4AZ7A

Differential inhibition of the tandem gh20 catalytic modules in the pneumococcal exo-beta-d-n-acetylglucosaminidase, strh
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
433
structure length
433
Chain Sequence
NEKLAKKKIVSIDAGRKYFSPEQLKEIIDKAKHYGYTDLHLLVGNDGLRFMLDDMSITANGKTYASDDVKRAIEKGTNDYYNDPNGNHLTESQMTDLINYAKDKGIGLIPTVNSPGHMDAILNAMKELGIQNPNFSYFGKKSARTVDLDNEQAVAFTKALIDKYAAYFAKKTEIFNIGLDEYANDATDAKGWSVLQADKYYPNEGYPVKGYEKFIAYANDLARIVKSHGLKPMAFNDGIYYNSDTSFGSFDKDIIVSMWTGGWGGYDVASSKLLAEKGHQILNTNDAWYYVLGRNADGQGWYNLDQGLNGIKNTPITSVPKTEGADIPIIGGMVAAWADTPSARYSPSRLFKLMRHFANANAEYFAADYESAEQALNEVPKDLNRYTAESVTAVKEAEKAIRSLDSNLSRAQQDTIDQAIAKLQETVNNLTLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-N-ACETYLHEXOSAMINIDASE
publication title Inhibition of the Family 20 Glycoside Hydrolase Catalytic Modules in the Streptococcus Pneumoniae Exo-Beta-D-N-Acetylglucosaminidase, Strh.
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 171
structure length 433
sequence length 433
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2012-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.90 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 AF1782-like 4az7A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4az7A01
4P8VA 5A95A 1JG9A 2HISA 4WK9A 4PMVA 4H41A 1JDAA 1VJSA 4GQQA 3HN3A 3T0AA 3L4YA 4E8DA 1Q6CA 1RH9A 2F8QA 4GPNA 2MANA 2X1IA 1Q6FA 5M03A 3L4UA 3AHXA 4H8UA 3NCOA 4K68A 2ZE0A 1W2PA 1M03A 3MS8A 4WF7A 1A47A 3EDKA 2OSXA 3ARSA 2VQTA 2XFYA 2VUYA 2O92A 3A47A 4AD1A 2CESA 3ZJ6A 4HOXA 3RM9A 2WW5A 1DTUA 3QR3A 1U2YA 1JD9A 3A4AA 2Y24A 2G3MA 1GOWA 4FK9A 1W1YA 1KCLA 1K9EA 1UZ4A 5KEZA 4GI6A 1V6YA 4OIFA 1JZ8A 2V3EA 4MTVA 1J01A 3VPLA 1NOUA 1QVBA 4D6GA 1XSKA 3WL0A 3W28A 3ALFA 3SCWA 3BAJA 4UQBA 5KZ6A 5DMYA 4S3JA 2ZICA 3WMBA 1HKKA 5AC4A 2XWDA 3NDYA 3VIHA 1G5AA 3N17A 2C0HA 1PBGA 2BHYA 1UR9A 1W32A 3N1AA 2ZUMA 3VMNA 3NUKA 3KE0A 3AFBA 2VI0A 4QCFA 1EQCA 3K8LA 4J3XA 4LQ1A 2C7FA 3ZT6A 4OZOA 3BAXA 2J25A 3WEOA 1JZ5A 3POCA 2WM0A 5A94A 4GINA 2XGIA 4TTUA 3RJYA 1JDCA 2DSVA 3CLWA 3UG4A 1EDGA 1JF6A 2ZX8A 1ZBVA 4DUWA 3F5JA 1H09A 1E0WA 1UR2A 2VZUA 3ZJ7A 4PMNA 2BY2A 3OZPA 1V0NA 2UWFA 3JUGA 1LWHA 1ZL1A 1OT2A 2GJXA 3WQ6A 4HOZA 4AIOA 3I3EA 1PZ2A 3POHA 2EBNA 1UKOA 4UCFA 1ISYA 5BRQA 2FHFA 4UTFA 3CH9A 4Z2IA 2DT2A 4CGTA 3VOCA 1TA3B 1W2VA 2ZX6A 3WUGA 4CCDA 3APGA 2YL5A 2FHBA 2J4GA 4X9YA 4WIWA 1HJSA 2V3DA 4ZXOA 4D72A 4L4PA 3RM8A 4QLKA 5LA0A 3FW6A 1CGXA 2XVNA 2DGAA 2EPLX 1ISZA 1TZ7A 5I3DA 4ZE5A 2GJPA 1HXJA 4AMCA 1W1VA 5E70A 2WCGA 4M29A 1SYTA 3WUBA 3W26A 5CSYA 1JYWA 1WCGA 3DHUA 2XM1A 1GHRA 3M07A 1QI3A 1HX0A 4F66A 1XHGA 3VIPA 5A8QA 4TTGA 4CVWA 5C8BB 2WAGA 4B3LA 2WBKA 3UG5A 4J3UA 1Q6GA 2O9TA 1L0PA 2G3IA 1GORA 1YHTA 5FL0A 4B15A 3RPMA 3T0DA 1D2KA 4W86A 1BHGA 3PZVA 4W7WA 3D3AA 1TFVA 4B3KA 4BF7A 5HPOA 1RP9A 3BC9A 2JF7A 1CGVA 1JFXA 4GKLA 4MDOA 2VVNA 2WMJA 1MFUA 3A4XA 1VRXA 2VC9A 1HT6A 3CZKA 1US2A 1UG6A 4PMZA 3UR7A 5ECUA 3PTMA 3BLPX 4F9DA 5BCAA 3WD4A 2XM2A 4D6HA 4UFMA 1E1FA 4AD4A 1J9YA 4BZYA 4TVDA 1GNXA 1MXDA 5AC5A 4P8WA 1V3HA 3WMSA 4ACZB 4W87A 1AMYA 2X0HA 2Y5EA 3CZEA 3ARQA 4DM2A 1GPFA 2WC3A 3UG3A 4B16A 3WF4A 2V5CA 1CYGA 1WZLA 2CBVA 1DWAM 2WPGA 5HBFA 3EMZA 3KL5A 1JGIA 2ZXAA 1E4MM 3AOFA 1BFNA 2WVUA 3OLEA 3AIUA 3ARTA 2XSBA 7A3HA 2BFGA 1QBBA 5CQ1A 2E8YA 4CN6A 2VOTA 3UERA 5I78A 1X6NA 2D0HA 1E4NA 4NI3A 3B9AA 5IDIA 2WLYA 2CEQA 3EYPA 2WHLA 1MW2A 1MWOA 1XGZA 5FOOA 4P8XA 3MUAA 1JNEA 4JKLA 1J0JA 3WNOA 1B0IA 1PIFA 2WLZA 2WWCA 4ACYA 1GCYA 4W93A 1NP2A 3VDHA 2WMFA 2YA2A 3BSGA 4M24A 3VM5A 2YL6A 1VB9A 1B3XA 2XFRA 1WKYA 4TXEA 4CKQA 1CLXA 4ZFMA 1NP0A 1US3A 4CU6A 3TP4A 1UKQA 4J3TA 3ZJ8A 3ZO9A 2WNWA 5E0FA 2Q8XA 4PMOA 3CHFA 5GNYA 1ISXA 4CN1A 1TE1A 4U5IA 2VZTA 1V6UA 2YLAA 3VINA 3CGTA 3BAIA 3AYRA 3TTQA 2ZXQA 2ZIDA 2J7CA 3CUGA 4W7VA 4GQRA 3CPUA 3AXIA 4D6JA 1FOBA 5DT7A 4HA1A 2CBJA 3EDJA 2WKGA 1W9DM 1QI2A 1WO2A 4FLRA 1C3FA 1JNDA 3ARWA 4AYSA 2VL4A 3PBGA 3WY1A 1EXPA 2CERA 3WN6A 1XCXA 3VUPA 3MSGA 1H1NA 4AZ5A 2XIIA 4GZJA 4HMEA 4HA4A 3WEZA 2FDMA 1MXGA 3WFZA 3G6MA 1OD0A 1NWUA 2HVMA 4PTMA 1RPKA 3MO4A 5D9OA 1OCQA 4NRSA 4J7RA 3EDEA 1HL8A 1KWGA 3WQ8A 4RL3A 1OM0A 2WVVA 1UYQA 4UOZA 4M8UA 2J62A 4P8UA 4Z2HA 2A3BA 2DQXA 1KGXA 4WSKA 4M56A 5HOSA 5JIWA 4EAMA 2VCAA 2DT1A 3BCFA 3GYCA 4FLOA 1RD6A 2CHNA 1CGWA 1HJUA 3QGVA 2VX6A 3O2LA 2D1ZA 2EPMX 4PTVA 4D6DA 4DWSA 2XVLA 4GI8A 3SCNA 4AZ6A 5FCZA 4UQCA 1GW1A 1X6LA 2WCAA 1KBBA 4HU0A 1JZ4A 3RO8A 1GOQA 1TG7A 2WMIA 4MAZA 1S46A 4CU8A 3MV11 3RJXA 1LF1A 3FY1A 3HJEA 3K1DA 3WF3A 3IJ8A 1H0IA 4PYSA 1QNOA 2GK1A 2VJXA 1WDSA 1MFVA 5DF0A 4ATLA 2ZUVA 1EOMA 1VEOA 1BSIA 2CIPA 4AIEA 4OJYA 3AHVA 4DM1A 1E0VA 5DO8A 2WB5A 3VX0A 4WJXA 5A6MA 1W1TA 2ZX5A 4PCSA 1ISWA 1Q4NX 4W88A 3VGFA 2PWGA 3VIOA 2PWFA 2CCRA 4HU8A 1QW9A 1KFWA 1AQ0A 7TAAA 3SUWA 3WD1A 3PZTA 4BS0A 3AZRA 2E9BA 4GO9A 3K8MA 5A6AA 5I77A 2GUYA 2EEXA 2J75A 1V02A 1E6XM 1LG2A 4RE3A 5C71A 3AZSA 4W84A 1CXEA 1QNQA 4JKMA 4IPLA 3T2QA 4HZ6A 2VR5A 3AMCA 5D8ZA 1JYXA 2EQDA 3SCRA 1UR1A 4NRRA 3T2OA 5BXPA 2J8FA 1WDPA 2NT1A 4U33A 1EH9A 1DWHM 4JL1A 5CGMA 3SUUA 4HMCA 3ECQA 3B8SA 4AZBA 3VNYA 4B9ZA 3KL3A 1OWQA 4OBSA 2J79A 3GH7A 4D1JA 3GNPA 2PWEA 1HJVA 3SURA 4AEEA 1U30A 1HKJA 1JD7A 2VURA 2E4TA 2W5FA 3ARYA 3GH4A 5AYBA 4C7DA 1UH4A 4NSBA 4FLSA 4LYPA 1EGZA 1GQLA 1J0KA 3LPGA 4KMQA 1PEZA 5A6SA 1UD4A 2RGMA 1NM9A 1BPLB 2QHAA 5I5RA 1CXLA 4P7OA 3L4WA 1XYFA 1MVYA 1W9VA 3WBAA 3K4AA 3MSDA 3RMEA 2E9MA 3RIKA 1W3KA 1GQKA 2DEPA 5GPRA 1XH1A 5CLWA 5LA1A 2C8NA 2BY1A 2PBOA 2VX7A 2VRQA 3NSXA 3W38A 3O9NA 2YJQA 3VVGA 2BVDA 1PAMA 4OKDA 2XSAA 3PZ9A 1EDTA 2CPUA 2D0GA 4DWSC 2GFTA 3CMGA 1UKPA 3CBWA 1CGYA 4U2ZA 1KXTA 1UR4A 2D2OA 3L4VA 2RGLA 4EE9A 2VCBA 3THDA 4PMQA 3GXFA 1BG4A 1E6SM 3W82A 3NIYA 4X0NA 2VMFA 4LX4A 3W37A 3W81A 1VFFA 2AAAA 3AICA 2GVYA 1G01A 4URIA 4U5KA 1B3YA 1V02E 3PZOA 4PMRA 4CD6A 1CWYA 2E3ZA 3AS3A 1JZ7A 2UY3A 3PZNA 1UD2A 2FGZA 3TTYA 3WDIA 2J7FA 5CPQA 2GJXB 3W27A 1DWFM 1KCKA 1ZBCA 1V6WA 4PMYA 1OBAA 2CBUA 2G41A 2X2YA 4H2CA 1NOFA 3QHMA 1PZ3A 1KXQA 1FFQA 2XFFA 2PWHA 1V3MA 1VEPA 1E71M 1LG1A 1FA2A 4HP5A 1VEMA 4F8XA 4AIUA 1TVNA 5D9NA 3FN9A 1C8XA 1W3JA 5HPCA 1UZ1A 2FHCA 4GI9A 3GM8A 4UR9A 4UFIA 3VD7A 4AD2A 1N82A 4MB3A 1QW8A 2YBTA 4UZSA 1ZU8A 1H5VA 2WSKA 2DSWA 2OSYA 4QCEA 3VDCA 3N11A 4TVCA 3I3DA 3MUZ1 3OGRA 3W25A 2XVGA 2YOCA 2OWXA 4ZE4A 4AD5A 3GTNA 2PB1A 3VGDA 3FHQA 2XYLA 4F9JA 3BLKA 1GOIA 3BAKA 1WZMA 4D71A 5A6BA 1BYAA 1E73M 4ML4A 1NWRA 5D9PA 3AXXA 1QHOA 2WBGA 3L2LA 1BF2A 2XUCA 2XJ7A 4NZCA 3AROA 1GOMA 4GXPA 4XUYA 4Q7NA 1GQJA 1Z32X 4BQ3A 4AISA 1XYZA 4PUDA 2UY4A 3U7BA 1UWRA 4JAWA 4TX6A 3VKKA 3PZUA 1E3XA 4HZ7A 1W1PA 1Y7VA 3W29A 3VIKA 3ARUA 1J18A 4W8BA 4M1RA 4KRTA 4R5EA 2UY5A 2OLHA 1CTNA 2ZUTA 4KWUA 2BXYA 1B9ZA 3AYSA 2V3GA 3KWXA 1V6XA 2G8ZA 2W62A 2WVSA 5M5DA 2D22A 2G3JA 4Q22A 4AZCA 1R8LA 3VIJA 4PSRA 1OIFA 4J28A 2BHZA 6TAAA 1ESWA 1FHDA 1JFHA 4W8AA 3DHPA 3MU7A 4P7NA 3OGSA 3LMYA 1AVAA 1VJZA 3N18A 4GIAA 1NWSA 2VO5A 2V38A 5D8WA 1C93A 1ODZA 2JIEA 4Z2KA 1UH3A 3AMKA 3QHOA 4M81A 3BH4A 2WZIA 4H04A 4UOQA 4H8HA 2F61A 1B3WA 2X09A 2OYKA 2JALA 1WZAA 2Y8VA 1OSEA 2WHKA 3ZIZA 2XWEA 3WNLA 6A3HA 4HA3A 1CPUA 3DYMA 3IK2A 1R7AA 4FF5A 2VTFA 3CIVA 3WUFA 1XRVA 1EHAA 2J7EA 5A8OA 2VRKA 2YA1A 1V03A 1EDQA 1G9HA 3ARRA 1JAKA 3IAQA 1FFRA 1TCMA 1V3KA 4J27A 3RILA 3N15A 2YLLA 3PZIA 1WDRA 1JI1A 1HJWA 4LGXA 2WSPA 3ZM8A 3W4RA 1R85A 3QOKA 1LWJA 3LPFA 4PBGA 2OZNB 1C91A 2A3EA 1CEOA 4IM4A 2J47A 2O9RA 3EDFA 2QV4A 1F4AA 2GSJA 2WMGA 3AIEA 1E56A 3AIRA 2B31A 4UQ9A 4CN4A 1L8NA 2PBGA 2ZUUA 5BROA 4CU7A 5DFAA 4UFKA 2YIHA 2XIBA 3CUHA 1TR1A 5CZKA 5JIPA 2NW0A 1PX8A 3VX1A 1UWIA 3T08A 4D6CA 2BV9A 2O9OA 2D3NA 2XGBA 2WMKA 4W5UA 3WDHA 4PUEA 5IHRA 3AS2A 2E9LA 2D23A 3WDRA 2ZWZA 3DYOA 2OSWA 1XSJA 2VZVA 3SEPA 3UEQA 5IFPA 2WVVB 3VD3A 5I6SA 2GDUA 4IUGA 1JZ3A 2D3LA 3MV01 2D0FA 4W8LA 3T09A 1G1YA 3WFLA 1EHNA 1OINA 1UWTA 3VIGA 3WH5A 4AD3A 5ABFA 1W3LA 4GZIA 1B90A 2GJRA 2ZUSA 7CGTA 2VNCA 4YHEA 1UOKA 1B31A 3CHEA 1UKTA 2CHOA 2Z1SA 4DWSB 2PI6A 3W6LA 3KZSA 4OUEA 1UD5A 3F4VA 1JXKA 3WBEA 1EOKA 4QDMA 1G94A 4W85A 3N13A 3S2CA 4PTWA 1E6QM 1FH9A 1OD8A 3AHTA 2WMIB 1SMDA 1NWTA 1GHSA 5D4YA 1UD3A 1LJYA 4HPGA 2GK1B 1H4PA 3MMUA 4AD0A 2X8RA 5FD0A 5E09A 3QHNA 1W91A 1I75A 1UH2A 1MW3A 3QOMA 5JUVA 3IANA 2A3CA 3NYDA 4HMDA 3WQVA 2WZHA 2X05A 1HKMA 4FZPA 1FH8A 1E55A 1C7TA 3EBVA 1J0IA 4M80A 3VDBA 3U5UA 3VD4A 4BQ5A 1W9UA 3WQ5A 1HJXA 4PMXA 4MJ4A 1JF5A 3BGAA 2J74A 3NJ3A 1GJWA 4JFSA 3GXMA 3EDDA 1UQYA 4FLQA 1V0MA 1E6PA 2FGLA 3CHDA 4IPNB 4JIEA 3ZR5A 1WE5A 2CETA 3N12A 3LPPA 4XZWA 4OBRA 1KGUA 2ZOXA 4QAWA 1ZJBA 4QLJA 4BQ2A 3ARVA 2QMJA 4P7RA 2WKLA 1W9XA 4P7QA 2YL8A 3AMGA 1VF8A 1QPKA 5E6ZA 3AMDA 4Z2GA 3DYPA 2IXUA 3BMWA 4AZIA 2W4XA 1WNOA 2BY3A 4MB4A 2DSZA 1UD8A 4QFUA 4S3KA 3T2PA 1NH6A 3CUFA 1ISVA 3GNRA 1W9BM 5IXEA 2ZUNA 3AS0A 1E6RA 1UKSA 4MDPA 5LYRA 1X1NA 1D3CA 1E4LA 1PPIA 1AQHA 3FNDA 2J7BA 1KQZA 4UFLA 3AIBA 5GNZA 1E70M 2EXOA 3CMJA 4V2XA 3WIJA 2JNKA 4H7VA 3EMQA 4M82A 2DT3A 5AY7A 3L4XA 2CXGA 1OGGA 3FXYA 4UOJA 1JIBA 2J7DA 4PRWA 3OLIA 3U57A 1GOOA 1VIWA 4JFVA 8A3HA 3GXIA 1VENA 1G0CA 4WSJA 3B9DA 1C7SA 3OLGA 4KGJA 1CNVA 4J3VA 1M01A 2W67A 2CKRA 1DWIM 1QHPA 3ARZA 1O6IA 4XX6A 3N04A 8CGTA 3AZTA 3AIWA 1ZB5A 3K46A 3CZ8A 1PX4A 2VRJA 5CPSA 4PCTA 4QP0A 1LLOA 3MKKA 3J7HA 3AQUA 3ZR6A 3HMCA 4AEFA 2DDXA 2OYLA 2DH3A 5CPTA 4F79A 3WUEA 1D7FA 3VIFA 1NARA 5M17A 2YDQA 3O6AA 2VZSA 1KB3A 1BVZA 2E8ZA 3GDBA 4ZXLA 2JFEX 2EPOA 4PMDA 3AMLA 5F7UA 2Y8KA 1WB0A 3TOPA 1V08A 3PZGA 3NDZA 4GZEA 3TTOA 2ZXBA 3IJ9A 3ZSTA 4W5ZA 2W66A 1BG9A 3HU7A 3W24A 2WC4A 1SFSA 2VVSA 1RP8A 4PMUA 4YPJA 3A6OA 5EMYA 4JKKA 3WNMA 1GZJA 1SMAA 2X0YA 1CIUA 4TVUA 3BXWA 4HTYA 1V0KA 2Z1KA 4CVUA 4MAVA 1OIMA 1GJUA 5ABGA 5HNNA 2BVYA 5E9AA 3WDPP 5I2UA 3WNKA 1HNYA 3U5YA 2GDVA 5FL1A 1QI4A 3THCA 3SCUA 3WEMA 3VM7A 4E8CA 4LPCA 1KR0A 1LQ0A 2J8GA 5DEZA 4W7UA 1W3HA 1J0ZA 1ZS2A 2BXZA 1VFOA 2F2HA 4D6EA 2CYGA 2VQUA 3CZLA 1TVPA 5IHSA 1J12A 1DP0A 1MYRA 1MQQA 1KQYA 1UR8A 4MNKA 1IZJA 2VCCA 1QI0A 5BWFA 2QLYA 3D5HA 2NT0A 3U7VA 1JAEA 1UWQA 3BAYA 4KH2A 4A4AA 5CXPA 4JFWA 4LYQA 1GQIA 1BYCA 1C8QA 1CXHA 2W63A 4AC1X 1BYBA 1E4IA 2JEQA 3WD3A 4V28A 1FP9A 4MPKA 2YKKA 2JEPA 2WHMA 4PTXA 4DUVA 1V6VA 3VMPA 3W0KA 1E9LA 1WPCA 2VR4A 1Q6DA 2A3AA 4D6FA 4D1IA 3RCNA 3OG2A 1QI5A 3SCTA 4J3WA 1E6ZA 1BGGA 1WDQA 5JBDA 1UA3A 4AWEA 2V3FA 1H11A 2WYSA 3MMDA 3TONA 3ZT5A 1PIGA 1TMQA 3VO0A 3ZMRA 3PHAA 4AZCB 1C90A 1J10A 1UHVA 2OO2A 3TA9A 1BAGA 4D6IA 1ZBKA 4X0VA 4YN5A 3GH5A 3BMVA 2XPKA 1E72M 3UR8A 1DWGM 2DIJA 4ATWA 1QNSA 3WD0A 5I24A 1KR1A 2DIEA 4JCMA 2G4FA 2NSXA 2OWWA 2ESCA 4AY1A 1XD0A 4TUFA 3AIQA 1OT1A 3RM4A 4RE2A 1JDDA 1XH2A 3OA5A 1DHKA 3TTSA 2A3HA 4Z2LA 3GBEA 2J7GA 3DC0A 1IT0A 1BTCA 3W53A 1E43A 2VZOA 4KRUA 2W91A 3WF1A 1WP6A 2XTKA 1K6AA 1XCWA 4CD8A 4CUCA 4V27A 4R27A 4UFHA 1J0HA 1LL7A 4JFUA 4HPHA 1B1YA 1UUQA 1GVIA 3VNZA 3AHZA 1E15A 1E40A 1HL9A 3CZGA 3WELA 4QLLA 2BY0A 3MANA 4N0RA 5EBAA 5FKYA 4DWSD 3W6MA 3UCQA 2D24A 3AJ7A 4MNJA 3WH8A 2IUZA 4N42A 4CCEA 1BYDA 1CENA 3SCPA 3WH6A 2BHUA 3GBDA 3CUJA 4PN2A 4W89A 2CITA 2WXDM 5CSUA 1NQ6A 1GUVA 3ARPA 3AXHA 5A6LA 1ITXA 2J78A 1IV8A 1V3LA 1R7OA 1HVQA 2WZEA 1E1EA 4TX8A 1QNRA 3BCDA 3WSUA 2QF8A 3OZOA 2XG9A 3WKZA 4UQAA 3CUIA 2BNJA 3I3BA 2PWDA 1H2JA 3II1A 4UQEA 1PX3A 5A6KA 4WLCA 3VIMA 4E2OA 2Y4SA 4LXFA 2E40A 3MMWA 4UQDA 2DPEA 3VD9A 1BLIA 2EPNA 1H0GA 3UETA 4JCLA 4MB5A 1I1XA 3EMCA 1TA3A 1CDGA 4UZUA 4FZOA 3CHCA 1CXFA 2EO7A 1CECA 3KEHA 4ATDA 4JFTA 5D9MA 4RE4A 4MJ2A 1MW0A 2XVKA 1CGTA 1H49A 4L4OA 1CLVA 2YDRA 1CZ1A 1C8YA 3WNNA 1UR0A 1VFUA 2CKSA 2AMGA 1UWSA 2BVTA 5ABFB 1CXIA 1F4HA 3PN8A 1B3VA 2DH2A 1HP5A 1CGUA 2ZX9A 2DSKA 1B30A 4MNMA 4EKJA 4JL2A 1ITCA 3CO4A 1GOKA 4C7FA 1UD6A 3GNOA 4U3CA 5I0DA 1H3GA 3ZJKA 1V3JA 1R86A 2J77A 3VMOA 4HOWA 3N9KA 1U33A 3NSNA 4WKAA 3AS1A 3F5LA 3AI0A 1ODUA 5A8NA 5CLTA 1W9PA 4A3HA 1CXKA 1E0XA 1FH7A 4CD4A 5A8PA 3AHYA 5C70A 2JIWA 4ZENA 5ABEA 3WQWA 5EFFA 1JZ6A 4YHGA 1M04A 1LL4A 3BAWA 2JE8A 1VAHA 4AZGA 1LL6A 1K9TA 5I79A 3M7SA 3FHAA 5A1AA 3ZOAA 5JBEA 2PMRA 1EA9C 5E6YA 3VDAA 1TUXA 2VT0A 4OOZA 2FH8A 4ACZA 2IXVA 4AZ7A 3A3HA 3SCQA 3PTQA 4PEEA 1K9FA 4NF7A 2EPKX 4B9YA 4XV0A 1M53A 4P7LA 1K9DA 2VX4A 1JL8A 2ZX7A 3M46A 5FIPA 1ECEA 3PZQA 3WNPA 4UFJA 3MUIA 3PZMA 2V5DA 3SCSA 4JZ5A 2DT0A 4JHZA 4PSPA 4U31A 1R87A 3OB8A 1EO5A 5DT5A 1HVXA 2FH6A 1E6NA 3UESA 4CD5A 4AXNA 3VILA 2WCSA 4MNLA 5EFDA 3VGBA 1BGAA 1XH0A 1EIBA 4EK7A 3K4DA 4MB1A 4A3YA 4ZEPA 1DWJM 5BXRA 3FAWA 4CCCA 2CNCA 3AISA 1KXHA 9CGTA 3WMCA 1J0YA 3L4TA 3OBAA 1HN1A 1HJQA 1O7AA 5BXTA 1JI2A 3CZJA 1E5NA 1H41A 1XSIA 2WVTA 4XZBA 3GZAA 5A2BA 4BQ4A 2PC8A 4C7GA 1J11A 4BCEA 3SCOA 2WK2A 4AZHA 1Q6EA 2WANA 1BQCA 1UA7A 1M7XA 3L2MA 4OOUA 3S6TA 1FHLA 3WH7A 3T0BA 2XHYA 1B2YA 3PTKA 2WWDA 3B9EA 3BSHA 3VTRA 4IISA 3FAXA 2OWCA 4HZ8A 4LYRA 2TAAA 2ZXDA 3DECA 1QOXA 5BXSA 2W92A 1P6WA 3OLDA 1JZ2A 1QNPA 5TD4A 3WDQA 1KWKA 2QPUA 2W61A 4WKHA 1MW1A 4H8VA 6CGTA 1KGWA 3ARXA 2WHJA 3ZSSA 5A6BD 5LA2A 2O9PA 3GXDA 3SIMA 2VX5A 1V0LA 1ZBWA 2QPSA 5ABHA 5CGTA 3WD2A 1GVYA 1MQRA 1JYNA 1V3IA 1XV8A 1YQ2A 1I1WA 2YBUA 3M6DA 2E0PA 5HXMA 5JBFA 3WDJA 1OGSA 1A3HA 3WQ4A 2CBIA 1NOWA 2J7HA 3AIVA 1VBRA 1XD1A 3ZQ9A 5CG0A 1FP8A 4KGLA 3MUY1 3VGEA 1ZJAA 2ZWYA 3G6LA 3RDKA 2D20A 3VIIA 3KL0A 5A2CA 5CJ5A 4BA0A 3ALGA 1E5JA 4XB3A 3WENA 3SUSA 2PF0A 2UY2A 3E1F1 2YDSA 2ZUWA 1WAWA 3WH9A 3OIHA 3IAPA 1C92A 5IFTA 4GO8A 1OB0A 3VGHA 3IJ7A 1DEDA 4Z2JA 4U3AA 5A69A 5A6JA 5HDRA 2BS9A 2OYMA 5E0CA 4Y7EA 3A4WA 1IZKA 1KXVA 2JF6A 3SUTA 2QMKA 1HKIA 3WF0A 3K8KA 1QBAA 4E4PA 4FMVA 3SCVA 3F5KA 5EB8A 4U2YA 1XC6A 5A3HA 3WL1A 1E3ZA 1VBUA 2YA0A 1JYVA 4DUXA 3CTTA 3LPOA 4JHOA 1EO7A 5I23A 3VGGA 1SR0A 1VFMA 2Y2WA 4UNIA 2DSUA 5M3WA 5GQBA 1GONA 4MADA 2XVPA 5GNXA 4J3SA 4EANA 1WZKA 3NSMA 1EQPA 1HP4A 1JXJA 5AYIA 1OGBA 3OGVA 2AOSA 1HF6A 1QHZA 4CD7A 3VU2A 3SUVA 1KBKA 1PJ9A 4WKFA 2EJ1A 4TOQA 3ZT7A 2G3NA 2WC7A 5BRPA 2YL9A 5A8MA 3VD5A 1UWUA 3L4ZA 1HIZA 3WF2A 1CBGA 4AW7A 1UQZA 1AQMA 5A2AA 5BYWA 1B3ZA 2WMHA 1BVNP 1MQPA
chains in the Genus database with same CATH superfamily
1YBQA 3MBFA 4AWUA 1JDAA 3LHTA 4Q8OA 3HN3A 3L4YA 3DBPA 1NDVA 3A9BA 4KBXA 1BWVA 5HQLA 5M03A 1XM3A 3PFRA 1LUCB 4K68A 3QY8A 1QOPA 1PO9A 3MS8A 3B51X 4UMBA 2XFYA 4JNEA 3V7PA 4MFEA 3A47A 2EG7A 2CESA 4IF2A 4HOXA 5C9RA 3V16A 4X22A 1NTHA 1DJHA 4OT7A 4IMDA 3LM7A 4AQLA 3GU2A 5A6TC 5KEZA 1JZ8A 1K4GA 3P82A 3WYZA 3IV8A 4ZGYA 3VPLA 4MTVA 3W7CA 5CBIA 4E3CA 4LSBA 3FKRA 4V1YA 4D6GA 4LS0A 3WL0A 5I00A 3W28A 3UXDA 1XFBA 5KZ6A 3URBA 3N6HA 2XWDA 2D1LA 3VIHA 2C0HA 2P76A 4BWLA 4KQNA 3VK5A 4WCJA 3VC5A 3KOFA 3K8LA 3A12A 2C7FA 3QSRA 3EEGA 3GYEA 3D4ZA 2J25A 5IOBA 3QNIA 4K8EA 2Z0OA 5A94A 1VYRA 3PPGA 3C56A 3G2GA 5FF0A 2VZUA 2YW3A 3ZJ7A 4PMNA 3PUOA 4JR5A 1LRNA 2UWFA 3HPFA 3CT2A 3W7RA 5KINA 4N4PA 2YYUA 4AIOA 1UKOA 2QGYA 5BRQA 2FHFA 1GTEA 4CGTA 3PR2A 2AQWA 3UA4A 3RU6A 4CCDA 3APGA 4X9YA 5D02A 4WIWA 1U22A 4L4PA 5LA0A 3FW6A 4J3ZA 1TV8A 2EPLX 1YE6A 4EF8A 5I3DA 1W1VA 3A21A 5E70A 1P6CA 2PDMA 9XIMA 4R5LA 1X96A 1U5HA 3KTXA 1MRAA 4YIWA 2WNNA 4I7UA 3DHUA 1GHRA 1QI3A 4O16A 4F66A 1SO4A 1XHGA 2IKJA 5EMJA 1IT8A 4CVWA 2C6QA 2JGYA 3S1XA 3RPMA 4B5UA 3HM7A 3W7IA 3CS2A 1EIXA 3WLLA 4W86A 3PZVA 4LANA 4B3KA 3SFWA 2JF7A 1V7YA 3SADA 2OMAA 1DJZA 4MDOA 2WYIA 3UCDA 3MVIA 1MFUA 1VRXA 2QUVA 1HT6A 4PMZA 3TN5A 3JS3A 2VM8A 2RAJA 5ECUA 2DW7A 3UW6A 1H7RA 5BCAA 3NPVA 4M7SA 4EXQA 1EGMA 4UFMA 1E1FA 2AL1A 1JGMA 1MXDA 4DJFA 4P8WA 2J8TA 2EG8A 1EKOA 4WVXA 4W87A 2DP3A 2X0HA 3SRHA 3CZEA 3ARQA 4E3VA 2PGFA 5LNRA 2NSOA 1KM4A 3A98A 2V5CA 2WPGA 3KDNA 4IH3A 1FTXA 2GGHA 1I60A 1BFNA 2OKOA 5HNUA 3EOUA 5EKYA 1EYEA 3TJLA 2E8YA 4GX9A 4CN6A 3UERA 3GE7A 4DBEA 3TXZA 2YXXA 4C1NA 3W87A 4K39A 3B9AA 3IJIA 3G0XA 3H2CA 3ME3A 3GG8A 3VNKA 1BKSA 4GY7A 3UWUA 3T8LA 1PDYA 3D6NA 3PPHA 4K6AA 1EBHA 1JNEA 3TSMA 1B0IA 2E6AA 3EJRA 1R30A 2WLZA 2WWCA 2QCDB 2YA2A 3NAVA 3VZZA 4Q8TA 3D52A 4M24A 4D2JA 3KCOA 1VYSX 5HANA 1KM0A 1M7JA 1OCBA 4CKQA 1CLXA 3R7MA 1US3A 4CU6A 5E93A 5TBOA 3TP4A 4JBRA 3ZJ8A 3C2FA 3D2EA 2WNWA 3EJTA 2R9RA 3CHFA 4PMOA 2XZ9A 1UB3A 4CN1A 4U5IA 1RJPA 2GQAA 4QNWA 4LFYA 3I7SA 4ZL1A 4C6BA 4Q6JA 2ZXQA 4W7VA 1H7XA 1EEXA 4HA1A 3EDJA 4PULA 4ZODA 2DORA 5TIMA 3QKZA 1W9DM 4HYRA 3AU2A 1QI2A 1PZ0A 2QCFA 4BF9A 3GIPA 2O4MA 3EJUA 1EGVA 1E9YB 4XBKA 3F2CA 1SJCA 2YIAA 2EFLA 5FIGA 1W3TA 3QPZA 4N6FA 1XDJA 3MJMA 2I5IA 4FP1A 4HD5A 4HMEA 4REQA 3ID7A 3T4AG 1IGWA 5AHMA 1DIDA 1GYMA 2EKCA 3P8IA 4DYKA 1Q66A 1UPMB 3B4UA 1K8YA 1FCQA 3TR2A 4KEVA 2J9YA 5D9OA 5LNUA 5DY3A 2E1DA 4MZYA 4JYEA 2FDSA 3EJSA 3TW9A 3GC2A 3VOJA 4GVHA 3TK7A 4P8UA 1KGXA 4M56A 3QR0A 2F7OA 1XIDA 2EGZA 5HOSA 3UPMA 3LCXA 5TQLA 4AH7A 2G4JA 1CGWA 1HJUA 3QGVA 2D1ZA 3SCNA 1XQLA 2VC6A 1W1IE 2IQTA 2WJEA 2XIJA 4HU0A 3U2OA 1O68A 2X41A 1TG7A 3G3MA 5HR6A 1S46A 3GU1A 1LF1A 3K1DA 3RJXA 3IJ8A 2OW6A 2X1TA 1IWBA 3CEPA 1DJQA 4PYSA 5CSRA 2GK1A 4ICNA 5DF0A 3M5VA 1XIIA 4EZVA 2Z6JA 3H7VA 1E0VA 2WB5A 2R82A 3NL5A 4CNUA 2CZEA 3S6DA 4HN4A 4K8GA 4W88A 2B0MA 4UUIA 3BW2A 4IIEA 2GF4A 2PD9A 1LLZA 2Z0IA 2RFGA 3DFSA 1AQ0A 1UJQA 4Z1BA 2O56A 1FWHC 3PZTA 5CJNA 2C71A 3BLDA 3NL6A 5CZTA 3G1VA 1QCWA 4GO9A 5A6AA 5I77A 2GUYA 3H22A 2PLCA 2JKAA 3TZFA 1YTKA 1E6XM 1Y5XA 2CLPA 4W84A 1DOSA 4DQWA 2BTMA 3TMLA 1YBQB 2EQDA 4H9ZA 2HTMA 4U33A 5TKYA 1R2SA 4EXBA 3ECQA 4AZBA 3WLQA 2Y6ZA 1FWFC 4GC4A 2RDWA 1IZCA 1H7WA 2PWEA 4GUGA 3KVJA 1HKJA 1XG3A 2W5FA 2PP0A 1TV4A 4FLSA 1GQLA 1J0KA 3LPGA 1PEZA 4HCDA 3UD6A 2QHAA 1ZAHA 1AZ2A 4OHQA 3WLKX 3TJ4A 4NZ3A 1IF2A 4ZB5A 2X7WA 2E9MA 4KCVA 2DZWA 2JGQA 2E68A 1W3KA 5FJJA 1GQKA 1SZRA 1FWAC 3LHZA 4H6QA 5LA1A 3ONCA 3UJFA 2BY1A 5H8MA 3W38A 3Q37A 2R1NA 2CXEA 5FSDC 1QPRA 4MUPA 1PAMA 3BJTA 2X40A 5DXYA 2CPUA 3E96A 2NX1A 2OT1A 1CGYA 1KXTA 3GB6A 3CV1A 2J6VA 3R6IA 1X97A 1JCNA 2PY6A 3GW3A 3NIYA 5G4WA 4LWWA 4LX4A 1K02A 2HSAA 2RUSA 1VFFA 2AAAA 1UMLA 3BUPA 3QQ0A 1XIGA 5AN7A 3NFUA 3HAJA 1V02E 3ZLGA 4O8RA 1NF0A 2E3ZA 2UY3A 1UD2A 3TTYA 3WDIA 3W27A 4JTGA 1V6WA 4PMYA 4Q8MA 1YTDA 1OHLA 3KDOA 2FB3A 2CBUA 2DFAA 3OYXA 1LOLA 4IIBA 3KM8A 3S2LA 1NOFA 5DCBA 3QHMA 1IE7C 1PZ3A 1FFQA 5K3VA 2XFFA 4WJ8A 1V3MA 4XZIA 4Z1CA 1E71M 1XKYA 4R9XA 4GBDA 1FA2A 5C7HA 1GZGA 4O19A 2C16A 2YBVA 1TVNA 2PTYA 4LVDA 3FN9A 5HPCA 4J2MA 1UZ1A 2FHCA 4DBUA 3GM8A 4UR9A 4F0LA 3E02A 4WDTA 4XAZA 4YTSA 2YBTA 3VKBA 3CTLA 1H5VA 4DPPA 4HT3A 3ICJA 2BDQA 4C6MA 2OSYA 4ZFCA 3QF0A 1XLCA 3N4FA 3S9YA 2VGFA 3BTNA 3GZ3A 1TV3A 3MUZ1 3OGRA 4JY9A 3RHGA 2Y5SA 4A8NA 4IQDA 2OWXA 4AD5A 2PB1A 3VGDA 3HV8A 2XYLA 4JX5A 1XLAA 2PTDA 3RV0A 3ERCC 4ML4A 4YCPA 3C2YA 2OGJA 1J93A 5D9PA 3ANVA 3UXKA 1XLMA 3QV7A 4NZCA 4JX6A 1NFBA 1SW7A 1I2RA 2A5HA 1GQJA 1BQGA 1C9WA 1XYZA 2CC0A 3WJXA 3CNYA 1GKQA 3OJGA 4DF0A 2OG9A 4JAWA 3VKKA 1RY8A 1I2NA 4HZ7A 2ZRZA 1Y7VA 3B04A 3G1RA 5HINA 3F1QA 5CC3A 3G18A 1SU5A 3L3OM 4MY9A 1MEIA 4R5EA 5AHLA 1CTNA 3GXNA 4KWUA 2E67A 1J6PA 2X7VA 1B9ZA 3ORWA 4IWOA 2V3GA 3FDGA 2WVSA 1JUKA 1QOQA 1R8LA 2CLOA 2ZA2A 3QMTA 2JKEA 1FHDA 3MU7A 4C1NB 2AQOA 3M44A 1B4KA 4FIRA 3KAVA 1HO4A 4S38A 1PSCA 2Z28A 3N18A 3U2ZA 1S3HA 2JIEA 3RAOA 1UROA 2A7PA 3AMKA 3HV9A 3QHOA 4M81A 3TNBA 4UNLA 3BH4A 4CNOA 4H04A 2GVGA 4UOQA 4GY0A 1TE6A 1J5SA 4KFPA 4M6QA 2YZ5A 3LTPA 3LRMA 1WZAA 2QKWA 1L2QA 3CB3A 4GVGA 2WHKA 4KEUA 4AX6A 4A05A 2VTFA 3CIVA 3UZZA 3WUFA 1XRVA 1H61A 4FXRA 1E1DA 1V03A 2AGKA 3LEPA 1V3KA 2XH4A 4J27A 3RILA 3N15A 2XIOA 3RCYA 4C6NA 3S9IA 1WDRA 3HQ1A 3ES7A 3ZM8A 3W4RA 1R85A 3FOKA 3QOKA 1LWJA 3OW1A 4GABA 1ZUAX 3C0SA 1OA1A 2GSJA 1QO2A 4EZUA 3M0VA 3I4EA 2QULA 3OU8A 3DGRA 4B5TA 4J35A 1YDNA 2RDTA 3BVWA 3B8UA 3PSVA 1L8NA 3VNJA 2NZLA 4NSWA 4Y8EA 3CUHA 1TR1A 4UTTC 5CZKA 4REQB 1QATA 2V2CA 1BXCA 4GNKB 3NYZA 1XYLA 3BOXA 5J5RA 2D3NA 4JQ4A 3H4WA 2XGBA 3PBUA 1P0EA 2WMKA 4PUEA 3W1UA 4IQEA 3EB2A 2E9LA 4PCFA 5CZSA 2ZWZA 1XSJA 2VZVA 4Q8QA 3WQDA 4HHLA 3VD3A 1KC7A 2GDUA 4IUGA 4DZIA 3MV01 2D0FA 1XLHA 3T09A 1UWTA 1N8IA 3UNTA 4ZOEA 3VIGA 3WH5A 5LIUX 1AFSA 5ABFA 1BF6A 3DHFA 1ZTVA 3N6JA 3WLSA 1LT8A 5D2XA 1UOKA 3BVXA 3IIVA 3H23A 5G1MA 3GS6A 4QIUA 2PI6A 4H9VA 2GUUA 1FWNA 1UD5A 3F4VA 4QDMA 4W85A 3S2CA 4GJJA 2F84A 1OD8A 1WX0A 3TIMA 4GIRA 4XVEA 2X1UA 1GHSA 4QG9A 3H6OA 4XK2A 4Y90A 3EX2A 4HPGA 2GK1B 4AD0A 1KRCC 5E09A 2REQA 3QHNA 3QOMA 2VDIA 4NZ4A 1M6JA 3BZGA 5E9XA 2OOFA 1HKMA 1SU6A 3XIMA 4XZMX 3KXQA 1FH8A 1XYCA 4ADSA 1OYCA 1ZP3A 2QUNA 1J0IA 4M80A 4U4MA 3VKJA 2QVHA 3U5UA 5AFDA 1W9UA 1TQSA 4MJ4A 2WSYA 3DHDA 2OT0A 1KD0A 1YYAA 1UQYA 1DKZA 4XD5A 4FLQA 1V0MA 1A50A 4IPNB 4JIEA 3ZR5A 4R5IA 3DUGA 3N12A 1U5VA 2ZOXA 4QAWA 1ZJBA 3QA8A 3ARVA 2BSLA 4P7RA 1HTIA 2GGEA 1QPKA 1JQKA 4XAPA 1P1MA 1WNOA 3OO2A 5EL1A 1UD8A 4QFUA 2GUBA 2A0NA 4US5A 4A8RA 3GHSA 3GNRA 2ISVA 1E6RA 4MDPA 1WXYA 2HMCA 4HKPA 1D3CA 1SSDA 3COTA 3WLNA 2ON3A 1AQHA 3FVDA 4ZQPA 5DLCA 1UP0A 4R7OA 3KTCA 4H8NA 2EXOA 3L65A 2PAJA 4C6JA 1IXNA 5I02A 3L4XA 2GJLA 3FXYA 3I6RA 3IIOA 2ZDSA 3OLIA 3U57A 3R8HA 3LXBA 3QW4B 4O15A 1LWIA 4IWWA 1CNVA 3HA1A 3ITLA 3WMLA 4HYVA 5TAOA 1DWIM 4TU1A 1A3WA 3AIWA 4ERIA 3K46A 1HKWA 2VRJA 2NCZA 1I2PA 2RAGA 4IJBA 4PB4A 5F2MA 3MKKA 3S5OA 1WOAA 5CPTA 3NQAA 4XAYA 1SPQA 3EOSA 1RXOB 3MO7A 2Q02A 2FVKA 3E74A 5FEWA 3E49A 2YDQA 2HE5A 3H21A 2A3LA 3O6AA 2JFEX 2G5WA 4H6IA 5H2ZA 1QK0A 3MHGA 3B8IA 2Y8KA 3A3WA 3CUXA 3CC1A 4GX8A 1V08A 1JJKA 1TJPA 3NDZA 4GZEA 1XCFA 1RLDA 2DUZA 3IJ9A 4E4UA 1QPNA 3PTDA 3WJYA 3G1YA 4DJFD 2TODA 3NO1A 3E0LA 2RHGA 1I4TA 4WDUA 3QRHA 4GYPA 3P67A 1IR2A 2RJGA 3Q45A 4E3TA 3DERA 1UP2A 2X30A 4JKKA 5GVJA 4IMEA 1CIUA 4DF1A 4TVUA 3BXWA 4MGGA 4S3BA 5BMXA 2QFFA 5HNNA 1RPXA 2BB0A 4ML9A 5E9AA 3WDPP 5DY2A 1HNYA 3EWCA 2GDVA 1QNVA 1KR0A 4H9YA 2J8GA 3O0FA 4W7UA 4OWGA 4L9YA 5JU6A 4I9TA 3SQLA 3EZ4A 1ONWA 1UR8A 3GFZA 2C79A 4HNCA 5GJMA 3L68A 5AVNA 3GDLA 4A21A 1UWQA 3OQ8A 3LZ3A 3QSTA 1GQIA 1C8QA 1CXHA 4ES4A 1ADSA 2Q71A 2YR1A 2A2IA 1AJ0A 1E4IA 2JEQA 4O0ZA 3UXIA 3HPAA 2GVLA 5B7ZA 4GE8A 1U1HA 2A4AA 3A3XA 3KVMA 4NP7A 1XPYA 5TF0A 1GGOA 4D1IA 2G50A 4WXZA 1I45A 2OO6A 3MJYA 1Q7MA 5H8UA 2OCZA 2ZC1A 2Q01A 3FCPA 3NPXA 4J3WA 3AAMA 3IACA 4WY0A 3GTXA 4NPHA 4GOAA 3W86A 1QJWA 3W7JA 2Y88A 3PBYA 4FR6A 2ZKMX 5F2LA 1I8JA 3PHAA 4HB7A 1C90A 1J10A 3LOTA 1YIXA 1SR9A 5D2YA 3TA9A 3M3WA 1BAGA 1PCKA 3GH5A 3BMVA 4WHBA 3N34A 3H54A 4AKVA 3S9ZA 3V1PA 1S39A 3UR8A 3UY7A 3BWWA 4XTDA 4ATWA 4KWVA 3WD0A 1T0OA 4HNTA 3T1GA 2PWUA 2HXTA 3LM3A 1F2JA 2GZXA 4POCA 4DELA 3G3DA 5HUPA 1PVNA 1OT1A 3RM4A 4RE2A 5FI8A 1YDOA 3OA5A 4GISA 5LNWA 3PJUA 5BW6A 1ZJHA 2PRHA 3C2RA 2A7NA 3GBEA 3W53A 3CLMA 1TR9A 2FYMA 1JPHA 2XTKA 3STEA 1K6AA 2BOEX 4CD8A 1A0EA 1H50A 5D32A 3WQCA 4UFHA 4GG9A 1UIOA 4PTNA 1LL7A 3QXBA 4ENLA 2Q8LA 4JYDA 1UUQA 3UJEA 3CZGA 2BOFX 4XVDA 3DX3A 3LCIA 2PDBA 1BKHA 1QO5A 4CCEA 1UZHA 3EWBX 3G0UA 4I5UA 2BZNA 4PN2A 2ACQA 4FEZA 2CITA 3HPZA 1O5QA 1SW0A 3AXHA 1IV8A 2BP1A 2HPIA 3EA1A 1HVQA 4TX8A 1H7NA 1RVKA 2QF8A 3OZOA 3W2JA 5B7YA 3A22A 4UQAA 3SGUA 4NAEA 2BNJA 3ZLHA 1V8EA 3KX6A 1H2JA 3II1A 4UQEA 4PB5A 3CH0A 4K7YA 3BLEA 3L67A 1O60A 1NDYA 4KS0A 4X3ZA 2VWSA 3RRXA 4GY1A 1QX1A 1GZ1A 4UQDA 1K70A 4AWTA 2EPNA 3UETA 4XKMA 4MB5A 3C0JA 4UZUA 1CDGA 1GOXA 2EO7A 3MSRA 3KEHA 5FJUA 5D9MA 4I9JA 3NR0A 4EZWA 1A5SA 1XX1A 4C1KA 3DXIA 2XVKA 2DY3A 3LHWA 3SN1A 3DDMA 2YDRA 3ANUA 3WNNA 4G7EA 1P0BA 4WJEA 5ABFB 3E5BA 3OZYA 1F4HA 2Y62A 3QGAC 1B30A 3TYBA 4WPEA 1UD6A 4X60A 3V5FA 4L80A 1Z3NA 1D7KA 4EOUA 2YW4A 1V3JA 1CT5A 5H6HA 1N55A 3PP7A 2PC4A 3EB3A 1J2WA 4DLMA 1G69A 3ATYA 5LIXX 4DAFA 4LS1A 2HS6A 1PXGA 1B54A 3G77A 2HS8A 5CLTA 3PLTA 3ATZA 4F2UA 3DFQA 2CLLA 3M0HA 2ACRA 5A8PA 4Q3MA 4RW5A 2REQB 2QJGA 4JTKA 1XS2A 4IG2A 3OBKA 3OVRA 2NQLA 4JTDA 2R1KA 4B5WA 3WQWA 3B52X 3CL6A 4I6VA 3KCJA 3RFAA 2VFIA 1BXNA 1WXZA 3ABZA 3OBEA 3PWIA 1YNYA 4G1NA 1XKJA 4YHGA 5CBBA 2V2DA 2Z26A 3MP3A 1ZGDA 4K2SA 1RK6A 2FPTA 1TWZA 1W0MA 3ZOAA 5JBEA 4ZOAA 4HSOA 3PFMA 3VDAA 4Z08A 1Y5WA 4S3EA 3N2BA 1X7FA 3A3HA 1QMLA 4L64A 3PTQA 4KCTA 2EPKX 4W9TA 3C86A 4IGHA 4P7LA 3TJXA 3MW7A 2ZX7A 3F4NA 1IEVA 3H24A 3WNPA 4UFJA 1SFLA 3MUIA 1S5WA 3PZMA 4PUUA 3SCSA 3RITA 4JZ5A 3F4DA 1U00A 4RDYA 2ASHA 3HO8A 4PSPA 5EMMA 2PUZA 2PRLA 4U31A 4GH3A 3A9IA 1EO5A 5DT5A 1KM2A 2FH6A 1GQNA 2Z7GA 1E6NA 1BWLA 5C2XA 3MZNA 5EFDA 3E2RA 3VGBA 1BGAA 3W9ZA 2CFFA 3DIPA 2QJIA 4GCAA 3MMTA 1KXHA 3L4TA 3Q67A 2PCQA 3RUBL 1V51A 1FWIC 1E5NA 3NPUA 4ZQCA 2P8BA 4XZBA 1DXEA 3P2VA 4IX2A 1YPFA 3CM4A 4BCEA 3YPIA 2WANA 4EZTA 3L2MA 4OOUA 3SRFA 3GAKA 3O16A 3S6TA 3QTGA 2PURA 3TFCA 3WH7A 4PFHA 4O52A 2GDQA 3UYIA 4WD0A 3B9EA 4IISA 3FAXA 2I56A 1FWSA 1AH0A 3W7KA 4G5DA 2TAAA 2ZZ6A 3E0IA 1QOXA 1EC9A 3DECA 5BXSA 3OLDA 3WDQA 4O54A 1B57A 1MW1A 3OEXA 4BEUA 5DELA 6CGTA 3LI0A 1EWEA 3ARXA 3ZSSA 2O9PA 4NYYA 1VHNA 1LDCA 3QBUA 1ZBWA 2J66A 3W2MA 3WX7A 4O50A 3O6DA 3HPXA 4JQ2A 3WD2A 3PUGA 1JYNA 1YQ2A 2YDAA 1S2VA 3WDJA 4MUZA 1A3HA 3L9CA 2J7HA 3AIVA 1KW1A 3SY5A 1RY0A 3NQBA 3QZAA 3MUY1 4L1GA 3FA3A 3VABA 4ZTYA 3GXPA 3VIIA 3KL0A 5E1QA 5T91A 5CJ5A 4BA0A 4WXYA 3RPTA 2BVWA 4ONVA 4PRRA 3WK0A 4BKNA 1ADDA 3E1F1 2YDSA 2ZUWA 5AC8A 2CU0A 4JQ3A 8XIMA 1EJRC 4HIBA 3DFHA 4DBSA 1C92A 4AFYA 3BOLA 4LBUA 4MWAD 1DEDA 4R53A 4Z2JA 5A69A 1EP2A 1L6FA 5E0CA 2ISWA 1IZKA 1I49A 1TMLA 3AU6A 4Q8PA 4FXJA 3SUTA 1A4LA 5JMUA 1QBAA 1OQFA 2ZYFA 3R12A 1UUMA 2FVLA 4CNNA 5A3HA 1E3ZA 3CV6A 3QNJA 1KM3A 2YA0A 2C15A 3W2LA 3VEAA 3SB0A 3CTTA 3LPOA 3QWEA 4JHOA 1OX4A 2PDHA 1UBPC 4DNHA 1ZCCA 1SR0A 1XLEA 1VFMA 4UNIA 1I4DA 5M3WA 2XVPA 5GNXA 4J3SA 4Z17A 1EQPA 1EUAA 3OGVA 3XISA 5BNKA 3UZXA 4L1WA 4CD7A 3EEZA 3RXZA 3SUVA 5HQMA 3KRZA 3K13A 3LLXA 4JY8A 4NASA 3UNDA 3OWGA 4FNPA 5A8MA 3P84A 4KT2A 1ZALA 3DENA 2BGNE 4BI7A 2VC7A 2VP8A 3D3FA 1UQZA 4XQ6A 2ND0A 4LV4A 3WK3A 3TJIA 3C6CA 4P8VA 4DJED 1MZRA 2JNSA 1AK5A 5A8GA 5D2TA 4YWIA 4RZ5A 4CCZA 1POKA 4GQQA 4X2PA 3GTIA 3N9RA 1AL7A 3QM3A 2MANA 2V5KA 1Q6FA 1W56A 3L4UA 2FPYA 4YYFA 3SAZA 2ZE0A 4WF7A 1YPIA 4FOKA 2C19A 2I7GA 4DI9A 3L3PA 3ARSA 4AD1A 1S2UA 4N02A 5CC5A 4INFA 1YW1A 4IXXA 1DTUA 1SZEA 1P0NA 1PIIA 4OV4A 5EPDA 2Y24A 2V5LA 1KCLA 2OZTA 1UZ4A 4OIFA 1TSIA 1ZYLA 4JTUA 4LVFA 4RCXA 1XSKA 3VDGA 5FF2A 3BAJA 1NDWA 1RBAA 2ZICA 3WMBA 4KEMA 1G5AA 1N2VA 1XYAA 4YYCA 3KFTA 3DG6A 4NI8A 5BOOA 3N1AA 3H12A 4HZMA 4O11A 4QS5A 2VI0A 3PANA 3KS6A 2R1LA 3Q0KA 1EQCA 1EX5A 1BD0A 3ZT6A 4IM0A 3QLDA 3WEOA 1J79A 1GVOA 5FJTA 3BURA 4GINA 3WQOA 3CAQA 3EWUA 4TTUA 3RJYA 3S1GA 3KS5A 3CLWA 4I5XA 1DJIA 4JIRA 3HURA 2BY2A 4NAEB 2WSRA 1LZOA 2XH0A 2OTDA 1SO3A 2GYIA 4HYBA 3TCEA 3JUGA 1ZL1A 3CMFA 3GWQA 1KLYA 5EYWA 3WQ6A 5GJNA 3POHA 4UTFA 1O95A 3CH9A 1EJTC 3FVMA 2DT2A 3RX4A 1AJ2A 1W2VA 5DMMA 3WUGA 1K6WA 1MJGA 5K9DA 3BPWA 3TROA 2YL5A 2FHBA 2J4GA 3W1LA 2V3DA 4D72A 3RM8A 1CGXA 4PB3A 4Q32A 2XVNA 5AYXA 4G7EB 3OHIA 2C18A 1ISZA 1TZ7A 5HK4A 1HXJA 3W7QA 2WCGA 3UT0A 3PNUA 3W26A 2WNQA 3WUBA 1JYWA 1KFLA 5D09A 1WCGA 2QIWA 2XM1A 3W83A 2OKTA 3M07A 4ORIA 2ALRA 1HFBA 3GO2A 4US5D 1UWAA 5TNVA 3VIPA 2PLMA 4B3LA 3UG5A 4ILSA 1L0PA 2G3IA 3RGTA 1GORA 5FL0A 1SM9A 1UASA 3I2WA 3R1ZA 4A2RA 1FWTA 1BHGA 4Y9OA 5AC7A 1TFVA 4BF7A 2Q8ZA 3ZZ1A 3BC9A 1R3VA 2H6RA 1CGVA 3ES8A 5HUOA 4IG2B 4GKLA 4M3PA 5EU9A 1W31A 3CZKA 4UMCA 3PUEA 1TWWA 1KM6A 1V7AA 4F9DA 3G1HA 4GXMA 3NZPA 3WD4A 3WQGA 3TZNA 2MI7A 3A5FA 4D6HA 1VKFA 3H7UA 3AYTA 1QR7A 1GNXA 3HG5A 3M0KA 1W8SA 3T4CA 4BWLC 4ZB0A 4NJHA 3D0CA 3JRKA 3WMSA 3DOPA 1AMYA 4CQDA 4JTRA 4DM2A 5PTDA 1ZY9A 1UP3A 3LHYA 3BARA 4B16A 3WF4A 2C13A 2VFEA 1S38A 2E09A 1OZQA 3AXMA 4M5PA 1CYGA 5HBFA 3KL5A 4NL1A 2OLSA 3BK0A 2WVUA 1PS3A 3O7UA 4KFNA 3ABSA 4C5ZA 1F8IA 2Z4GA 1X6NA 3LV5A 4DEFA 1NFGA 4HPJA 3TTEA 3EYPA 5I3IA 5CJMA 3QE6A 4B2DA 3DFTA 1MWOA 3N4AA 5FOOA 4MPQA 1J0JA 5FAGA 3MCMA 3WNOA 2X3WA 4DBWA 2PDWA 3SECA 1DPMA 4D8JA 4ACYA 1NP2A 1Q85A 2WMFA 4YCOA 3VFCA 1K8XA 2AGTA 3DPQA 1GVEA 3TFXA 1YRRA 4IIFA 2YL6A 1VB9A 2XFRA 1GEQA 1WKYA 2IPFA 4TXEA 5HAOA 2GWNA 1ZZMA 3W2UA 4ZFMA 1F7BA 1NP0A 5E0KA 3CPRA 3L0GA 3EPNA 3SRKA 2Q8XA 1OX5A 4A35A 1ISXA 4PR4A 3C4UA 1TE1A 4IPIA 3N73A 4GVFA 2QUUA 9XIAA 2ALDA 2J7CA 3CUGA 4FXSA 4GQRA 4L6DA 4UMAA 4D6JA 1FOBA 2QAPA 4NZFA 5G2HA 1WO2A 4LC6A 5DXXA 3M1ZA 4IJRA 1OG6A 3TA6A 4XWUA 3RLGA 3W7GA 4HK5A 1TCDA 3PJWA 3DYTA 4NYUA 1S5NA 3MSGA 1H1NA 4AZ5A 2HWGA 4F0HA 2XIIA 1VFLA 1W8GA 4NZJA 1K3UA 2QXWA 2FDMA 4DJFC 3R10A 4O17A 3G6MA 1OD0A 1KNWA 3PJXA 2XFWA 1QAPA 3AYVA 3OA3A 4UIOA 3V1HA 2HVMA 1KBJA 4KIKA 3USBA 1ZQ5A 3MO4A 1OCQA 4MKNA 3PG8A 4J7RA 1HL8A 4HU3A 3WQ8A 1KWGA 2G96A 4L4LA 1F3XA 1X8FA 4ZQNA 1UYQA 4UOZA 5LIYX 4M8UA 2Z00A 1I2QA 1W1ZA 3M0XA 2RKXA 2J62A 5CPMA 3PPFA 3TH6A 5AYZA 4WSKA 2JBMA 3QJAA 5JIWA 2R14A 3GYCA 4DN1A 4FLOA 3GC5A 2XVLA 1OF6A 4H01A 1X6LA 3A5VA 2HZGA 2WCAA 4C6LA 4E5TA 1G4SA 3KDRA 3RO8A 1FX6A 3DEQA 3NOYA 4CU8A 3BZJA 1FXQA 3HJEA 4C6OA 2POTA 1H0IA 4XD3A 1QNOA 2VJXA 4HMNA 2WNZA 1K7XA 2ZZ3A 2ZUVA 4TMCA 1OX4B 1XLIA 3QTPA 3MY9A 3W3OA 2CIPA 5DO8A 4EF9A 4GFSA 2NUWA 1UUOA 5A6MA 2XIMA 3ABHA 2ZX5A 4PCSA 4QDWA 1Q4NX 1XYBA 4O1DA 4L65A 3MPGA 1A49A 2QPXA 2PWFA 2C1IA 2ZZ2A 1QW9A 3SUWA 3MDWA 1XRFA 2E9BA 3KZPA 3K8MA 4KWWA 1P0DA 1US0A 2KZHA 1DQXA 5CCZA 2ZVRA 3AZSA 1EZ2A 3TC6A 4DF2A 1KRBC 1L6SA 4JYFA 2P3ZA 4HZ6A 2VR5A 1SSGA 2DZAA 3AMCA 1SW3A 3UPBA 3ITOA 2Y5JA 4NRRA 2QQ6A 3VI2A 5BXPA 1WDPA 2NT1A 4R88A 4F40A 1EH9A 3G8EA 2V6AA 4O0QA 1DWHM 5CGMA 3SUUA 3TW6A 4HMCA 1RAKA 3H55A 1GG1A 3EAUA 3GH7A 4LJ3A 3GNPA 3EX3A 1XLGA 4AEEA 1PKYA 1VBJA 1S2CA 4FAMA 5K4XA 5KZMA 5ABTA 2FTPA 3LD5A 4C7DA 4NSBA 4I9MA 1RBOB 3ABRA 3NVTA 1UD4A 3OOQA 4GA8A 2QUTA 1DXIA 4ZQMA 3BV4A 4P7OA 1MVYA 3K4AA 4AHQA 4AVMA 3RMEA 3RIKA 5C2GA 5AECA 4R5GA 1T41A 2OODA 3UGRA 2VX7A 1W9MA 3NSXA 4ROPA 1R2TA 1E51A 3DG7A 2OZ0A 1S5VA 4G7FA 2XSAA 4OKDA 3PZ9A 1EDTA 3TX9A 1TMHA 2G3FA 1UKPA 3CBWA 1UR4A 3NGFA 3L4VA 2Y70A 4EE9A 2HDJA 3PJTA 3E12A 1S5TA 3GXFA 5FF7A 3Q65A 1E6SM 4YTQA 3SGZA 4YTUA 1Z89A 4X0NA 3O3OB 4F2TA 2GVYA 3GSMA 2IKHA 1Y2OA 2PSNA 4U5KA 2ZFAA 2RJHA 3W07A 3PZOA 2GL5A 3FFSA 2X1SA 4PMRA 2PWVA 1CWYA 1VQTA 3H70A 4IQJA 3H26A 3A13A 1ZBCA 1W5OA 4K8HA 1R0MA 3M6YA 1R46A 2OO0A 3S3GA 3CWOX 4KEZA 3GTFA 2WZMA 4LRSA 3VYLA 2E25A 4LF2A 2WKJA 1KXQA 3NM3A 3UZ5A 2PE4A 3M16A 4Q8WA 4RK8A 1LG1A 2EKGA 3IWPA 1A80A 1YMYA 4F8XA 1SZNA 4AIUA 5D9NA 1Y8BA 4GYFA 1C8XA 1W3JA 4Y9NA 5FJOA 3TYAA 6REQA 1RCOB 3UZJA 1NJJA 4AD2A 1N82A 4HCLA 4H9TA 1E9VA 1QW8A 4MB3A 3INPA 1E9IA 1E1CA 3C61A 4H6RA 3GDRA 2Y7DA 5F1VA 1TYGA 5JXQA 1QFEA 3WBWA 3G22A 3VDCA 3N11A 3BQ6A 4XIMA 4FPSA 1RZMA 3P5ZA 3TUUA 2HE8A 4F9JA 3BLKA 4QS6A 1ME8A 2W0UA 4RZBA 1L6YA 1NWRA 4EWJA 4ZMGA 4ICMA 2WBGA 1VC4A 3B8DA 5G4HC 2XUCA 2XJ7A 2Q13A 1GOMA 2Q3OA 4Q7NA 4Z1YA 3N3TA 2UY4A 3U7BA 2GGIA 4EPEC 1G6CA 2P1FA 1E3XA 2Y1HA 3HZ3A 4WPCA 1JRBA 1PKMA 3CV5A 1Z44A 1J18A 2EHHA 4JIQA 4M1RA 4KRTA 3TDFA 3SDOA 4ADTA 1F73A 3OK8A 2G8ZA 4GGBA 2PLKA 5M5DA 3UXLA 2D22A 4Q22A 3VIJA 5HWJA 1OIFA 2O0I1 1IEQA 4K38A 4A6GA 1EA0A 4W8AA 3DHPA 5HWNA 4BR1A 4GLEA 3TNOA 3GDTA 1VJZA 1R2RA 4C6EA 4GIAA 5BRBA 4C1LA 1IXOA 3TV8A 1ODZA 3D47A 1H62A 2E5DA 1UH3A 4HBKA 4BI5A 1AZ1A 2OX1A 3P62A 2WZIA 4WUIA 2DZTA 4LCRA 1FBAA 2F61A 2VEIA 2PTXA 3NOEA 1EXBA 6A3HA 2XWEA 3WNLA 3B0PA 4HA3A 1CPUA 5I07A 3DYMA 1DE5A 3IK2A 3EKZA 4P5UA 1XIEA 3R0DA 4DO5A 3SN4A 3BDKA 2OQHA 2YA1A 2QR6A 1EDQA 1G9HA 2VENA 3ARRA 3IAQA 3NA8A 1TCMA 1E0UA 3GFYA 4N9BA 3A24A 3PZIA 3T7VA 1DHPA 4HHHA 1JI1A 4GQ0A 4FM3A 4IPJA 3HQPA 2J9ZA 5C5BA 3GI7A 2PS2A 2X1RA 4PBGA 2OZNB 1RUSA 2A3EA 1CEOA 1I0BA 2O9RA 3EDFA 2QV4A 3NQ8A 2FFIA 4RDWA 3W72A 2WMGA 2V2HA 3HQNA 1TQWA 2YB1A 4D8LA 5I3KA 3GR7A 2B31A 1AD1A 3MA8A 3QEZA 1J6OA 2H3DA 5DFAA 4QJ5B 1S1RA 5JIPA 4F0SA 3R8GA 3VX1A 1UWIA 4HPNA 3LCWA 1TB3A 2BV9A 4MWAE 4ORMA 3CAVA 2I5QA 3N2CA 4Q6XA 4RW3A 1Q45A 4IT1A 4W5UA 2F1AA 4NNAA 4XZHA 4KIKB 2NLYA 4QGCA 3KBJA 2E7FA 1DKXA 3L0KA 2QCMA 3QFEA 1C9DA 5I6SA 3B06A 4DAIA 2D3LA 1RV8A 5AHIA 4W8LA 1G1YA 1EHNA 3E0VA 5DANA 4UWMA 3IVSA 4AD3A 5LNSA 3SYVA 1Y5VA 4GZIA 1ME9A 2ZUSA 7CGTA 5G1TA 4EPBC 8XIAA 2CW6A 2CHOA 2VXNA 3KZSA 1DIOA 1QT1A 5FF4A 1M5WA 3STGA 4E81A 1JXKA 1J5TA 1G94A 2MUCA 3UWQA 1E6QM 1FH9A 3UXAA 2FTYA 5A5WA 4JDYA 1FCVA 1NWTA 3H2NA 1LROA 1H4PA 2YCEA 5FD0A 1TQTA 3E2VA 2ADAA 1I75A 1UH2A 5JUVA 2GSEA 4TX9A 3TCSA 1H60A 3HG3A 1SUXA 4NNBA 2X05A 3GAYA 3G0SA 1BWKA 2VFGA 3TYDA 1R38A 3CYJA 2BG5A 3HFYA 4JTJA 2F9RA 3VDBA 4M19A 4BQ5A 1LCOA 1PL9A 1JF5A 3BGAA 2J74A 1P48A 1GJWA 4JFSA 3GXMA 3OODA 3AXKA 2PTWA 3WK2A 5T9CE 3EX1A 4YTRA 1F3TA 2FGLA 4HSNA 3TC7A 4B4FA 1KGUA 1GNTA 2OZ8A 5J04A 4NT0A 4I8YA 1XQKA 3MVTA 2WKLA 2B7OA 2CWXA 2FKPA 2YL8A 1LOSA 3QPYA 5E84A 2WPBA 1VF8A 5HMFA 3DYPA 3BMWA 5IBXA 3R94A 2W4XA 2BY3A 3RU8X 2TRSA 4S3KA 3T2PA 3VCCA 2ZUNA 1FWBC 3APYA 4BEQA 2ATMA 5JVLA 2YXOA 1F74A 3TMQA 3STPA 4KKXA 4M0XA 1X1OA 3MHUA 2J88A 2VDHA 5GNZA 2KHOA 4MY1A 1A5LC 2PMQA 4V2XA 3IGXA 2PGRA 4M82A 4H7VA 1FDZA 5AY7A 6ALDA 1K1DA 2XU2A 4PTDA 2J7DA 4D9PA 2J13A 2NWSA 5BOFA 3GXIA 8A3HA 3SFKA 3UWEA 3S5SA 3R4IA 3WK1A 4WSJA 2WQDA 5CZJA 1C7SA 4KGJA 4J3VA 3WJSA 1TIMA 2PDGA 2CKRA 2PZNA 1OFQA 4ZO9A 1U83A 1Q65A 3CZ8A 2PZ0A 4LTSA 3MI2A 1KFJA 4GXWA 1LLWA 2VD8A 4QP0A 5D30A 4S1FA 4QQUA 1LLOA 3J7HA 3AQUA 3ZR6A 2PD5A 2P50A 2DDXA 2OYLA 3OIXA 2DH3A 3DG3A 4F79A 1D7FA 3VIFA 1SJBA 4QEEA 4LB4A 2VZSA 3WFAA 1KB3A 2ZRWA 4IMFA 4ZXLA 4UTHA 4JEJA 3W00A 1XF0A 5F7UA 2C0AA 1MUMA 1GWJA 3QV9A 3TOPA 4EX4A 3ANYA 5I3GA 4MHBA 3TR9A 3N9SA 4HK7A 4GUIA 4U28A 1EJ7L 3Q84A 5L9FA 1BG9A 2ZADA 4XAGA 2WC4A 3GD6A 3N25A 1SFSA 4GC3A 1RP8A 2ZZ1A 1TPUA 4F3HA 3A6OA 4HSHA 3OVGA 3WNMA 1SMAA 1Q4WA 3AUOA 1XWYA 3QH2A 1XLBA 6REQB 4MAVA 4F0KA 5KZEA 1OIMA 5ABGA 4IQLA 3BLFA 1T8QA 1FWJC 5I2UA 4R3UA 3S4TA 1V79A 1QI4A 3THCA 1E1CB 3CL7A 3VM7A 1GK8A 3KOYA 4E8CA 1OADA 1XIFA 2HK1A 1W3HA 5D33A 4M6VA 2QEZA 1ZS2A 4B2DD 3HFTA 3EOEA 2F2HA 1TVPA 1DP0A 1KQYA 4RZ4A 4XD6A 1IZJA 5BWFA 4XO7A 2NT0A 3VOFA 3LCGA 4LEQA 4G1KA 3SY8A 4LYQA 1LQ7A 1XGDA 1FP9A 4MPKA 2JEPA 4W4QA 3VMPA 1E9LA 1OK4A 3QYQA 4D6FA 2PDQA 1I4LA 1YTEA 4Y96A 1ZAJA 1YXCA 4DRSA 2Z27A 4Q7BA 3FX4A 1BGGA 1H11A 2WYSA 3MMDA 2GGGA 3ZT5A 1KFBA 3VO0A 3ZMRA 1W5NA 2OO2A 3KTSA 3W23A 4ZOBA 4K3ZA 1ZBKA 4YN5A 3VKDA 1JUEA 4FZIA 1XGEA 1DWGM 3W1PA 1SFJA 3C2EA 1KR1A 1YKWA 2V9DA 3FK4A 1RSCA 2DIEA 3W76A 1TV7A 2G4FA 2XN1A 3BW3A 1GG0A 4YJ5A 3TC3A 4R9OA 4R7JA 2ESCA 1XD0A 3PM6A 4TUFA 3O3RA 3D50A 3AIQA 5M2FX 4GYPC 1F5ZA 1XH2A 1DHKA 3IRSA 2A3HA 2J7GA 1IT0A 2CWNA 1BTCA 2VZOA 3THAA 3LBOA 1G4EA 1WP6A 1OFAA 1SZGA 2VD9A 3M41A 3NXLA 1XCWA 4QG8A 3THUA 3F7WA 1N7KA 1HL2A 4R27A 1J0HA 4HPHA 5C9WA 2YFOA 2NV9A 3GC4A 3T8QA 3WELA 1AJZA 2BY0A 3QGKC 2BGSA 2UBPC 5F2IA 4O1CA 5FKYA 3W6MA 2OQLA 3WJWA 3AJ7A 1AH4A 5C5BB 3PY2A 2IPWA 1TWDA 1PTDA 2Q12A 1CENA 4HPXA 4L56A 4NILA 3TU9A 3GW0A 4OTKA 4FOUA 4O12A 3GDMA 3O3MB 5A6LA 5HJYA 1E1EA 3V4BA 3CUIA 3HAIA 3M5ZA 5U4NA 1R3YA 3A23A 4OUIA 5DBUA 2PWDA 3LZ5A 2A21A 3BG9A 4AU0A 4E2OA 2Y4SA 4LXFA 3BJSA 2OOGA 1K7FA 3MMWA 4RR4A 1K03A 1FY6A 3MSYA 1TA3A 4FZOA 1XLKA 4DXVA 3LCHA 1CGTA 2QZRA 1CLVA 3DX1A 1VFUA 2AMGA 1SVDA 2BVTA 3FYOA 1QU4A 3PN8A 5GJPA 2DH2A 2NUXA 3WCZA 4MNMA 4JOMA 4WSHA 4NXSA 3VE9A 4JL2A 4QROA 1R9YA 4U3CA 3GNOA 5HR7A 3P3BA 1UPXA 3VMOA 2J77A 4PL2A 4EZYA 1XRTA 4AUBA 2VUNA 3D51A 4WKAA 1KA9F 4GHRA 2WQPA 3C52A 1RLCL 1ODUA 4CNPA 4MF4A 4H1ZA 2ISFA 1FH7A 1W17A 5K2ZA 4NXKA 2JK2A 5C70A 4KWOA 1KBLA 1R47A 4DLFA 4IPPA 4QTGA 7TIMA 2J24A 1JZ6A 4IFRA 3WLPA 3BAWA 1VAHA 4AZGA 1LL6A 3U48A 3DKJA 4IMCA 5I79A 3FHAA 2INZA 3ZFHA 1D9EA 1XLDA 3VAVA 4F0RA 1EA9C 5G5IA 5E6YA 4OOZA 3IS4A 4GUJA 4ACZA 4AZ7A 5C0QA 3FYPA 2HRWA 4KRZA 1K9FA 3ZVIA 1WXJA 1T99A 4S23A 4XV0A 1M53A 2B81A 1EF3A 3V0SA 3LGDA 1ECEA 3PZQA 1R5EA 3OP2A 4WX2A 1DIKA 4ZTXA 2V5DA 4JHZA 2WINM 2QDEA 3BW4A 1KFCA 3UYCA 1HVXA 3WJZA 3CHVA 1JCYA 1RD5A 2PF8A 1XH0A 2XGZA 1EIBA 4EK7A 3K4DA 2Q6ZA 2VR2A 2CNCA 3K5XA 1SJAA 3GIYA 2VEKA 3WMCA 3CQ0A 2O0TA 2WO5A 4JXCA 1O7AA 5BXTA 4ZQRA 3W7LA 1C29A 3E3HA 1H41A 1RA5A 4B91A 1NF7A 5LXEA 2QUMA 2XH2A 3GZAA 3HG2A 1EP3A 2YFNA 4ZA0A 1UR3M 4BQ4A 4GVIA 5DBTA 1CI1A 3P93A 3SCOA 2XSXA 2NVAA 4AZHA 1Q6EA 4F2BA 2PDNA 4IXHA 2HQAA 3QY7A 4ZO6A 3W7MA 2QDGA 1F3EA 3PTKA 3QLLA 3CQIA 3S6OA 3DX4A 3DFOA 4LYRA 1PYMA 4A3RA 3TXVA 4B92A 1JZ2A 1YEYA 1XINA 3O63A 4B4HA 4XG1A 3VE7A 1KKRA 3C8NA 4G56A 3W73A 4RNFA 3MWCA 3NO3A 5LA2A 3CKDA 2TYSA 4K1GA 3W7NA 2VX5A 4IUOA 4XISA 5ABHA 5CGTA 4Z0JA 4ZOCA 3KP0A 2XISA 1I1WA 4OBTA 1XDLA 3P8JA 5HXMA 4LYKA 8TIMA 4IFOA 5JH2A 1J4EA 3WQ4A 3EB4A 1G7UA 2OLAA 2GAFD 2TMDA 3S8HA 5CG0A 2C08A 1FP8A 4IM2A 3PWGA 4UXDA 2QCGA 1LORA 4PRTA 3G6LA 2D2GA 2D20A 5A2CA 1IHIA 4FNTA 4JD4A 2INEA 1O4UA 4XAFA 4XB3A 5CAKA 1KRAC 4MLJA 3WH9A 1XBZA 3W1MA 1DE6A 4CEXC 5IFTA 3CZNA 3IJ7A 1VLWA 3PG9A 4U3AA 5A6JA 3FJNA 2OYMA 2HJPA 5KETA 1PKLA 4LUIA 2AL2A 3V36A 4E8GA 1HKIA 3WF0A 2XN2A 3NXFA 5EB8A 3RR4A 2ONEA 1DXFA 1XC6A 4UC5A 3P0XA 3T9PA 3WL1A 1EJUC 4FX8A 4F48A 3BL3A 3WQFA 1NVMA 1QTWA 1Y0EA 1LRTA 3QVQA 1SGJA 4IICA 2YKTA 2Y2WA 1S3TC 3U9IA 4AEOA 2FVMA 1J2BA 1GONA 1EC8A 4MADA 3L2IA 1WZKA 4IMAA 3NSMA 2QW5A 4JN7A 1HP4A 5LGXA 2V63A 2AOSA 4QRNA 1AD4A 2JKPA 1KBKA 1PJ9A 4WKFA 2EJ1A 1YLVA 4LAZA 4X63A 3LLFA 4XTIA 3BO9A 2YL9A 3THQA 2OFJA 3VD5A 1UWUA 3WF2A 1TV5A 4AW7A 2E5BA 1Z6KA 4J40A 2QF7A 5KMYA 1NDZA 2POZA 1B3ZA 1BVNP 1MQPA 4UTIA 3PULA 4P2VA 5A95A 1JG9A 1IXQA 4AF0A 4WK9A 2GPTA 6XIMA 4H41A 1XP3A 4PGLA 1JPMA 1Q6CA 2F8QA 2X1IA 1EJWC 2B7NA 2PFHA 4YL2A 3NCOA 5EMKA 1GPWA 2G95A 1YXYA 1W2PA 1A47A 2OSXA 3HPSA 2VQTA 2VUYA 1KTCA 3KAOA 3ZJ6A 3RM9A 2WW5A 5DCEA 2QYGA 2X3XA 3QR3A 4ATMA 3ZLFA 5IM51 1W6TA 1GOWA 1V93A 1W1YA 1K9EA 3U4FA 1QVBA 2VEMA 1W5QA 4NY2A 2E6YA 3LG3A 1N8FA 3ITCA 4HNLA 3UJ2A 5DMYA 2GQ9A 1HKKA 2E1WA 4S3DA 3T40A 2IW0A 3BLIA 2BHYA 1UR9A 2R24A 4UTKA 2ZUMA 3VMNA 1SO6A 3NUKA 3KE0A 4PA8A 3AFBA 4JHMA 3HGOA 2ZE3A 2WJDA 4MG4A 4LQ1A 1EFZA 2YCIX 5H1WA 4OZOA 3P14A 2C14A 1JZ5A 4NHVA 3POCA 4NJIA 2R6OA 2XGIA 4IL2A 1EDGA 3G5EA 2VDGA 4DUWA 3F5JA 1R34A 2CLIA 1E0WA 1VFTA 2UZ9A 4WGHA 3LBMA 2BXVA 3N29A 3W22A 1LWHA 1Q13A 5G2IA 1OT2A 5AHFA 3W1XA 1PZ2A 2PU1A 5MF5A 4DO4A 2EBNA 2RT6A 1ISYA 4UCFA 1OVDA 1ITQA 4JTLA 4DXKA 3LLDA 4Z2IA 4C90A 3VOCA 1TA3B 2NWRA 2ZX6A 4KCUA 1Q2RA 2PU0A 1TTPA 2O7SA 3PC0A 5I03A 1W5MA 2NV1A 4O1EA 1MXSA 1HJSA 4ZXOA 2QJMA 4LAOA 4QLKA 2EPHA 1TV2A 1DJWA 2FJKA 3I6EA 3LUTA 1K8CA 4NVTA 2GJPA 3TQVA 1OABA 4HHMA 3RO6A 4PMJA 4RXFA 3TN3A 4OU1A 2PPGA 5I3FA 5CG7A 1DTNA 3T6CA 2CZDA 1WKFA 1JCXA 1HX0A 4Y2WA 3MP5A 3L23A 3LSCA 5LGZA 4TTGA 2WBKA 4MWAA 4J3UA 1Q6GA 3MHFA 1YHTA 3RMJA 5LHEA 1D3HA 1VCGA 3BVUA 1D2KA 4ZSUA 3SQSA 1JFXA 3TN4A 4DHGA 2VVNA 3BSMA 2VC9A 1XL9A 1US2A 3M64A 3PTMA 3R89A 1QPOA 1DIEA 2XM2A 2QKFA 1FKWA 4BZYA 5T9BG 2VHLA 2P88A 5AC5A 4UDYX 3FLUA 1V3HA 4FS9A 3KW3A 3APTA 2A79A 4ACZB 1TKKA 2Y5EA 3DX0A 2Z0NA 1GPFA 5BOEA 3UG3A 4DJDA 3O8AA 4B3ZA 3KRUA 1XXXA 3GY1A 4ICCX 4DX3A 2I17A 2CBVA 5G4EA 4M6UA 1JGIA 2ZXAA 1E4MM 4EWND 3AOFA 4IWPA 1EBGA 3QN3A 2P53A 4L6HA 3OLEA 3TKFA 2A1YA 3AIUA 5CPOA 3ARTA 2DQWA 2BFGA 7A3HA 1QBBA 1IGSA 2Y7GA 1AW2A 4JNFA 4DJEA 5FESA 1IWAA 1XGZA 3CV2A 4P8XA 3MUAA 2FIQA 3QPEA 3EX4A 4G2DA 1K77A 2PLJA 5D05A 3V3WA 4PUNA 4O53A 1YXDA 3E6EA 1TWSA 4B90A 4HHPA 3KBMA 4O10A 1UKQA 4J3TA 3ZO9A 5E0FA 5GNYA 1PZ1A 4G6QA 1A5CA 3B8VA 5MHBA 2VZTA 1V6UA 4JPGA 4GRSA 3CGTA 4LC8A 3BAIA 3AYRA 2ZRXA 5FJPA 2ZIDA 1MRQA 1P5BA 3GNDA 3AXIA 3CPUA 1YADA 3G1XA 5DT7A 2CBJA 4V15A 2WKGA 5B80A 4FLRA 1C3FA 2LXYA 4LB3A 3NQ6A 3Q94A 1JNDA 3ARWA 3M0LA 4I9AA 4AYSA 1TPFA 1HGWA 1MO0A 1ZNNA 5KSWA 2VL4A 2JQXA 4HN8A 3IIZA 1OY0A 1XCXA 3HBLA 4MMWA 2ELBA 4WQ6A 3NQVA 4GZJA 5BWAA 3W6YA 1ITUA 3KHDA 3WEZA 1MXGA 1FCUA 1M41A 3T49A 2DU2A 2XN0A 1NQKA 4ZCWA 4S2CA 1NWUA 1PB0A 5AC6A 2ODOA 1RPKA 1WQ5A 2Y61A 3DI0A 4NRSA 4PC8A 4RL3A 2WVVA 4A3UA 3B3DA 4Q8VA 4JLCA 3H2OA 4NJKA 2HROA 4Z2HA 1J96A 3Q2DA 1TQVA 1JDEA 3DX5A 4LBSA 4EAMA 2DT1A 3KRBA 4LVAA 1GYNA 4EP8C 3O2LA 2EPMX 4D6DA 3ITTA 2QCLA 4PTVA 4DWSA 4GI8A 5FCZA 5D37A 1GW1A 3DU0A 2AL2B 3QMRA 1KBBA 4CEUC 4I7WA 1GOQA 6PTDA 2NX3A 2WMIA 2GSHA 3CPGA 4MAZA 5BU6A 3FY1A 5J8LA 3U4AA 4C6IA 2CZVA 1HGYA 3S1WA 1WDSA 1MFVA 4ATLA 2ZA3A 1EOMA 1VEOA 4QITA 3M0ZA 1A5UA 1BSIA 5CC7A 1EL3A 4LY4A 1ZHAA 3M5XA 4IGSA 2PWGA 5HQEA 1GT8A 1NFPA 3G8RA 1OC7A 1F8MA 2CCRA 4HU8A 1KFWA 7TAAA 3WD1A 4PODA 1JPIA 4M7TA 3AZRA 1VPYA 3UJSA 3D4YA 4QJ4B 4OFCA 1PYFA 2EEXA 2J75A 2ZBTA 1P7TA 4XKYA 1GKRA 2IKIA 4RE3A 1OF8A 4EPDC 1FWCC 1QNQA 3U3HA 4YMZA 4IPLA 1JCJA 2GQ3A 1XLJA 4YXGA 5D8ZA 4AF0B 3T44A 1JYXA 1UR1A 3LHUA 3T2OA 2J8FA 4Z42C 3M0YA 4JL1A 2VYOA 2ACUA 1YNQA 1IIHA 3B8SA 3VNYA 3KL3A 1JVNA 1OWQA 4OBSA 2OVLA 1BTMA 1HJVA 3LS9A 1U30A 1FKXA 2VURA 3HB9A 2ZDRA 3LVTA 3R8RA 3GH4A 3BVTA 1JCMP 4A29A 4LYPA 4UNKA 3KRSA 4GNJA 3SQMA 3BV7A 5A6SA 5HNTA 5DX7A 1NM9A 3H53A 1BPLB 3N6QA 5I5RA 3W1NA 1DQWA 1XYFA 1W9VA 4LU0A 5DRIA 3W88A 3WBAA 4DB7A 3S5NA 2IQDA 4QJ1A 4BY3A 1L6GA 1Z8AA 2TPSA 3LXAA 2DEPA 1XH1A 1OFDA 5CLWA 2C8NA 2PBOA 2VRQA 2AKZA 2QCHA 2YJQA 3GVQA 3VVGA 2FFCA 4V33A 3BLLA 4HY9A 2D0GA 5K9CA 3CMGA 4U2ZA 1P0KA 4BF5A 3NQ2A 3V35A 2RGLA 3PVFA 2NQJA 5BZAA 2VCBA 1LTDA 3C5QA 4PMQA 1Q5MA 3AWOA 3PAOA 4NIRA 1YDYA 3LBCA 3W37A 3W81A 1TREA 2Z6IA 3AICA 3JZUA 3W75A 3AO0A 4URIA 3LRLA 5I3JA 1M3UA 3BANA 1MUCA 5HMDA 5I06A 2Z25A 2E77A 4E2DA 5I7GA 4WOZA 3CQKA 3MP4A 1ML1A 1KCKA 2FZNA 5EY5A 3NQ7A 1JPDX 1TIWA 3GHTA 4IL0A 4GFIA 4IGNA 2G41A 2X2YA 4H2CA 2HVNA 2VEPA 4LEFA 3MI3A 1FQ0A 1LT7A 2ZCGA 1EWDA 4Y9PA 4QISA 1IQ8A 1CCWB 2PWHA 2J9XA 1OYBA 4HP5A 2P0OA 1VEMA 4AY8A 2PA6A 4I5RA 2RDXA 4UFIA 1RQEA 5LNVA 4AG0A 3RLVA 2OEJA 3RCMA 5CAHA 5AHNA 1WAUA 2A85A 4K7VA 4RDZA 4S2BA 1S1PA 2NXHA 2HVOA 3O15A 4MWAB 2XVGA 1LBLA 4PZVA 4KETA 2YOCA 4ZE4A 4X2RA 4JTEA 2I16A 3KOWA 4GBUA 4JNZA 4OV9A 2Z24A 1DL3A 1GOIA 3BAKA 2YSWA 4D71A 3GR4A 5A6BA 1ALDA 1BYAA 2PP3A 2V5BA 3SJNA 1QHOA 1BF2A 3L5LA 4NAFA 3AROA 5G1YA 2DZSA 4B5VA 1KV8A 4RUBA 3TSDA 4FNRA 3DZ1A 3RX2A 2EAWA 4MYAA 1UWRA 3PS7A 1H1YA 3LDVA 2KX9A 4EXAA 3HG4A 3M0IA 3W29A 3VIKA 4LUTA 4F4RA 3W2NA 4W8BA 3LA4A 1AG1O 4PO2A 3IV3A 2Z1WA 2Z2AA 2BXYA 3AYSA 3KWXA 3F4CA 1V6XA 3TOYA 5FSEC 3WO8A 2H3BA 2G3JA 4GJ1A 4NKCA 1WKEA 4AZCA 4J28A 2BHZA 5I3HA 6TAAA 5FLEX 2OQYA 4P7NA 4IP7A 4ECLA 2F6XA 4B9QA 3OGSA 3LMYA 4N6EA 5EA9A