 3KDRA 3A98A 1DKYA 2OBLA 4JLCA 5FLEX 4E3CA 2LM0A 4HY9A 1U00A 1UPXA 4IM3A 1W9MA 4JL9A 4D8JA 4E81A 3F7WA 4UDYX 1OA1A 3B52X 3I01A 4EZWA 4R5JA 4KIKB 2OBMA 3T48A 2KHOA 2YIVX 3LMFA 3GI7A 1E1DA 2YI9A 1E9VA 4EZVA 2N3KA 3ERCC 1DKZA 5FIGA 2GA9D 4H6HA 3T4AG 1SUFA 3QA8A 1GN9A 2EWFA 2RT6A 2YIBA 3T46A 4EZXA 4EZTA 4PO2A 3D2FA 3ZEDA 4EZOA 3B51X 1OA0A 4HR1A 4UDXX 3KAVA 4JWCA 1SU7A 4EZZA 2Z8YA 3UITA 1SU8A 3KAWA 3VEBA 2X5CA 4H6IA 3T49A 4B9QA 3DPQA 5TKYA 3FD9A 4IWOA 1OAOA 3OHXM 2ND0A 4HYBA 4KIKA 2PY6A 3I39X 1JQKA 2QFFA 4IM2A 5E84A 3I04A 3D2EA 4JNEA 3B53X 2JNSA 3DPOA 4EZQA 3T47A 3O3MB 2QXLA 1SU6A 4M0MA 1MJGA 4G6QA 2NCZA 3RV0A 4JWEA 4R5GA 3ER9B 4EZRA 4IWPA 4NPHA 4HR1B 4IWQA 4F00A 3O3NB 3ER8C 3RV1A 4EZYA 3QNJA 4R5IA 1E2UA 4JWDA 4R5KA 3DPPA 4EZPA 4JWIA 1DKXA 3OWGA 2WINM 2YI8A 3VEAA 4F01A 3C7NA 4IM0A 4EZUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FM3 A; 
#chains in the Genus database with same CATH topology
 4JN4 A;  2OW7 A;  1YWM A;  2V0O A;  4R5L A;  1GNL A;  3ACO A;  4ATM A;  1DKY A;  3DX3 A;  1U00 A;  1UPX A;  3G9G A;  3OK8 A;  2EFL A;  3F7W A;  4UDY X;  1TQT A;  3B52 X;  2Z0N A;  3D4Z A;  3DX4 A;  1TQV A;  2YL9 A;  3I2W A;  2LXY A;  2YIV X;  3EJU A;  4EZV A;  2ELB A;  5FIG A;  2GA9 D;  4FZS A;  2F18 A;  1SUF A;  3QA8 A;  1GN9 A;  2F7P A;  3CVR A;  1HWW A;  3KAV A;  3EJR A;  4EZZ A;  3CKD A;  1QWU A;  3VEB A;  4H6I A;  5C5B A;  3DPQ A;  3HAI A;  3FD9 A;  4IWO A;  3BVW A;  3OHX M;  4HYB A;  1PS3 A;  5E84 A;  3B53 X;  4DYL A;  3T47 A;  2ALW A;  2YKT A;  3RV0 A;  2F7R A;  4IWP A;  2YLA A;  4AZB A;  3HAH A;  3LLL A;  3QNI A;  2D4C A;  3O3N B;  2YLL A;  1LQ7 A;  3BLB A;  3BUP A;  4R5I A;  4WPC A;  3DPP A;  4EZP A;  4JWI A;  1HTY A;  2WIN M;  3VEA A;  1R33 A;  3Q0K A;  4EZS A;  4EZN A;  3VKH A;  2YIA A;  4AZC A;  2F1A A;  4H8S A;  4I1Q A;  4FM3 A;  3LVT A;  4JLC A;  5FLE X;  2Z0O A;  4E3C A;  2LM0 A;  4HY9 A;  4IM3 A;  3D52 A;  1W9M A;  1TQU A;  4E81 A;  2D1L A;  1I49 A;  2JNK A;  4AZ5 A;  3T48 A;  3GI7 A;  2YI9 A;  1E9V A;  1DKZ A;  4H6H A;  3T4A G;  3BUB A;  3DDG A;  1OA0 A;  4JWC A;  2YL6 A;  1OAO A;  2EFK A;  4KIK A;  4IM2 A;  4AZI A;  3DPO A;  3O3M B;  2QXL A;  3DX0 A;  1SU6 A;  3PLT A;  2FIC A;  4WPE A;  4G6Q A;  4R5G A;  4IWQ A;  3CZS A;  4EZY A;  3BVV A;  4AZH A;  3DX2 A;  3HAJ A;  3OWG A;  1WDZ A;  3C7N A;  2F1B A;  4IM0 A;  2OZN B;  2ND1 A;  3BVT A;  4JNF A;  2GAF D;  3L3P A;  4NSW A;  3DDF A;  2YL5 A;  1GNT A;  4AZ6 A;  3D50 A;  2OBL A;  3EJP A;  2GF4 A;  2ZXQ A;  1O7D C;  2OO2 A;  2C08 A;  4BNE A;  4D8J A;  5C5B B;  4R5J A;  1QX1 A;  2OBM A;  2KHO A;  3ERC C;  2EWF A;  2RT6 A;  2YIB A;  4EZX A;  4EZT A;  4PO2 A;  4HR1 A;  4UDX X;  1SU7 A;  4AVM A;  3EJQ A;  1I4L A;  2Z8Y A;  3UIT A;  2YL8 A;  3BUD A;  3QWE A;  3T49 A;  1I4D A;  5TKY A;  3EJS A;  2ND0 A;  1ZWW A;  3I39 X;  1JQK A;  2QFF A;  3BVX A;  4JNE A;  4AZC B;  4FZP A;  4M0M A;  4NQI A;  2F7O A;  1MJG A;  2MI7 A;  2NCZ A;  4JWE A;  1URU A;  4EZR A;  4NPH A;  3DYT A;  4HR1 B;  3ABH A;  1R5E A;  3CV5 A;  3SOG A;  3QNJ A;  2RAK A;  2X3V A;  4JWD A;  2OW6 A;  1DKX A;  2PMR A;  1X03 A;  3D51 A;  1I4T A;  3M3W A;  2EX3 B;  1ZYL A;  2X3X A;  3O3O B;  1QWN A;  1TQW A;  4IW0 A;  3L3O M;  3KDR A;  3A98 A;  3EJT A;  2QKW A;  4JL9 A;  1HXK A;  1OA1 A;  3I01 A;  2FYV A;  4EZW A;  3D4Y A;  4KIK B;  3LMF A;  1E1D A;  5KBP A;  2N3K A;  3T46 A;  3D2F A;  3ZED A;  4EZO A;  3B51 X;  2RAJ A;  4DCN C;  3DX1 A;  2RAI A;  1SU8 A;  3KAW A;  3BUI A;  3RPM A;  2X5C A;  3Q84 A;  4B9Q A;  2Q13 A;  2PY6 A;  3BVU A;  4AZ7 A;  2X3W A;  2F7Q A;  3D2E A;  3I04 A;  2Q12 A;  3BUQ A;  2JNS A;  1R34 A;  4EZQ A;  1X04 A;  1O7D B;  2O0I 1;  3ER9 B;  1Y2O A;  4F00 A;  2WYI A;  2WYH A;  4AKV A;  3ER8 C;  3RV1 A;  4AZG A;  2Z0V A;  4FZO A;  1E2U A;  1TQS A;  3QE6 A;  4R5K A;  3CAZ A;  3SYV A;  2YI8 A;  3CZN A;  4F01 A;  4EZU A; 
#chains in the Genus database with same CATH homology
 4JN4 A;  4EZS A;  4EZN A;  2ND1 A;  4R5L A;  3VKH A;  1GNL A;  4JNF A;  2GAF D;  2YIA A;  2EX3 B;  1ZYL A;  3O3O B;  1GNT A;  4IW0 A;  4FM3 A;  3L3O M;  3KDR A;  3A98 A;  1DKY A;  2OBL A;  4JLC A;  5FLE X;  4E3C A;  2LM0 A;  4HY9 A;  1U00 A;  1UPX A;  4IM3 A;  1W9M A;  4JL9 A;  4D8J A;  4E81 A;  3F7W A;  4UDY X;  1OA1 A;  3B52 X;  3I01 A;  4EZW A;  4R5J A;  4KIK B;  2OBM A;  3T48 A;  2KHO A;  2YIV X;  3LMF A;  3GI7 A;  1E1D A;  2YI9 A;  1E9V A;  4EZV A;  2N3K A;  3ERC C;  1DKZ A;  5FIG A;  2GA9 D;  4H6H A;  3T4A G;  1SUF A;  3QA8 A;  1GN9 A;  2EWF A;  2RT6 A;  2YIB A;  3T46 A;  4EZX A;  4EZT A;  4PO2 A;  3D2F A;  3ZED A;  4EZO A;  3B51 X;  1OA0 A;  4HR1 A;  4UDX X;  3KAV A;  4JWC A;  1SU7 A;  4EZZ A;  2Z8Y A;  3UIT A;  1SU8 A;  3KAW A;  3VEB A;  2X5C A;  4H6I A;  3T49 A;  4B9Q A;  3DPQ A;  5TKY A;  3FD9 A;  4IWO A;  1OAO A;  3OHX M;  2ND0 A;  4HYB A;  4KIK A;  2PY6 A;  3I39 X;  1JQK A;  2QFF A;  4IM2 A;  5E84 A;  3I04 A;  3D2E A;  4JNE A;  3B53 X;  2JNS A;  3DPO A;  4EZQ A;  3T47 A;  3O3M B;  2QXL A;  1SU6 A;  4M0M A;  1MJG A;  4G6Q A;  2NCZ A;  3RV0 A;  4JWE A;  4R5G A;  3ER9 B;  4EZR A;  4IWP A;  4NPH A;  4HR1 B;  4IWQ A;  4F00 A;  3O3N B;  3ER8 C;  3RV1 A;  4EZY A;  3QNJ A;  4R5I A;  1E2U A;  4JWD A;  4R5K A;  3DPP A;  4EZP A;  4JWI A;  1DKX A;  3OWG A;  2WIN M;  2YI8 A;  3VEA A;  4F01 A;  3C7N A;  4IM0 A;  4EZU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...