4AZ7A

Differential inhibition of the tandem gh20 catalytic modules in the pneumococcal exo-beta-d-n-acetylglucosaminidase, strh
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
433
structure length
433
Chain Sequence
NEKLAKKKIVSIDAGRKYFSPEQLKEIIDKAKHYGYTDLHLLVGNDGLRFMLDDMSITANGKTYASDDVKRAIEKGTNDYYNDPNGNHLTESQMTDLINYAKDKGIGLIPTVNSPGHMDAILNAMKELGIQNPNFSYFGKKSARTVDLDNEQAVAFTKALIDKYAAYFAKKTEIFNIGLDEYANDATDAKGWSVLQADKYYPNEGYPVKGYEKFIAYANDLARIVKSHGLKPMAFNDGIYYNSDTSFGSFDKDIIVSMWTGGWGGYDVASSKLLAEKGHQILNTNDAWYYVLGRNADGQGWYNLDQGLNGIKNTPITSVPKTEGADIPIIGGMVAAWADTPSARYSPSRLFKLMRHFANANAEYFAADYESAEQALNEVPKDLNRYTAESVTAVKEAEKAIRSLDSNLSRAQQDTIDQAIAKLQETVNNLTLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-N-ACETYLHEXOSAMINIDASE
publication title Inhibition of the Family 20 Glycoside Hydrolase Catalytic Modules in the Streptococcus Pneumoniae Exo-Beta-D-N-Acetylglucosaminidase, Strh.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
total genus 171
structure length 433
sequence length 433
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2012-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.90 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 AF1782-like 4az7A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4az7A01
1WO2A 1OSEA 1BYCA 1UD5A 3K8LA 3SURA 1C8YA 1OGBA 3GDBA 1UUQA 5FD0A 2VUYA 4F8XA 4PMQA 3BLPX 3PZQA 3SCOA 4UR9A 4YHEA 1F4HA 4CVWA 1Y7VA 4C7GA 3DYOA 5A8NA 4WKFA 1TVNA 3ZT7A 3K8KA 1UH4A 2WC7A 3WNMA 2ZUWA 3WF4A 1HL9A 2WLYA 3OB8A 1KXTA 4W7VA 1L8NA 4CU6A 4UFKA 3VDHA 1UR8A 2JEPA 5HOSA 5EFFA 3LPGA 1JG9A 1B3ZA 4JIEA 1C3FA 3UETA 1ZJAA 5CLWA 1G9HA 3WY1A 1LLOA 2DGAA 1E6PA 1E73M 3SUSA 3EYPA 1BGAA 3TP4A 1DWIM 2VX5A 3N1AA 2WSPA 1HL8A 4NI3A 4OBRA 4HOXA 4U33A 1EIBA 2XG9A 3AIWA 1UH3A 2CBJA 3G6MA 3CUHA 2JE8A 1CPUA 1GHRA 1UQZA 2YBTA 5E0FA 1WDSA 3AOFA 1TVPA 2D24A 4AZCA 1E1FA 1E3XA 2BY3A 4WKHA 3SCQA 1SR0A 4Q22A 4HU0A 2WMKA 3VILA 3AXXA 2CERA 3WNLA 2BHZA 1KGUA 5BXRA 3WBAA 1CXLA 3CZEA 4F9JA 2VRQA 5A8MA 4W8AA 4JFWA 1ZS2A 1GOIA 4PMDA 4PMOA 3RILA 3MSGA 1CXKA 5GQBA 1E4IA 1PPIA 1BHGA 1ITCA 5LA2A 4HMEA 3S6TA 2WK2A 3B9AA 3PN8A 3CHFA 4U5IA 2CBVA 4QCEA 2XFRA 3WD2A 3UR8A 4D6HA 2WVUA 2JALA 1J11A 3ARXA 2J78A 1V0NA 2PI6A 3BLKA 2QHAA 1X6LA 1KGWA 1NWRA 1J9YA 2O9TA 3F5JA 1JZ5A 5CSUA 3WIJA 2XVLA 5D9MA 3JUGA 4FF5A 5HPOA 2IXVA 3RJYA 4LYQA 4KRUA 3MMWA 2A3EA 4E8CA 1GQLA 2YL8A 1DWJM 2WLZA 4W7WA 2XIIA 2VCBA 4GZIA 5E0CA 4V2XA 4DM1A 5A2AA 4DWSC 2FHCA 1CGVA 2GJPA 3ARVA 4JCMA 2WVTA 3AXIA 4OZOA 4XV0A 3MU7A 3VNZA 1VBRA 4ACYA 1EDTA 1KB3A 3VDBA 3VGEA 1FH8A 1WDQA 1UWRA 1CBGA 3KEHA 1HP4A 5CPTA 1Q6GA 3WF0A 1V08A 1C8QA 4M80A 1GUVA 1N82A 3M46A 1UWSA 4TX6A 1B3YA 4M1RA 3O6AA 2WNWA 2WXDM 2FHFA 2EEXA 3ZT6A 3VINA 2E3ZA 3PZVA 5E9AA 3DECA 1I1WA 2G41A 1UZ1A 1V02A 3GNOA 3A3HA 1JDCA 3QHOA 2W4XA 1R87A 4F9DA 2VVNA 2PBOA 4LQ1A 2ZIDA 3UCQA 1HKKA 2CXGA 2VRJA 2W63A 4OIFA 2X09A 3IJ7A 3WEZA 3VGGA 4TVUA 1BVZA 3THDA 1UWTA 1OIFA 1HIZA 4W5UA 5CPQA 3ZMRA 1XYFA 1VEMA 4A3YA 3NIYA 2J8FA 1XHGA 1MYRA 4JHOA 2C0HA 4HZ6A 1R85A 3KL3A 5HXMA 2CHNA 3AIBA 3T0DA 1XSIA 3ARPA 4OOZA 4WSKA 1PX8A 1HP5A 3VKKA 1J0IA 4UCFA 5FKYA 4CCCA 7A3HA 4RE4A 1HKMA 3CBWA 7CGTA 2VX4A 3M07A 1KBKA 1CNVA 1SMAA 3UESA 3SEPA 2YKKA 3MV11 1JAKA 3L2MA 2CYGA 4AZ7A 2XUCA 1JZ7A 1GONA 2VT0A 4J3WA 1V6XA 4AIOA 4DUWA 3OLEA 4AD0A 1JZ3A 4E8DA 1BYAA 2ZUUA 5E09A 3GZAA 1CTNA 3ZR5A 5JIPA 1XC6A 5CQ1A 4N42A 5A6AA 4HTYA 4PTVA 5I3DA 1JNEA 2OWCA 4W7UA 5A6BA 2WMIB 5BXSA 1UOKA 1EOKA 3WMSA 2VVSA 1B31A 3SCNA 1ESWA 1JIBA 1D7FA 4M81A 1K9FA 2QV4A 2WKGA 2WVVB 4WF7A 5EB8A 1US3A 4PEEA 2DT0A 2Q8XA 5BXTA 5I79A 3VX0A 1U2YA 6A3HA 4P7LA 3WNPA 3O2LA 2RGLA 3WD4A 1GOMA 1PEZA 1LL6A 2CNCA 4GIAA 2YJQA 3QR3A 1Q6FA 4BS0A 3LPFA 1E70M 2BFGA 5A69A 1W9XA 1J0YA 4QLJA 3AIUA 4PMNA 5E70A 4URIA 1CXFA 1UKTA 1BFNA 2J7HA 4MDOA 1H41A 4QAWA 3T0AA 4OKDA 5FL1A 4LYRA 3A4XA 2YDSA 5A3HA 1ZL1A 3WUFA 1E6QM 3DYPA 3IJ9A 3L4UA 2WVSA 1NOUA 2XJ7A 5GNYA 1V3KA 2PF0A 2QPUA 3KL5A 3T2QA 1JF5A 3ZR6A 2CBIA 3CZ8A 3ZT5A 5D8ZA 1QNOA 2GK1A 2XSBA 2VZUA 4Z2JA 3NSNA 1CIUA 2C8NA 3WH6A 4TTGA 2BV9A 1W9VA 1NWTA 1Q6DA 2YA0A 1UKSA 3DYMA 5JBDA 4JHZA 3WQ4A 1G01A 3AXHA 3LPOA 1FP9A 2F61A 1JYNA 1P6WA 3AZTA 3WDJA 5IXEA 1KXHA 3W24A 2YDRA 2YL9A 1FA2A 2VR4A 2NSXA 4CN4A 3GH4A 1VB9A 4AEFA 1KXQA 4U2ZA 3N9KA 4PTXA 4QP0A 4H8UA 4MB4A 2OSWA 3RM4A 2YA2A 1GW1A 3CUJA 1ZBKA 4KGLA 3WQ6A 2Y5EA 3EDFA 3WEOA 4C7DA 2BS9A 5ABHA 5A95A 2ZUSA 2D20A 3F5KA 1V0MA 3BSGA 3N04A 3FAXA 6TAAA 3VD7A 5I6SA 3PZNA 1TA3B 4H04A 3SUUA 1LL7A 1E0WA 3K46A 3K1DA 2YDQA 4MB5A 1UKOA 4HU8A 3WUBA 1B2YA 2E0PA 3CH9A 4D6CA 3VIOA 1WDPA 4QLKA 1GOWA 1GQJA 2EQDA 3WL1A 1QI0A 3M7SA 6CGTA 3VX1A 2VJXA 4BQ5A 1OD0A 4IPNB 3HU7A 1XSJA 4PSPA 3U57A 1E9LA 2CESA 1JL8A 4AW7A 2QMKA 1NH6A 4GZEA 3WF3A 1X1NA 2D0HA 2OYLA 3WH9A 4QLLA 4X0VA 2VZTA 1HVXA 2CETA 3KZSA 2WBKA 2VMFA 5D9PA 2VNCA 3AFBA 1HXJA 5KEZA 4D6EA 4K68A 1UZ4A 3CLWA 4AEEA 1MWOA 2A3CA 3WNNA 3NDYA 4W86A 5BYWA 3B9EA 1E56A 4J27A 2XPKA 2XWEA 1CWYA 3WNKA 4J28A 3GYCA 3WSUA 4BA0A 1MQPA 4AZGA 1GVYA 1CGUA 4ML4A 2DSWA 3ALFA 3BGAA 1QNPA 1XSKA 4U3CA 5A2CA 4DUXA 5A2BA 5FCZA 3L2LA 2EJ1A 1TUXA 4HOZA 2J7FA 4TVDA 3ZJ6A 4GQRA 2GJXB 4J3VA 1TG7A 2WMHA 4TUFA 1LWHA 3TTQA 2V3FA 4AD3A 1V03A 1UR1A 1OCQA 1W9PA 3SUTA 1JYVA 4EK7A 5HBFA 3WBEA 3RM8A 5ABFA 1GOOA 2Y8KA 4P7QA 1W1VA 2CEQA 2ZXBA 3GBEA 4P7NA 2WCSA 3VOCA 1WPCA 3PZUA 1JZ2A 3WQ8A 2D2OA 2DH2A 1ECEA 1E3ZA 1XYZA 4TX8A 4D6IA 3BH4A 4CVUA 2VX7A 3ZSTA 3CZKA 1FFRA 1VFFA 5I24A 3AZRA 1WZKA 2XGIA 1A47A 3AMLA 1MFVA 1E6SM 4J3TA 1GHSA 3EDEA 4UQAA 1MXGA 4OOUA 2E9BA 1UA3A 4AYSA 5GNXA 3CHCA 1DWFM 2D1ZA 1AQ0A 1DWAM 1CZ1A 2PWHA 3VIHA 1TFVA 4KRTA 1AQHA 5CSYA 1JXKA 3B8SA 3WL0A 1V0KA 2CPUA 5E6YA 1H4PA 3CZJA 4Q7NA 3U5UA 4WJXA 3MV01 3I3DA 5D9OA 2FHBA 3T0BA 1KCLA 1JDAA 1C8XA 4IPLA 3TONA 4P8VA 1C91A 2XVNA 1M53A 4UFMA 2WWCA 1HJWA 3AHXA 1UR0A 2B31A 1ISZA 3LPPA 2UY3A 1E5NA 4B9ZA 1H49A 3AJ7A 2DQXA 4BQ4A 1CENA 4EE9A 1SMDA 5A8PA 4ATWA 5KZ6A 3A4WA 3W28A 4HZ8A 2WSKA 5CPSA 3RJXA 5A6KA 1K6AA 4HA3A 3FHQA 1K9TA 3WFLA 4DWSD 2XVGA 2GDVA 2EO7A 2ZX6A 3T08A 5GNZA 4ACZB 3CHDA 2ZICA 1W9BM 1EO7A 1XCXA 2WC3A 3GM8A 4JKMA 2DSZA 1UD8A 1JDDA 3AIVA 2AMGA 2ZWYA 2W62A 3ARWA 1H09A 3VIMA 2DIJA 1XH2A 1TCMA 4MADA 5FIPA 1QBAA 4PUEA 1WKYA 1EO5A 1UQYA 1M01A 1ISVA 4M8UA 4OJYA 1V6UA 1GQIA 4HPGA 5AC5A 3WDRA 4MPKA 5LA1A 4N0RA 3CHEA 1NARA 1UD2A 4NF7A 5BRQA 3VD9A 4AZ6A 1DWGM 4GKLA 4PYSA 1OIMA 1VENA 2EXOA 3OGRA 1J0JA 2GUYA 2XGBA 4FZPA 3PTKA 3PHAA 3EDDA 1VAHA 2J47A 3L4TA 4JL2A 5A1AA 4C7FA 3AIEA 4WIWA 2DSVA 1QOXA 3AMGA 3VPLA 4UNIA 2ZOXA 1YHTA 5CGTA 3TTOA 3N18A 2W66A 1M03A 1MW1A 2PWDA 1EXPA 3AMCA 3TTSA 2VQUA 4RL3A 3MMUA 3L4XA 5D4YA 5M17A 2VI0A 2XYLA 1VFUA 4UFIA 3RM9A 1VRXA 4OBSA 2JF7A 1UKQA 5F7UA 1E5JA 4D1JA 1TE1A 2ZX7A 5M03A 3W6LA 3THCA 1SFSA 3AS0A 2ZXAA 4ZXLA 3KE0A 4B16A 2PWGA 4BZYA 2DSUA 4AIUA 5JBEA 2EPKX 5IHSA 5FL0A 4AZBA 3WMCA 1V6WA 2Y24A 1EHNA 4EANA 3ZJ8A 3VMNA 2WZHA 1U30A 3PZIA 2J79A 4KGJA 3D5HA 3VIPA 3ARRA 3WKZA 3IANA 1DHKA 5A6LA 1UD3A 3BAYA 3ZIZA 4E2OA 3VIJA 3FXYA 4UFHA 4TVCA 2D0FA 5BCAA 1V3LA 1B3VA 1QI4A 2JEQA 4JL1A 2QLYA 1OM0A 4P7OA 3CMGA 1AVAA 2F8QA 2NW0A 1JI1A 1WDRA 2J74A 3ZJ7A 3U7VA 4D1IA 4CU7A 1JXJA 5ECUA 3AMKA 2WHMA 1B90A 3VVGA 3IAQA 4CD5A 1B9ZA 1HT6A 1U33A 3BAWA 3I3BA 4W84A 1E0XA 4D72A 3DHUA 1KWGA 3OA5A 2XVPA 4TXEA 4ZENA 2CITA 3BAJA 1IT0A 4XX6A 1I75A 3AHVA 4BF7A 1JZ6A 4JFUA 2JIWA 2JNKA 2O9PA 1CGYA 5D9NA 2V5DA 1BPLB 3OIHA 3KL0A 5CXPA 1KWKA 3NJ3A 4U3AA 1MQRA 4KH2A 3RPMA 3POHA 3WDPP 2WKLA 4LYPA 2W5FA 1KQYA 3U5YA 1CXEA 2YLAA 2A3BA 2OLHA 4GXPA 2GVYA 4B3LA 1ODZA 1VIWA 2BY1A 3TOPA 3FNDA 1JGIA 1S46A 3WEMA 2W67A 1EQCA 4L4OA 2YBUA 1J0KA 1MVYA 3WENA 1MW0A 1W9UA 1HX0A 5BRPA 1B0IA 3OG2A 2CKSA 2FH8A 5AYBA 2ZUVA 5I2UA 3W37A 4J3SA 1XV8A 4P8WA 2PMRA 1UD6A 4M29A 1QPKA 1GJUA 2J4GA 2YL6A 1W3JA 3MUIA 4GQQA 3OLDA 4R27A 1AQMA 2PWEA 3WQVA 5DEZA 3QOKA 4AD1A 3PZTA 4A4AA 3T2PA 1GORA 1KCKA 5I0DA 1E15A 4Z2LA 1BG4A 1EA9C 4D6FA 1KGXA 2WM0A 3CZGA 1UWQA 1EDGA 1UD4A 4M24A 3SCTA 3EMCA 3T2OA 2V38A 1VFMA 2ZX9A 1W2VA 3PZMA 1K9EA 4DWSB 1JFHA 2J8GA 1W1YA 2WMIA 4MNLA 3SIMA 1J12A 3VUPA 2VC9A 4NRRA 3WMBA 1RH9A 4W8BA 1GQKA 3ZSSA 2WVVA 4XB3A 2A3AA 1BSIA 5JIWA 5CGMA 2QMJA 1V3HA 3W27A 3VM7A 1UH2A 3PZ9A 5HPCA 2PWFA 1NP2A 4UOQA 2C7FA 3L4WA 1Q4NX 4AY1A 1H2JA 1O6IA 3CGTA 1BQCA 2PB1A 1GPFA 1YQ2A 4Z2IA 5I23A 1FHDA 1WNOA 3NYDA 2OSXA 3N17A 5CG0A 3HJEA 1W32A 1CGXA 3RIKA 4UFLA 1C7SA 4MJ2A 1QI3A 4PBGA 1VJSA 4YN5A 5EFDA 1GJWA 4CCDA 1HKIA 1RP9A 1UR2A 1OT2A 3AMDA 3L4YA 4A3HA 1QBBA 1TR1A 8A3HA 3K4AA 4MB1A 1BF2A 3WF2A 1C90A 1LG2A 1JAEA 1PIFA 3WD3A 3BAKA 1NOFA 1QW8A 1LG1A 1E6RA 3AICA 3ZM8A 5ABGA 3ECQA 4HA4A 4V27A 2DT2A 3MKKA 2ZX8A 4WKAA 1US2A 3S2CA 3LMYA 4CCEA 2VR5A 2DEPA 1W9DM 2BHYA 2NT0A 4PMZA 1NWUA 1LWJA 1JD7A 2WWDA 3ARTA 1OT1A 9CGTA 4M56A 4AIEA 3SCVA 2WPGA 1M04A 1KQZA 3WQWA 3T09A 4S3KA 1BTCA 1QHPA 3VU2A 3GXIA 4AZHA 1J18A 1DWHM 1TA3A 1V6YA 2YLLA 1KR0A 3CO4A 3NCOA 1OBAA 4UQCA 3AHYA 1GZJA 5AYIA 4AISA 1QNRA 4CN1A 2FGZA 4ZE5A 4UQDA 3KWXA 4Z2HA 1EOMA 2DT1A 3WELA 3MMDA 1PAMA 3VD4A 3EBVA 3W26A 3BSHA 3PTQA 3J7HA 2HISA 4YHGA 3CMJA 2ZUMA 4TTUA 2VCAA 1X6NA 1E43A 4BQ3A 4AC1X 4UOJA 3UERA 2WHLA 3VDAA 2G3NA 4FMVA 5E6ZA 1WB0A 3OZOA 4JKKA 3OZPA 5C71A 2D23A 2O92A 1IZKA 4S3JA 2O9RA 2UWFA 3WUGA 3HN3A 3W53A 1K9DA 4J7RA 1EQPA 1FH9A 1HNYA 2VRKA 1Q6CA 3A4AA 3N12A 1JZ8A 3BXWA 1GCYA 1CDGA 3VDCA 1WZMA 3AQUA 3N13A 4MAZA 3F4VA 1QVBA 4Y7EA 1ITXA 4PMUA 3QHNA 3VO0A 1J10A 1UWIA 1H11A 2UY4A 1XH1A 4PCTA 5DT7A 3SCRA 3AHZA 3TTYA 3W82A 2XIBA 2ZX5A 1MW2A 3A6OA 3ARYA 2V3GA 1CXHA 3WFZA 3B9DA 3WD1A 4GI8A 1MFUA 2ZXDA 4XZBA 2VOTA 3SCWA 1EHAA 1JFXA 4B9YA 4HMDA 1HJSA 2GJXA 3MSDA 4FK9A 1HJQA 2J7CA 1PZ2A 1MQQA 3PZGA 3I3EA 2Y4SA 4CUCA 3A47A 2BXYA 2FH6A 3WH7A 2OO2A 3VGBA 1TZ7A 1Z32X 4BQ2A 3POCA 4BCEA 3VD3A 2J25A 2J7EA 3MS8A 3IK2A 1OGSA 4QCFA 3AS3A 2ZE0A 1WAWA 1PZ3A 2DDXA 1V3MA 3AZSA 1UA7A 2WHKA 4CU8A 5HNNA 2WMFA 1W2PA 3NSXA 2XHYA 4H7VA 1J01A 1V0LA 2GSJA 4W89A 1AMYA 3AYSA 2NT1A 4R5EA 4JFTA 4IUGA 1JYWA 2XFFA 2J62A 1E0VA 1B3WA 1HVQA 1W3LA 4HP5A 1GNXA 4UTFA 5DFAA 3RCNA 2V5CA 1MXDA 1WZAA 1UWUA 3VTRA 5A94A 1HJVA 2BVYA 1GOQA 4HA1A 5A6BD 4HOWA 2VZSA 2GFTA 2YOCA 1WE5A 1H3GA 3BC9A 1NM9A 1OD8A 1PX4A 4EKJA 2WMGA 2E9MA 4JAWA 3W38A 1NWSA 1O7AA 3AISA 3ARZA 3MUY1 2UY2A 2WMJA 3FW6A 3WQ5A 4ACZA 1BAGA 2WZIA 3AROA 5AC4A 3WH8A 4UOZA 4MNMA 1M7XA 1E71M 4AZCB 1XRVA 4MJ4A 3SUVA 4XZWA 1KFWA 3W4RA 1J0HA 2BHUA 1B3XA 4CD6A 1J0ZA 4AWEA 3ARQA 4W93A 3ZOAA 1E72M 4UQEA 1IV8A 4RE3A 5A6SA 2X05A 2J7BA 1QW9A 3D3AA 4MDPA 4UQBA 1NP0A 4PMYA 1NOWA 1I1XA 1QHZA 2CBUA 4U5KA 1JD9A 4WK9A 3GNRA 3MO4A 3VM5A 1E6NA 4P8UA 1A3HA 2J7DA 1HN1A 2RGMA 4NRSA 5IFTA 4GO9A 4M82A 2CHOA 4J3XA 2YIHA 2VTFA 3HMCA 2MANA 4QFUA 1G5AA 2WCAA 3VD5A 3CUGA 3VIKA 4PTWA 4L4PA 3G6LA 2E9LA 4IISA 3OBAA 3GBDA 3WNOA 1QNSA 4WLCA 1D3CA 2VL4A 3CTTA 1GOKA 3DC0A 3ZO9A 2AOSA 1B30A 5JBFA 1XD0A 4FLSA 4X0NA 1G0CA 2FGLA 3VMPA 1FP8A 4OUEA 3CZLA 4YPJA 1QHOA 2J75A 4GI6A 5HDRA 1BYBA 1HJUA 1C92A 1R7OA 1ZBWA 3W81A 4W88A 1ZJBA 2EPMX 4DUVA 1FOBA 4DM2A 3CIVA 4AD2A 2O9OA 2J77A 3EMQA 1QNQA 2BY0A 5CZKA 3VIFA 3UEQA 1JF6A 1CLXA 2Y2WA 4AD4A 1DTUA 4LXFA 4E4PA 2WB5A 4MB3A 1OB0A 3FN9A 4ZEPA 2ZUTA 3VNYA 8CGTA 4X9YA 2XM2A 1VF8A 3PZOA 4H41A 3W29A 2QPSA 1E40A 2WHJA 3GH5A 2DH3A 3AS2A 4UZUA 2XFYA 4AD5A 4NZCA 1FH7A 5I5RA 3NUKA 2QF8A 4PMXA 3ZJKA 1E55A 1KXVA 3BAIA 1HJXA 2DSKA 2YL5A 5C70A 2G3IA 4V28A 1VFOA 5CLTA 1VEOA 1BG9A 5CJ5A 2XVKA 1WZLA 3EDJA 4D6GA 5JUVA 3APGA 1RPKA 4QDMA 3VGFA 1IZJA 4H8HA 5BXPA 2JFEX 1BYDA 1KR1A 4W8LA 1ZU8A 3FHAA 3AYRA 1W3KA 3VMOA 1W1PA 5DMYA 2CIPA 3U7BA 4GZJA 2WCGA 2OYKA 2Z1SA 2FDMA 1ZBCA 1C93A 3OGVA 3ARUA 4WSJA 1RD6A 4B3KA 5BROA 5A8QA 3AIRA 2GDUA 2PC8A 1NQ6A 4J3UA 1UR4A 3WDHA 3VGDA 4D71A 5EBAA 2OWXA 1XGZA 5C8BB 1V3JA 3WUEA 4D6DA 2OYMA 5M3WA 2E8ZA 1EGZA 5LYRA 3QOMA 1E6XM 2IUZA 4PCSA 2AAAA 1W3HA 2GJRA 4XUYA 4FLQA 5IDIA 5LA0A 3F5LA 3E1F1 1JZ4A 2G3MA 4LGXA 3MUZ1 4IM4A 2J7GA 3BMWA 4AMCA 2VZOA 5A6MA 1MW3A 5A8OA 3N11A 2BXZA 3RMEA 2X0YA 2BVTA 1QI5A 4P7RA 2BNJA 2A3HA 2Y8VA 4U31A 1WP6A 3WDQA 2WYSA 2X0HA 2DT3A 3UG4A 4D6JA 1H0IA 4UQ9A 1RP8A 1LJYA 2X2YA 1FFQA 3FAWA 4JKLA 4DWSA 1JYXA 1FHLA 2VCCA 2W91A 4GI9A 3WF1A 2Z1KA 4JZ5A 3AHTA 1UHVA 1F4AA 1C7TA 3CUFA 1ISYA 1SYTA 3SCPA 3CUIA 2JIEA 3EMZA 1D2KA 2CKRA 3PTMA 1CGTA 4MNJA 2ZUNA 1PJ9A 2JF6A 2EPLX 5DT5A 3AS1A 5IHRA 4JFVA 3NDZA 4P8XA 4W85A 1E6ZA 4W5ZA 2G8ZA 1KBBA 4UFJA 1BVNP 1E4NA 4F79A 4LX4A 2F2HA 2GK1B 5I78A 3L4VA 4GPNA 3GH7A 1G94A 5A6JA 4W87A 1QI2A 2X8RA 3AI0A 3WN6A 1EDQA 1E4MM 2OWWA 4EAMA 3CPUA 4FLRA 3VGHA 4HPHA 2X1IA 3K4DA 7TAAA 1ISWA 3OGSA 1CYGA 3UR7A 1UYQA 2WAGA 1E1EA 1DP0A 5AY7A 1OWQA 2XWDA 3MUAA 1ZBVA 2IXUA 3BCFA 2W61A 4CD8A 5ABEA 4PTMA 3BMVA 1H1NA 4H8VA 3W0KA 1BGGA 2V3DA 2WZEA 2E40A 2ZXQA 2XTKA 1VEPA 3W6MA 1WCGA 2V3EA 2CCRA 4AXNA 4HZ7A 1CXIA 4CD4A 4KMQA 2YA1A 3W25A 2ZWZA 2WANA 1BLIA 3BAXA 5DF0A 4ZXOA 5BWFA 2VO5A 5IFPA 1W91A 3AIQA 3K8MA 5M5DA 2WW5A 4LPCA 5TD4A 2PBGA 3O9NA 4HMCA 2D0GA 3SUWA 1PIGA 4ZFMA 2XM1A 2EBNA 3M6DA 4Z2GA 1DEDA 2UY5A 1L0PA 3BCDA 1UR9A 1G1YA 1JI2A 4PMVA 3NSMA 1R7AA 4FZOA 4Z2KA 1PBGA 4AZIA 1V02E 4B15A 1B1YA 5DO8A 2EPNA 4CKQA 3UG5A 1V3IA 3ARSA 3II1A 1CGWA 4AZ5A 4ZE4A 1Q6EA 4UZSA 3GXMA 3VIIA 4TOQA 1VBUA 1ISXA 4CGTA 4PUDA 2BY2A 3SCSA 4H2CA 3FY1A 3GXFA 2E4TA 1OGGA 4ATDA 4PSRA 4U2YA 3WH5A 1VJZA 1LF1A 4MNKA 1JNDA 2VX6A 3OLIA 3DHPA 2XSAA 4ATLA 2WC4A 3RDKA 1ZB5A 1HF6A 1XD1A 4MTVA 2ESCA 2D3LA 5D8WA 3N15A 4PN2A 4JCLA 1R86A 3RO8A 1W1TA 4CD7A 2TAAA 1V6VA 1UG6A 1EH9A 1XH0A 1ODUA 4PMRA 1LL4A 3EDKA 2HVMA 2E8YA 2D3NA 4F66A 5FOOA 2G4FA 3IAPA 3UG3A 3ZQ9A 3QHMA 1H0GA 3L4ZA 4RE2A 2OZNB 4JFSA 2OSYA 2DPEA 3TA9A 1H5VA 4PRWA 2VURA 3QGVA 5ABFB 2WBGA 1CEOA 1GVIA 2BVDA 4MAVA 2DIEA 1OINA 1LQ0A 3GTNA 1PX3A 3GXDA 3IJ8A 2G3JA 1UKPA 1HKJA 4CN6A 3PBGA 1CLVA 3VIGA 1XCWA 3OLGA 4GO8A 3WD0A 2W92A 3GNPA 3WDIA 1CECA 4KWUA 5I77A 1R8LA 4FLOA 1E4LA 4NSBA 3SCUA 1TMQA 3ALGA 3MANA 5GPRA 2EPOA 5EMYA 4GINA 2VZVA 2D22A 2VQTA
chains in the Genus database with same CATH superfamily
5AC8A 1WAUA 1MRQA 3GDBA 3LDVA 3U9IA 1AG1O 2VUYA 5REQB 1VLWA 5TF0A 4NQ1A 2SFPA 1TPUA 5TKYA 3DYOA 3QFEA 4WKFA 4F48A 3HAIA 3D52A 3ZT7A 1PTGA 1W8GA 4R5JA 1UH4A 4QAIA 3E96A 3WF4A 1HL9A 5CC6A 1JPIA 2R9RA 5HR6A 1RHCA 1R46A 5G1YA 1XFBA 4C6DA 4EZVA 1OFDA 2PDKA 1UR8A 5KMYA 3HQPA 2JEPA 2EX3B 5HOSA 4IGSA 2B7QA 8XIMA 1GG1A 4RNFA 1B3ZA 4HY9A 3K30A 5DCEA 3O06A 1C3FA 5CLWA 4ZBCA 3WY1A 3O05A 1LLOA 3JZUA 1E73M 2WJEA 3UZYA 4FZIA 2ZC8A 1XDJA 4Y9AA 4HOXA 4O19A 1G4SA 3AIWA 4O4VA 1PV8A 2JE8A 4PFHA 5E0FA 3L7RA 3BE7A 2FZ8A 3AOFA 4NAEA 1KLZA 2XIOA 3LV5A 3N6QA 2D24A 4C1LA 2FJUB 1E0TA 4WKHA 3EEZA 3SCQA 1SR0A 4Q22A 3SRHA 4LVGA 3WYZA 2CERA 2ZRWA 3GNDA 3LBOA 1CXLA 2OTDA 4W8AA 3B3DA 4JS3A 1ZS2A 4H9VA 3HB9A 2F2KA 4Q4KA 4UWMA 3RFAA 1IE7C 1CXKA 2YGYA 5F4WA 5GQBA 1E4IA 1I8JA 1KA9F 5LA2A 2A85A 5CAHA 3OHXM 4Q3MA 3S6TA 2ND1A 2WYHA 3CHFA 1Y8BA 3URQA 6REQB 3D50A 4K39A 4QCEA 4S1FA 3R6IA 3UR8A 2PU0A 3AUOA 2JALA 1TV2A 2YX0A 1V0NA 3QC3A 3HPSA 3P8JA 5D04C 2QUVA 1X6LA 5CZTA 1J9YA 3P14A 4IMEA 1FWHC 3GAKA 3G1FA 4EIVA 5HPOA 3RJYA 4LYQA 4KRUA 3WLLA 3CNYA 1GKRA 3QZEA 4B5XA 1SSDA 3Q84A 4JCMA 2WVTA 4JTQA 4OZOA 3S83A 4JQ3A 3VDBA 3VGEA 5FJUA 3WQOA 3DUGA 1FH8A 2F7RA 4YYFA 1HP4A 5PTDA 3BLIA 1ONEA 1C8QA 4M80A 2VEGA 2E5DA 3B40A 2H90A 1GZGA 3O15A 4M1RA 1TRDA 3ATZA 3M1ZA 4WOZA 3JR2A 3O0KA 3VINA 1SVDA 3LU2A 1I1WA 5HUPA 3L9CA 1R87A 2VVNA 2RH9A 3UCQA 1TQJA 2VRJA 3IJ7A 4R33A 3TSBA 4PE8A 5C9XA 2W3ZA 5D33A 3THDA 4W5UA 5CPQA 4KIRA 2DW7A 1WKEA 3NA8A 2REQA 4IFKB 1Z42A 4H9XA 3GE7A 1MYRA 4JHOA 2C0HA 4HZ6A 5TIMA 3NURA 3LBMA 2CHNA 2XFWA 2HSAA 3T0DA 4PZVA 1HP5A 1J0IA 5FKYA 4D8ZA 3GAYA 1Y5WA 2VX4A 3M07A 1KBKA 1KM3A 3GU9A 4S3FA 3UESA 2R6OA 3SEPA 1YEYA 4QQUA 1WX0A 3MV11 1JAKA 1ML1A 4IXXA 5B7ZA 3UNDA 2VT0A 1M7PA 4DUWA 1A5UA 1IEXA 3GK0A 3CQHA 4UDYX 3GYEA 3INPA 5BZAA 2VEIA 5CQ1A 2VC7A 2I5IA 5I3DA 2UZ9A 3OBKA 4LCRA 8RUCA 2WMIB 1UOKA 3SJNA 3GXNA 1B31A 2PGFA 4DO7A 1K9FA 3OVPA 2WINM 4FOUA 2WKGA 2WVVB 2OO6A 4PB5A 5BXTA 5I79A 3VX0A 1U2YA 3W7OA 3YPIA 3WNPA 2YXXA 3CQIA 3O2LA 1QXLA 1TWZA 1DXEA 1PEZA 4NJIA 4RKAA 3RNDA 3LPFA 2BFGA 1XIDA 1KTBA 4IIBA 4PMNA 5E70A 1CXFA 1HUVA 4HCDA 3BLEA 4WPEA 1DIKA 5FEPA 1H41A 4QAWA 3LBCA 5FF7A 4L9ZA 3DPQA 1ZL1A 1IYXA 2ZZ5A 3L4UA 2WVSA 1NOUA 2XJ7A 3CPRA 1I4NA 1V3KA 3C0QA 5C2GA 1JF5A 3GUGA 4FZSA 4CCZA 1QNOA 1EP1A 1EWEA 1QASA 2HS8A 1SGJA 3PS7A 1PVNA 1GVSA 3WH6A 4H00A 1DXIA 4LSBA 4TTGA 5C2XA 3WQDA 5HUOA 3TDFA 3TXZA 1DJIA 4XISA 4E0CA 3AXHA 1FP9A 1P6WA 2QDDA 3AZTA 3WDJA 4HU3A 1KXHA 4E2VA 1M1BA 2NSXA 2NVAA 3S2LA 3GH4A 1W5PA 1A0EA 3KAWA 4RK8A 4U2ZA 2AQOA 3GS6A 2KHOA 3VXGA 3DDGA 4QP0A 4GX8A 2F7OA 2YA2A 1OF8A 4KGLA 2ND0A 1YX1A 2Y5EA 2ATSA 5C9UA 2OO0A 2YB4A 4C7DA 4WD0A 3F5KA 3IUHA 1SJDA 3DG3A 3KP1A 2AL2A 4L6HA 2NQLA 2BSLA 4CQDA 3F2CA 4H04A 1WDDA 4MG4A 3STFA 4ILSA 3K5XA 4D6CA 4E81A 3CH9A 3VCRA 3UF9A 4GWEA 4BQ5A 4EZRA 4UTTA 1VJIA 5TQLA 4LBUA 4L65A 1JL8A 4JQAA 4JNEA 2J66A 2OGJA 4DI9A 4Q4OA 2D0HA 3WH9A 4QLLA 1KKRA 2VZTA 4Q4PA 2OOGA 2A6NA 2R82A 2CETA 3ERPA 2P8BA 2QKFA 4PUNA 3AFBA 1M68A 5DBTA 3S2MA 3AO0A 3DAQA 2NVDA 3LTYA 2FYMA 3CLWA 4AEEA 2A3CA 3WNNA 1EEPA 6ENLA 3B9EA 4H9ZA 3W7RA 5BW6A 3WSUA 4BA0A 4AZGA 1AUSL 3ABSA 4ML4A 2DSWA 2QZRA 3ALFA 3BGAA 3T9PA 1GKQA 4U3CA 1IIGA 5FCZA 3A12A 3NGJA 1TUXA 4HOZA 1S3HA 2J7FA 4UTWC 4Q4SA 1Y5XA 2GJXB 1ONXA 3P67A 4GYJA 4C6KA 1XJBA 1UR1A 5LKYA 2DVUA 1W9PA 1DKZA 3S3GA 4C6LA 3WBEA 4ICCX 1XFCA 3RM8A 4CNSA 1XI3A 2PD9A 3TQ0A 2XN1A 2OBMA 2D2OA 4NPHA 4GE8A 3T42A 3G1AA 5EMJA 1SJAA 4CVUA 2ZDSA 4YL2A 1VFFA 3B04A 4LAMA 5HMDA 1PS3A 4FR6A 1XUUA 1WZKA 2XGIA 1X8FA 4E2DA 1GHSA 1E9YB 3P84A 3WJZA 1UA3A 3CAKA 2XIMA 4UTMA 4I8YA 5DBUA 3CV6A 3QYSA 4RXGA 2HE8A 2PDHA 2ODOA 1EF3A 1AQ0A 1CZ1A 3W6YA 3TFCA 1TFVA 5IBXA 5REQA 3B8SA 4DN1A 1V0KA 3CZJA 1G69A 1XIGA 2F7QA 5DELA 3MV01 2FHBA 2Q6ZA 2YIBA 2GGJA 1R3YA 1C8XA 3TONA 1F3EA 1C91A 5MKGA 2XVNA 1M53A 1PCWA 4UFMA 1BWKA 3AHXA 2I9UA 4UCGA 3GUWA 1UR0A 4IH3A 3SBFA 1MO0A 4YCOA 4IQDA 2X16A 3AJ7A 1TE6A 4G9PA 5A8PA 1SMDA 3PPGA 1PWLA 4EZWA 3SB0A 3KDRA 1MSSA 3FA5A 4AQLA 3OA3A 4HA3A 1FKWA 2NQJA 2YIVX 1S2CA 4C5YA 1FXQA 3WFLA 4AB4A 3UZZA 2GPTA 3BUQA 5DCBA 3EGJA 3FEMA 3W2MA 5F2GA 4R88A 1B54A 1W9BM 4ZO8A 1H09A 4WGXA 3LS9A 5FF2A 4MADA 4MYAA 3MY9A 3UW6A 3CIWA 3SFKA 3L65A 5HNTA 2GVJA 4HNNA 1UQYA 2PF8A 1VYRA 3WDRA 4MPKA 4N0RA 2HNEA 4DJFD 1R2SA 1DWGM 4GKLA 2J6XA 3T4WA 1VENA 3FDKA 1NDZA 4PB3A 3DFTA 2PP1A 3W85A 3C5QA 3PHAA 1CT5A 3L4TA 4JL2A 4WIWA 1J8VA 2Q02A 1QOXA 4MY8A 3KBVA 1YHTA 3TQKA 2PWDA 4Y9PA 4A3QA 3LCHA 3BV4A 2F84A 5D4YA 1OCNA 2I9EA 4I9JA 3WLJA 1RV8A 4OBSA 5EMUA 3V5OA 2Y7GA 2ON3A 1UKQA 2OFJA 3VOHA 1E5JA 1TE1A 3ANYA 3MI2A 1EYEA 1S39A 4LVFA 1SFSA 1W5QA 2PDYA 1XC4A 4WXYA 1M6JA 2PWGA 2DSUA 4ZB2A 1SO4A 3PUOA 1I4TA 4JQ1A 3GIQA 4GYPC 2OLSA 1A53A 2W27A 2OVLA 2Y24A 3KVLA 1W6TA 2ISDA 4LVBA 1XYMA 3G5EA 3VE7A 3VMNA 1U30A 3H24A 3UJSA 1GVRA 4LTSA 3ANVA 3H2AA 3IANA 1DHKA 3R25A 5C5YA 2VEMA 3R13A 1L6YA 4XAZA 4E2OA 3I39X 4FNRA 2I57A 2JEQA 4ICMA 4NNAA 4BK9A 5D30A 4P7OA 1ALDA 3CMGA 2CZ5A 2NW0A 2V5JA 3U7VA 2ZBTA 4LNCA 2DZBA 2WHMA 1OK6A 4LY4A 3VVGA 4CD5A 1B9ZA 1HT6A 4IIHA 5JU6A 2G3FA 3BTNA 3IACA 1RBLA 3G8EA 4D72A 4C6IA 3DHUA 2RDUA 3EWWA 4R5GA 1QAPA 1ZY9A 4LS2A 4TXEA 2CITA 3DU0A 3NPVA 3AHVA 3U2CA 1IIHA 1JZ6A 2JIWA 1CGYA 3DYTA 3KL0A 5CXPA 1KWKA 2C15A 3NJ3A 2BP1A 2FFIA 3RPMA 4YTTA 2WKLA 1KQYA 3U5YA 2FJKA 4FP1A 3NZQA 4QNWA 3IWPA 5BNKA 4IFKA 3FNDA 4IM0A 4R3UA 1OC6A 2D4CA 2VHLA 4NL1A 1MW0A 1W9UA 3H4WA 3BQ6A 5I3KA 4PEKA 3TMLA 2CLHA 3W37A 4J3SA 4ZO7A 4P8WA 3LHVA 3P62A 2H8XA 1KM4A 3DPOA 5I06A 4R27A 3MCMA 1VPQA 3FFSA 3EJUA 3PZTA 4A4AA 1HGYA 2J6VA 1MUMA 5GVJA 3EX4A 4G7FA 1TX2A 1SU6A 4XSMA 1DIOA 1KCKA 1DQUA 2RAIA 2ZA3A 2ICSA 1OYCA 3W2UA 1DJYA 1LRQA 2VEPA 3TQPA 1EJXC 3PVFA 1EDGA 2XINA 3SCTA 3EMCA 3L21A 4PCFA 1K9EA 4DWSB 4WPCA 3PSVA 4RNHA 1F5ZA 1W1YA 3W76A 2WMIA 4MNLA 3TC7A 2YIAA 3QN3A 3WMBA 4Q6XA 3NR0A 1GQKA 3W7PA 2WVVA 3C0JA 3TN6A 2GDQA 4G8TA 1XIHA 3LZ5A 2ZRYA 4TX9A 4YVPA 3GIPA 2QMJA 4H3DA 3MPGA 2HTMA 4Q4RA 2BWGA 1CB7B 4GFIA 3W87A 4F4RA 3W27A 4B4HA 4EZOA 3NYZA 4IJRA 3PUEA 4HHLA 4IZGA 2PWFA 4TR9A 5CG7A 3MHUA 5C2CA 1NP2A 4IP5A 3WLHA 1SZFA 4HYWA 4HN8A 2EAWA 1VRDA 1H2JA 1QW7A 3W86A 1BQCA 2PB1A 2V5KA 4GUJA 5CPMA 3W7CA 3S5YA 4DJED 3VKCA 1YQ2A 1QR7A 5I23A 5GJNA 2FB2A 1RCXB 3BUIA 3ZYZA 3QE6A 3N17A 4MWAC 3S9YA 3LTPA 1CGXA 4UFLA 4C1KA 2WKJA 4YN5A 5C6MA 2YCKX 3MCNA 1IXNA 4QE5A 1UR2A 2BGNE 2V67A 4H01A 1SFLA 2VWSA 4QTGA 1NVMA 4I9MA 3PP7A 4B5TA 5HAOA 4NKCA 3KHJA 3WD3A 2HMCA 4F0SA 2D1LA 2VC6A 1LG1A 3LRLA 3M64A 1EZWA 4JYDA 3ECQA 4YXGA 4JL9A 4V27A 3MKKA 4L9YA 2YCJA 2TYSA 4QS6A 3B0YA 3EJPA 4JN7A 3ZR4A 3M43A 3RXZA 1YNYA 3S2CA 1C29A 2NT0A 4PMZA 2Y62A 1LWJA 1JD7A 3W7LA 4MF4A 3NXLA 3NGFA 3LY0A 3E5PA 1PS9A 2BODX 1QX1A 3T09A 4AWSA 1IXOA 3SN4A 1QHPA 1ZALA 4A6GA 5XINA 4C65A 1OFQA 1V6YA 3UXIA 1VS1A 1KR0A 1B4EA 4RDWA 3AHYA 4AYGA 1Z89A 2DQWA 4AISA 3LM7A 4UQDA 2OT0A 3KWXA 3R4IA 3U2ZA 1SU5A 3CL6A 1DE5A 3HPZA 3W26A 2OKOA 2WZMA 1A50A 2KAUC 3WX7A 2HISA 2BGSA 1TPFA 1X6NA 3OW1A 3TYUA 4G1KA 4H2HA 3UA3A 3ATYA 4HB7A 2WHLA 5M2FX 4DYEA 2ASHA 3CEUA 5E6ZA 1GTHA 4QJ5B 4XZ9A 1VFTA 1XW8A 3OZOA 1KM6A 4JKKA 4O18A 1OG0A 1A49A 3FEQA 1IZKA 1J6PA 3HN3A 4NP7A 3W53A 2A7RA 1EQPA 1RCOB 1HNYA 2VRKA 2G5WA 1JZ8A 3EX3A 1GCYA 1CDGA 2F6XA 1WZMA 3AQUA 2RDXA 3VDCA 1XGDA 1QVBA 4UTKA 1ITXA 4PMUA 2Z1XA 1QFEA 3N4AA 1X1ZA 3QHNA 3HPAA 1H11A 2UY4A 1EJUC 4UMAA 2QJIA 3PK7A 3TTYA 3F2DA 2XIBA 3W1QA 3UWZA 1LDCA 1KRAC 3WFZA 4UBPC 2CLEA 3LI0A 3Q0KA 4PCNA 2NSOA 4HMDA 1HJSA 2GJXA 3MSDA 2C1GA 1Q4WA 2J7CA 1PZ2A 4M0XA 1THFD 1MQQA 3QTPA 2ALWA 2AAMA 4O4WA 1IWBA 3I3EA 4CUCA 3A47A 1H51A 3VGBA 4QNEA 1Z32X 4XO7A 1K4HA 3PJTA 5KTLA 5H6HA 3A21A 3VD3A 1YNPA 3IK2A 4GJIA 4JIHA 1ICPA 2Y5JA 4HPXA 3VNIA 4IUOA 3FVMA 3DFNA 2Z0VA 1WAWA 2GZXA 4POCA 3D0CA 4MZ8A 2WHKA 3FYOA 1W2PA 3M0HA 3NSXA 1J01A 3W1RA 1S2TA 1AMYA 4R5EA 3IRDA 2ZTKA 3TJIA 2EG6A 1E0VA 4HBKA 5D05A 1GNXA 3OEXA 3RCNA 1UIOA 3KUMA 4FI4A 1WZAA 3A13A 1R3WA 2BVYA 1GOQA 4HA1A 3SQMA 2ISWA 3MKVA 4XBJA 1FCVA 3M0LA 3M0ZA 2GFTA 4YWSA 1H3GA 3HBLA 3MC5A 4OFCA 3R7MA 4DZ5A 3BG5A 2Z6JA 3GWQA 5LIUX 4HCLA 2E25A 2E9MA 4JTUA 4A8RA 3NQ8A 1Y5VA 2QCMA 2UY2A 1R5YA 1LLWA 4IQLA 3V1PA 4H4IA 3VZYA 4LU0A 3GFYA 1BAGA 5AC4A 3C52A 1R47A 1J0HA 4K1GA 1Y65A 4HK7A 1RK5A 2CZEA 5CPNA 4AWEA 2QVHA 5AHNA 2Z4GA 2QXLA 3IGXA 1E72M 3ZOAA 1JJKA 4IMAA 2E68A 3SY8A 4RE3A 2X05A 1VBGA 4UQBA 2QCCA 1NP0A 1I1XA 2RKXA 2A4AA 3ISIX 4U5KA 1QJWA 4WK9A 3CAVA 3GNRA 3CKDA 1A3HA 2RGMA 1W3IA 1EA0A 2MANA 2Y0FA 3CUGA 1X8CA 2ZA1A 3MHGA 3WNOA 4FF7A 5J5RA 3KW3A 1D3CA 1UJPA 4DIAA 2JKEA 3DC0A 1XLBA 1XD0A 3R0KA 4FLSA 5JBFA 1SQ7A 1V77A 4Q8WA 1FP8A 4OUEA 3LLFA 1NF0A 1CLKA 3CZLA 3ZFHA 3ZWSA 4PH6A 1X96A 3WQEA 4US5D 2Z7GA 1R7OA 1S5VA 1SW7A 1XPGA 4S3CA 2V0TA 1ZBWA 1K7FA 3LV6A 2IQ0A 2HRWA 2EPMX 1ZAJA 4DUVA 3Q2DA 1FOBA 3USZA 3URBA 3LI1A 3CIVA 1FQ0A 4A3RA 4AD2A 1KV8A 4ZSTA 2Q3RA 2NWRA 4Z1DA 3UEQA 1AMKA 1TREA 3KTCA 3W1AA 2C16A 2V69A 1TV5A 4KFNA 4AD4A 1DTUA 5FJJA 1TQTA 3P5YA 3E3HA 1KM5A 3CPGA 1T40A 1ZRQA 3VNYA 1RQBA 8CGTA 3N34A 3KX6A 3BOFA 3UXLA 1E40A 1JUKA 4GQGA 3AS2A 3BQ5A 4UZUA 1OFRA 3NG3A 3PPHA 4NZCA 2QF8A 1TYGA 3OOQA 1E55A 2DSKA 1OABA 5C70A 4HHPA 1FWFC 2G3IA 1R33A 1VFOA 5CC5A 1YPIA 3ZWTA 1VEOA 1BG9A 1DE6A 4KW2A 2E7FA 2PDWA 1GGOA 5T9CE 3EDJA 2OU4A 3UITA 5HWJA 2E28A 5FEWA 3APGA 3FX4A 4I5XA 3DG7A 3F4WA 4HCHA 2QJMA 3BOLA 5LXEA 2GVEA 2AKZA 3FHAA 1Q6LA 1TSIA 1J2BA 2ZRXA 1S2AA 2P3ZA 3QYQA 2CIPA 5KZEA 4UR7A 4G2DA 2WCGA 1ZBCA 3OGVA 4LJ3A 4JPGA 1EEXA 3ZZ1A 2QGHA 3R94A 3OK8A 2YCEA 1TV4A 5A8QA 3MQTA 1ZSXA 1UR4A 3WDHA 2Y61A 5SWUA 3VGDA 2ZZ4A 3TQVA 2R94A 4DO4A 1XGZA 5C8BB 1V3JA 2PS2A 4PTDA 5I00A 2AAAA 1XQKA 3UZJA 3I7RA 1WDWA 1VBHA 3E1F1 4AX6A 4UDXX 5A8OA 1MW3A 3CV2A 1K7XA 4I90A 1OFOA 1QI5A 4P7RA 3W7KA 2Y8VA 4BI5A 1WP6A 2E6AA 4KWSA 2X0HA 4MIMA 4RZ6A 3UT0A 1R3QA 3JZEA 2O4QA 1LJYA 1FFQA 4DWSA 1JYXA 2VCCA 4N9CA 2QS8A 4GI9A 4JZ5A 2QIIA 3AHTA 4FNSA 1OCBA 1RD5A 3S0CA 3BVUA 1MI3A 1C7TA 2NX9A 6PTDA 3SCPA 2JIEA 4XBKA 1D2KA 2CKRA 3ONCA 3CWNA 4I1QA 3NTYA 2DZWA 4GJ1A 3C4UA 2QULA 3AS1A 5IHRA 4OT7A 4W85A 3NDZA 5AHMA 4C6FA 4Y2WA 3R12A 4B91A 2Z26A 4HYVA 1E4NA 4LX4A 4B5WA 1TTPA 5A5WA 1XS2A 4JGDA 4GPNA 1UB3A 4I7VA 2EJAA 1G94A 6TIMA 1XIJA 3W7QA 1OHLA 4BY3A 1I49A 1U22A 3K1GA 1TZ9A 3S1UA 2X1IA 1HGWA 7TAAA 3SRDA 2HPIA 3QPYA 4A8IA 2WAGA 4G6QA 1DP0A 1PYMA 3U48A 2NLYA 5I07A 4LVDA 4HTBA 4IW0A 3ACOA 3DFSA 2W61A 1C9DA 2GGIA 2VFFA 3R0UA 1EKOA 4H8VA 4Q8QA 1LOSA 2WNQA 3WLKX 2JKAA 2IPFA 1UASA 3FA3A 5I09A 3RR1A 1WCGA 3HFTA 1IHIA 3GG0A 3LD5A 2YB1A 4CD4A 4EVZA 5LHFA 3RLVA 5KETA 5DF0A 4GCXA 2PODA 4ZXOA 4BEUA 5IFPA 4LNYA 4S23A 3G1RA 2WW5A 3CAQA 2PBGA 2P8CA 1YDYA 4HMCA 4C6OA 2PDXA 1PIGA 1S3TC 3CK5A 3TN4A 1QATA 4EZNA 2AGKA 2EBNA 4IIGA 2UY5A 1L0PA 3EB2A 2PAJA 1UR9A 4QX4A 5FAGA 2X5CA 1EJ7L 4J5NA 1EZ2A 2FIQA 3T05A 3SJ3A 4Z2KA 4JTIA 3IJDA 5G1TA 4S3EA 4AZIA 1V02E 3PJXA 3MMTA 4F3HA 5DO8A 2EPNA 4QROA 4L1XA 3II1A 4O11A 4AF0B 1L2QA 4E8GA 3UWYA 4C6EA 2X1SA 3FY1A 3GXFA 2E4TA 3QSTA 1OGGA 4JDYA 1LF1A 5A8GA 1JQVA 2Z1WA 5H1WA 2VX6A 1FWTA 3OLIA 3SQLA 3UD6A 1R5EA 2HNHA 1YBQA 1AD1A 3VOGA 2AQWA 2IPWA 1ZB5A 4GIYA 5BWAA 3KVJA 4MTVA 1DORA 2ESCA 2D3LA 4XTIA 5D8WA 1LBLA 1L6SA 3S6DA 3PC0A 3H2NA 3EJTA 1W1TA 3RO6A 2Z2UA 4V15A 4PMRA 1ME7A 2HVMA 2YXOA 4CQ8A 2G4FA 1O68A 1FKXA 3TMQA 3QHMA 1M9HA 3HG4A 2DPEA 1Q7QA 1L6GA 3C56A 2HCVA 4Z42C 3ZLFA 3IGUA 2BVDA 2HV5A 2NX3A 2X7WA 5CBBA 1P43A 3IJ8A 1TWIA 4CN6A 4GUHA 4JQ2A 3T0TA 3VIGA 3GLCA 4F0HA 1XCWA 5TNVA 4MLJA 4GO8A 1W54A 3TEVA 1MMFA 2W92A 1EPVA 3GNPA 3IIPA 1VFHA 1R8LA 3GC4A 3ALGA 1R38A 2EPOA 1M5WA 5HNRA 3PUGA 4GINA 3NQVA 3QMSA 2GVLA 1OSEA 1BYCA 1OGBA 1TJ2A 1UUQA 5FD0A 2OLAA 3DIPA 2PDMA 3MDUA 1KBLA 2BASA 4V1YA 4EXAA 3PZQA 4LANA 3V5CA 3WBYA 3QW3A 4R85A 5A8NA 1HKVA 4REQB 4DZIA 1TVNA 3CYVA 1MDRA 1IGWA 1W3TA 2QCLA 3WNMA 3QY6A 4GQBA 2ZUWA 2HWGA 1NFBA 3TNOA 4WXZA 3OB8A 3P6LA 4NJKA 3KVMA 4YNGA 4DVOA 1KXTA 4W7VA 4CU6A 4UFKA 2E67A 4I8DA 6XIAA 4FS9A 3B0PA 3HMJG 1KCXA 1BSLA 2TSYA 5FJRA 4JIEA 2I1OA 4QE1A 1W1IE 5LXXA 3N29A 1S1RA 3UBPC 4GY1A 4YCPA 5CZ0A 1NSJA 5HULA 4WRHA 1XLJA 1HL8A 2QUNA 1PZ0A 3KBMA 4M7SA 3CUHA 3KLKA 1CPUA 1UQZA 1F6KA 1UP3A 3RGTA 3G1YA 1RJQA 3EOEA 2ANUA 3B8VA 3OZYA 1WDZA 1WOBA 4HU0A 2DUAA 4B2DA 3TUUA 2BHZA 1OZQA 4PC8A 3MSYA 3G0SA 3P0WA 3TYCA 1FWRA 5DY3A 3HV8A 4LV9A 3RILA 3MSGA 7ODCA 2Y1HA 4NU7A 1PPIA 2WSQA 2EG8A 3F1QA 2Y7EA 5AYZA 2PDIA 3GX9A 3LXAA 3CLMA 1AW2A 2R91A 1E9VA 4D6HA 2WVUA 4EPBC 3I65A 2OQYA 1VBJA 5EY5A 1FWAC 1YE6A 4M19A 1QWUA 5D9MA 3DBPA 3JUGA 4FF5A 2BG5A 1ADSA 4KKXA 1Q85A 3LGEA 3EPMA 1KTCA 2A3EA 3FXGA 4WDWA 5FI8A 4WY0F 4GYKA 1H61A 1XLMA 1CGVA 4IFOA 3I01A 1O5RA 3ARVA 4RDVA 1XYCA 4XV0A 2E1DA 3VNZA 3QFWA 3P74A 3BGJA 1TPDA 4ROPA 1O66A 1WDQA 1UWRA 3VKHA 5CPTA 4DLFA 3WF0A 1GUVA 3HGJA 4IPJA 3EA3A 2Y89A 1UWSA 1U83A 4TX6A 4I9AA 2DU2A 3O6AA 3LRKA 1LOLA 2FHFA 2E3ZA 1YADA 4LAZA 5E9AA 1R3SA 3DECA 4ZMGA 1V02A 2YFNA 1EUAA 3RRAA 2HEJA 1HO1A 3UG8A 4LQ1A 2ZIDA 1WQ5A 1X97A 2CXGA 1QO2A 4OIFA 2PP3A 3VGGA 2X3XA 5F2MA 1RVKA 2YSWA 1UWTA 1OIFA 4O57A 3F03K 4MUPA 5HQEA 2J8FA 2VFGA 2PU1A 5C7VA 5HXMA 1IEQA 3ARPA 4WSKA 4OOZA 3LMZA 4GQ0A 4CCCA 2J9XA 4RE4A 1HKMA 7CGTA 3PNUA 3BVVA 4S3DA 4LFYA 1SMAA 3FGCA 3PF3A 3L2MA 2FLIA 2CYGA 4AZ7A 1GONA 3N2TA 3RU6A 1V6XA 4H6IA 3OLEA 4KFOA 2Q09A 1XCFA 3RCYA 2PCEA 5CSRA 1WKFA 4JX4A 2E6DA 4DJDA 5E09A 1YLVA 1X1OA 3GZAA 3UQNA 1CTNA 4J35A 3CHVA 3O7UA 1XC6A 1MRAA 3N73A 3DX1A 4HTYA 4PTVA 1JNEA 1SFTA 2FB3A 3WMSA 2VVSA 5HQLA 3DFOA 4EOUA 3CXOA 5AVNA 2QV4A 4GVGA 1R2TA 1RA5A 3NWRA 4WF7A 5EB8A 1US3A 4PEEA 2Q8XA 1GJPA 4P7LA 2GJLA 4BWLA 1UCWA 2RGLA 1LL6A 2CNCA 3QMRA 3G18A 5T8GA 1W9XA 5LNRA 1UZDA 4C1NA 3MO7A 3U4FA 4Q8MA 1UKTA 2A3LA 1TV8A 1Z7AA 5CC7A 1IWPA 5LSMA 3QKZA 3OHIA 4GISA 4LH8A 1N8FA 4EXQA 4IQEA 3DYPA 3ZS4A 1GG0A 1XICA 1TTJA 2ACRA 5FIGA 5GNYA 2QPUA 3KL5A 2X1RA 4JTKA 1KFBA 2Y6ZA 1RLCL 3CZ8A 2VZUA 2ZQ0A 5LNSA 4IX0A 3SDOA 1CIUA 1GYMA 1IZCA 3KBNA 3TYAA 4O13A 3G1HA 2BV9A 1W9VA 2YA0A 4MFDA 1PIIA 1A5MC 5JBDA 2F61A 3LHTA 4US6A 3V36A 3I68A 5IXEA 2PLJA 2YDRA 3ELFA 1FA2A 2VR4A 5K7JA 3NNTA 1KBJA 4AEFA 4C91A 3VDGA 5BU6A 4BF5A 2Y5SA 4MB4A 1XLEA 1OX6A 3RM4A 1GW1A 1LP6A 3L5MA 3ME3A 1NTHA 1DBTA 3WQ6A 3H4XA 3REQB 1RA0A 3EDFA 4HPJA 3WEOA 2NUWA 1X7IA 4O1EA 2BS9A 3W71A 3BSGA 2BOGX 3N04A 4M6PA 6TAAA 1LWIA 3L23A 3VD7A 1QT1A 2ZRZA 3W70A 2P0IA 1QOPA 3TSMA 3SUUA 3I2WA 3NL6A 4WHBA 3MYOA 1LL7A 3K1DA 2DZSA 1XGEA 3PBYA 4XAYA 3WUBA 2OBLA 3A98A 3WL1A 2G0WA 3M7SA 3U2EA 5KZMA 3PTDA 2WSRA 4IPNB 1URUA 3KHDA 2OQHA 1EC8A 1E9LA 1PSCA 4IWOA 1NH6A 1HFBA 3WF3A 4ROQA 3BG9A 1W17A 3GDLA 2O0I1 4GGHA 5DX7A 2WBKA 2VMFA 3MDWA 4B5VA 4PB4A 4AF0A 5KINA 3T47A 1HXJA 2DJXA 7ENLA 1SU7A 1XUZA 2B7PA 3M6YA 1MWOA 4R7OA 3IJQA 1XF0A 4W86A 2P5NA 1ZQ5A 4RPQA 1Q5MA 1CWYA 4H7ZA 1P1MA 1CGUA 4X63A 4R5KA 1EB3A 1DIEA 3C61A 5A2CA 2P1FA 3N2BA 3PWAA 1F07A 4PULA 2ONEA 3E0WA 1TG7A 1H62A 2WMHA 1LWHA 4AD3A 1G7UA 3I6RA 4Q4MA 5KITA 1ENUA 1A4MA 2Y8KA 1W1VA 2CEQA 2ZXBA 1U1HA 1L8PA 3QVQA 1JZ2A 5CEWA 2DH2A 1H5YA 3OIXA 4D6IA 4CQCA 5D32A 3GXTA 4Z1CA 4FXRA 3CZKA 1FFRA 1AFSA 3BMXA 2PRHA 2QW5A 3LHWA 5I24A 3AZRA 1A47A 3L67A 1E6SM 4DZAA 2C6QA 3UYCA 2V5LA 2ABBA 4YIWA 4AYSA 3O0FA 2QGYA 4N4QA 1DWFM 2D1ZA 4ZZ9A 2PWHA 1AQHA 3WL0A 3JRKA 1H4PA 1O95A 4WJXA 3W1LA 3IUIA 5BOEA 1BXCA 3T0BA 3KBWA 4D2JA 1TR9A 4WDUA 4U10A 4H7CA 1SZNA 3GD6A 5LHEA 1HJWA 2V81A 4GGBA 2R1PA 1ISZA 2QFFA 1FDZA 2UY3A 4ZFCA 1E5NA 1H49A 3AXKA 1QU4A 1CENA 1GEHA 4EE9A 5KZ6A 2HS6A 3A4WA 3DXIA 4HZ8A 3RJXA 3DI1A 4IIEA 3OYXA 4RDZA 3FHQA 3ITGA 4EPEC 1K9TA 1S5TA 4JIIX 1W9MA 2IQDA 2DV0A 3L5AA 5L6UA 2INEA 4ACZB 3CHDA 2ZICA 2DIKA 4ORMA 2DSZA 3OU8A 3AIVA 2AMGA 2ZWYA 3OJGA 4NI8A 1JVNA 3VKDA 3N6JA 4ZGYA 4Q7IA 2V5BA 5CJMA 1HG3A 1I2QA 4FOJA 4B9QA 1EO5A 4NAEB 1M01A 2PP0A 3B9OA 1ISVA 2TMDA 4M8UA 1XDLA 4Q7BA 4HPGA 2QNEA 3CHEA 1NARA 5BRQA 3BJFA 4NIRA 4PYSA 1FHUA 3EJQA 4M1BA 5AYXA 3R79A 3MCOA 3T40A 2C18A 3OGRA 3NQGA 4MFEA 1TV7A 2VD8A 2OMAA 3W83A 2G97A 4TIMA 5U7SA 4FZPA 1UPPA 2WQPA 4NZJA 1VAHA 2J47A 4JICA 4TMBA 3USBA 2DSVA 3PWGA 3W2KA 4UNIA 1LQ7A 2ZOXA 1T5AA 4XD5A 3K13A 3PR2A 3EWXA 3MMUA 3WQCA 3R2GA 1QWNA 2XYLA 4UFIA 3RM9A 2Z7KA 1VRXA 5G4HC 3HF3A 3RX4A 3M0XA 1XLHA 5G2IA 3WK0A 3TH6A 3IIVA 4L4LA 3MZ2A 3HTWA 4GCAA 1I4DA 4OECA 3NQMA 1U1JA 4QGCA 5T26A 1MEIA 1OEPA 1VPYA 1GWJA 2J27A 5IHSA 1XG4A 3WMCA 1SZEA 4K7VA 3GB6A 3HPFA 1R9XA 3STCA 3VI2A 1QRQA 4EZSA 1TJ0A 3ZXWA 1FY6A 4EANA 3ZJ8A 4IM3A 2F1BA 1PE1A 3W23A 2J79A 4EACA 2VENA 3CB8A 1KFLA 5EU9A 3WKZA 3OWGA 2ACUA 5L9FA 3M41A 1R3RA 3R8RA 3W22A 3H23A 3M9YA 2QCDB 4UFHA 1B3VA 3NOEA 3CV1A 2QLYA 1OM0A 3S5OA 2F8QA 1WDRA 3VFLA 5HJXA 4J1OA 4OBTA 4A8LA 3DDFA 3AMKA 1B90A 3E12A 1U33A 1N55A 4HT3A 4NSWA 3WLNA 2PWUA 1F05A 1TRIA 2OZTA 4EXBA 2I16A 1OCJA 4ZENA 2QJNA 4GA8A 2I5QA 2FGBA 3QV6A 5D9NA 3RK8A 1BPLB 3OIHA 1P0NA 4LC8A 3UP8A 1MQRA 2Z2AA 3BO9A 4X2PA 3S1WA 4MSSA 1CXEA 5KZDA 4QDPA 1TIWA 4GXPA 1VH7A 1WBHA 3H53A 1ODZA 2BY1A 3M47A 4XQ6A 1UWAA 4GKTA 1EQCA 4L4OA 2YBUA 3NEHA 4EZYA 2YFOA 4MHBA 1EX5A 2NUXA 3ABXA 2ZUVA 4IGHA 1POJA 1QPKA 4KESA 7REQB 1RLDA 4ZQMA 2ISVA 2FFCA 3THUA 3WQVA 4O1FA 4AD1A 3E2RA 4HHMA 4N7QA 2GVGA 3T2PA 4Z17A 1O7DC 1WYIA 4QBXA 1JPKA 1BRLA 1GORA 1A0CA 2V2DA 1E15A 2I14A 1UD4A 4L7ZA 5CSSA 3S1GA 2VGIA 1B9BA 3SI9A 4C6QA 1JFHA 3NL3A 5EBUA 4UTTC 1SZGA 4IWQA 5J8LA 1W56A 1QK2A 4NNCA 4GUIA 2VKZG 4R34A 2VC9A 4NRRA 2ZC1A 1X6UA 3BVTA 2VP8A 4JTTA 3ZSSA 3OG3A 4UNKA 1YXCA 5H2ZA 3ES8A 3D4YA 3R43A 1I2NA 5JIWA 4ADTA 2YW3A 1V3HA 4IP7A 4ZTYA 3VUSA 2GGGA 3PZ9A 4K3ZA 5AECA 2RAJA 1I60A 3ICJA 1CI1A 1NQKA 2IW0A 3BW2A 2E5CA 5GJPA 4BKNA 1OFEA 1UBPC 4PR4A 4DO6A 4JWCA 1HTIA 3HA1A 1ITQA 5F1UA 1FHDA 1WNOA 3D2EA 5I03A 5J04A 1G67A 3RIKA 3ZEDA 4G7EB 1ZHAA 1VJSA 1R0MA 3PBUA 1AA1B 4CCDA 4R53A 1D8WA 4AVFA 3NO3A 3LRMA 2OXNA 1OT2A 2OEJA 3AMDA 4A3HA 2QT3A 2ZCGA 3K4AA 3LNMA 4MB1A 3RPTA 3KRZA 1PWMA 1A5CA 4E4FA 1LTDA 1KCZA 1JAEA 2PA6A 4ES4A 1PIFA 4EPKA 2BX7A 1MXSA 3BAKA 2A5HA 3S9IA 1BKHA 5G4WA 1UUMA 1E6RA 2FPVA 3ZM8A 3AAMA 5ABGA 4O16A 1KFKA 2DT2A 5BOFA 2I56A 1F9CA 3V0SA 1US2A 2EKGA 5LGZA 3MWAA 2CXEA 2VR5A 1W9DM 3SGZA 2AL2B 2BHYA 1O7DB 1YTKA 3ZLGA 2YDAA 3REQA 1NWUA 3W7IA 2WWDA 1OT1A 1H1ZA 9CGTA 2PDNA 4M56A 4AIEA 4XZMX 3SCVA 2WPGA 1M04A 1KQZA 4JTEA 5CGQA 4X22A 2PTZA 3IIXA 3UXAA 3GXIA 1J18A 1DWHM 2FZMA 3CO4A 3NCOA 1OBAA 4RLIA 1V5XA 4UQCA 5AYIA 4CN1A 2HQAA 2FGZA 4Y96A 3S42A 3HOJA 3EBVA 4JD4A 3D46A 3A22A 3J7HA 3CMJA 4DJEC 1E43A 2PC4A 5AYYA 4AC1X 3VDAA 2G3NA 4UNLA 3C0LA 4YTQA 5C71A 2D23A 1B57A 4HYBA 1UW9A 1ZZMA 1Q6CA 3N12A 2WJFA 4XZLX 4J40A 4QJ1A 3N13A 3APTA 4BNEA 2GWNA 1MUCA 3NM1A 4RZ4A 3VO0A 1H7RA 4M0MA 1ZYLA 5J5DA 3SCRA 2PSNA 3QXBA 3W82A 2ZX5A 1MW2A 3U3HA 3ARYA 4F2TA 3CZNA 2CLKA 4WVXA 1VR6A 3QR0A 4XZBA 3SCWA 1O5KA 4Y8FA 4FX8A 3NO5A 3ONBA 1WXZA 3VEBA 3M0MA 1K8XA 5C0QA 2Y4SA 1VQTA 4R5IA 4ORIA 3POCA 3DX2A 2GQ9A 2DORA 1V7AA 3IVSA 1GEQA 3WG6A 3M5YA 3H7VA 2XISA 4QCFA 2ZE0A 1VFSA 2DDXA 1V3MA 1EUNA 3AZSA 1ZENA 4CU8A 4O17A 2WNNA 3PJUA 3G3MA 4RE0A 1TO3A 4W89A 3AYSA 2UBPC 2NT1A 4XG1A 4CQBA 3N9SA 3HM7A 4IUGA 2XFFA 3TWAA 3GDRA 5AHLA 4XZNX 3AWOA 3B8DA 3W2LA 4HP5A 3VE9A 4E2BA 5MKGB 1IF2A 1MXDA 3BLDA 3E49A 3QMTA 1F73A 2J88A 4HOWA 5A6BD 5FEZA 4X3ZA 4AVOA 5D2VA 1EJVC 2YOCA 1WE5A 3BC9A 1I9CB 2EHHA 4EWJA 5C9ZA 2FMNA 4UXDA 1PX4A 5I3JA 4H6RA 3GSMA 3UXDA 3L66A 3VOJA 2O0TA 1DKYA 1EGVA 1RUSA 2VUNA 3FW6A 2GGHA 5A6TC 4HNOA 4ACZA 2WZIA 1B3OA 2DVXA 2OPJA 4MJ4A 1SJCA 4L61A 1B3XA 1XLCA 3GTHA 2PDLA 5AHIA 4AWTA 1ZNNA 4FEZA 3MUXA 1BWVA 2A0NA 2J7BA 1OYAA 4AMAA 4PMYA 3NQBA 3QBUA 3VYLA 4TMCA 4GX9A 4CQAA 3WJWA 4DNHA 1MNZA 4J9JA 1UJQA 3EA1A 4NRSA 3PB2A 4M82A 4GO9A 2VTFA 1KW1A 4PUWA 4KBXA 4QFUA 3LCIA 4TV5A 5M1TA 3VIKA 1VHNA 4JWEA 4L4PA 4IJCA 3G6LA 3R1ZA 1J5SA 3TLLA 1ADDA 4DYLA 4NNBA 3HV9A 4WLCA 2D2GA 4XZIA 1Q8JA 1KC7A 3ZO9A 9XIMA 3VMPA 3W1TA 4FX7A 4ZOEA 4JTDA 3TOYA 5HDRA 1BYBA 1HJUA 1C92A 4Q8PA 2QDGA 4OWGA 2FTPA 3W81A 3QNJA 4W88A 1Q13A 3SIZA 3FV9A 4DM2A 2HBVA 1L6WA 2DZTA 2NV9A 3EMQA 3IJLA 2BY0A 3R11A 5CZKA 3B9NA 2DFAA 2XH0A 2FYVA 3V7PA 1DL3A 2Y2WA 2G96A 4MZ1A 1XLKA 4LXFA 2DJLA 2WB5A 3FN9A 4RUBA 1TV3A 1FX6A 3VZZA 1PXGA 4X9YA 2XM2A 3PZOA 2WHJA 3GH5A 1MDLA 2QCDA 1GZ1A 2ALDA 3TXVA 3GIYA 3NUKA 3ZJKA 4PMXA 1KXVA 1EWDA 2YL5A 4QM1A 1EF2A 3PG8A 3SW6A 4V28A 1Q63A 2DUXA 3DI0A 3LGGA 4AUBA 1K77A 2OQLA 1YWMA 1TIMA 4H1ZA 3UWEA 5IM51 4RPPA 2FZNA 3QZ6A 1RPKA 4QDMA 1H1YA 1V8EA 1EBHA 4H8HA 1DJZA 2V30A 3DBNA 1KR1A 1XLAA 1XLIA 2FZDA 3E2VA 1W3KA 1NDVA 3N3TA 4MPQA 3U7BA 3NFUA 2OYKA 4EZQA 4WY0A 4MWAD 3I4EA 4HZMA 1VCVA 2MUCA 3ARUA 3KXQA 3HAJA 2GDUA 4Q8TA 2CLIA 1NQ6A 4HHHA 4D71A 5EBAA 4RX0A 2ACQA 1YDOA 2XZ9A 5HMFA 1EGZA 2OW7A 4PCSA 1OY0A 1W3HA 2GJRA 3DGRA 7REQA 3FLUA 1G4TA 3F5LA 2KX9A 2G3MA 4IM4A 5D03A 3BMWA 4AMCA 5A6MA 3RMEA 2BVTA 3WO8A 2BNJA 3KS5A 4U31A 4D6JA 1H0IA 1V79A 4D8LA 2GF4A 2PTWA 2BBFA 4DF1A 4U28A 3PAOA 1RP8A 1R30A 2X2YA 1F7BA 3FAWA 4JKLA 3SECA 1FHLA 4OGZA 4ZODA 1KO0A 1K8YA 3EMZA 3G3DA 5D37A 3OVGA 1DV7A 3PTMA 1CGTA 1QNVA 2LLEA 1PJ9A 2EPLX 5H8UA 4P8XA 2IPGA 1SR9A 1KBBA 4UFJA 3STGA 1LUCB 3DC8A 2GK1B 1TPH1 4DJFA 3ITOA 3L4VA 3GH7A 3C2EA 2Z28A 3N25A 5K9DA 3B0XA 1P7TA 4A29A 5HINA 2V0OA 3APYA 2GQ8A 2OWWA 1E4MM 6ALDA 3I6TA 4C90A 1H7PA 3VGHA 2J9ZA 3NQEA 3OGSA 1CYGA 3URNA 3M3WA 1UYQA 4X9SA 1X03A 3CV5A 5AY7A 1EXBA 4MOZA 4G7EA 3OQ8A 2VWTA 3JU2A 4GK8A 3O3RA 5I3IA 3BMVA 1XIBA 2PDQA 1BGGA 4GUFA 2WZEA 4J2PA 1PZ1A 1EJTC 4K6AA 4PUUA 2XTKA 3SR7A 4DX3A 3L12A 4ZB5A 4HZ7A 2BTMA 2UV8G 1ECQA 3BUDA 3TC6A 1HWWA 1F3TA 3W25A 1BLIA 2BB0A 1KM0A 5BWFA 1W91A 1QWKA 3K8MA 1O1HA 5TD4A 4Y90A 1LROA 3NXFA 4XD6A 1TJRA 3M6DA 4Z2GA 1DEDA 4IICA 1TCDA 4FX6M 4GVIA 3LQGA 4HKPA 4NVTA 4FZOA 4RR4A 3M0JA 5TBOA 4B15A 3SN1A 2EGZA 3UG5A 2YZ5A 3VOFA 1V3IA 3L3PA 3QV9A 2WYIA 3LZ3A 3O6YX 3VIIA 5LNUA 1ISXA 4PUDA 1A5LC 4GC3A 3XINA 2WZTA 4UTIA 4PSRA 4QSHA 3WH5A 1I0BA 4LT9A 1VJZA 1HL2A 2Q3OA 3B03A 4MNKA 5U4NA 1J5TA 3DHPA 2XSAA 5FJOA 2P53A 1FWSA 4A05A 3C2RA 3W9ZA 4JY8A 2GQ3A 4JYFA 3WCZA 4JCLA 4EP8C 1R86A 1GNTA 4CD7A 1EJWC 2TAAA 5EMLA 3LCXA 3IVUA 1ODUA 4J2MA 1GVEA 1RQHA 1LL4A 1ZAIA 4JDBA 4E38A 3UZ5A 2A2IA 4S3AA 3ZQ9A 1H0GA 4ZB0A 3L4ZA 4RE2A 2QUTA 2OZNB 2OSYA 3SADA 3V16A 3WLTA 1H5VA 2BOEX 2VURA 4LALA 5ABFB 2WBGA 1U00A 1UMYA 2CLFA 1CEOA 4GUGA 3W2NA 3BCJA 1GVIA 4MAVA 2DIEA 3L5LA 4O14A 4DI8A 3QGAC 4LEQA 2Y70A 1PX3A 1GTEA 3SGUA 3TW7A 2G3JA 1UKPA 5H91A 3PBGA 2NQ9A 1CLVA 4JTJA 4O1CA 2PRLA 5DRCA 3QM3A 4FLOA 3SCUA 2B7OA 5EMYA 4HIBA 3GO2A 3UXKA 2ADAA 4W8LA 2VQTA 2PDJA 5AHEA 3DPPA 5FAJA 1UD5A 3SURA 1WXJA 2P88A 5HMEA 3TLQA 4F8XA 4BI7A 2GA9D 4DAFA 3BLPX 2N3KA 3SCOA 4YHEA 1F4HA 4CVWA 1Y7VA 4FOKA 4H6KA 1XLLA 3DEQA 3PBVA 1XYAA 4KFPA 4JX5A 2OX4A 2WV8A 4Y8EA 3QQ0A 4DXXA 2XN2A 4AXKA 3UJ2A 2GOKA 2XH4A 1UC5A 1KFEA 2QCEA 1A5AA 3LPGA 4WQ6A 3TJ4A 1US0A 4DJEA 3UETA 1HW6A 4LYKA 1G9HA 1F2JA 2DGAA 1E6PA 3EYPA 5RUBA 1BGAA 3CU2A 3T7VA 3GG7A 1DWIM 3N1AA 1UIPA 4CNUA 4NI3A 1E2UA 5LIXX 4OBRA 4Q8OA 4OV4A 2PDBA 3TR9A 1EIBA 4OVXA 2XG9A 1RQEA 4DPQA 4FIRA 4AEOA 1UH3A 1E9ZB 1JDEA 2QV5A 4O0KA 2FDSA 2YBTA 3CAWA 4MJZA 4GBDA 1BWLA 3R0DA 1WDSA 1B4KA 1TVPA 3SGGA 1TB3A 2W0UA 1E1FA 1E3XA 3GTXA 3H6OA 4AFYA 4IIFA 1QPOA 1O94A 2WMKA 2EG7A 2RHGA 3V0TA 3AXXA 3WBXA 1KGUA 3WBAA 1DQWA 4M7TA 3CZEA 2VRQA 1GW9A 4KEMA 5A8MA 4GNVA 4R7JA 1G6CA 2C19A 1GOIA 4PMDA 2NLIA 4PO2A 2Y7DA 1KV5A 1ZGDA 5H8MA 3D6NA 1BHGA 2WK2A 3O16A 3S8HA 3B9AA 3PN8A 4QJ3B 3TA6A 4U5IA 5EPDA 2CBVA 1VLIA 1XDMA 2XFRA 3BJSA 3T55A 3ARXA 2J78A 2HDJA 1P6BA 2QHAA 3H4GA 4Q8NA 1KGWA 1NWRA 1XQLA 5BOOA 4K8GA 1DTNA 1GK8A 3WIJA 1TX0A 2XVLA 1Z9AA 2IXVA 2IS7A 3MMWA 3TJXA 4E8CA 3GNNA 2NVCA 1GQLA 4ZQRA 4S2BA 4W7WA 1LQ2A 4GZIA 4DM1A 5A2AA 4YTSA 1YTDA 4GI4A 4DWSC 5T9BG 3GRIA 2FHCA 1PHQA 1QK0A 2GJPA 1GVFA 1JCJA 4H19A 5EKYA 1VBRA 3SO7A 2VOMA 1KB3A 1X7FA 1CBGA 2R1KA 1Q6GA 3TYBA 2VDIA 4LUSA 2QCFA 1N82A 5E0KA 1WXYA 2X42A 2PGRA 3M46A 2QCNA 3IIZA 1B3YA 2DVTA 4JWIA 4OQVA 2WNWA 4HK5A 3ZT6A 2EEXA 1Z48A 1BF6A 3VK5A 3NQCA 2ZZ1A 3PZVA 1YDVA 3HFYA 1A3XA 1T7LA 3A3HA 1JDCA 3CMFA 3FD9A 1Q65A 4Y9NA 1Q7MA 3UFYA 2PBOA 1HKKA 2I7GA 5I02A 1BVZA 3QGKC 1HIZA 1DKXA 1XYFA 1VEMA 5JXQA 1G4EA 3TCSA 3QV7A 1XRSA 3RF9A 3KL3A 1VCFA 3AIBA 3A5FA 1PX8A 4UCFA 7A3HA 5FA5A 3A9BA 3CBWA 4JR5A 1O1ZA 3C3NA 3LLXA 1W0MA 4NZFA 4V1XA 3I04A 2R1MA 3E0VA 4XBSA 3E2QA 1WV2A 3PUDA 4B3ZA 2XUCA 4XVDA 3L0KA 3O3OB 4AIOA 1T99A 4AD0A 4PMJA 4LUTB 4UR8A 4E8DA 3R8GA 3QKEA 2WQDA 2ZUUA 2VELA 3BLOA 3HZ3A 4ERGA 3IGSA 3NVTA 2LXYA 3ZR5A 3UZXA 2A6LA 3B53X 4N42A 4WOQA 5A6AA 1GT8A 2NXGA 4W7UA 5EMMA 3UCCA 4DBUA 5BXSA 1PHWA 3S2JA 4HNCA 2PD5A 4TO8A 3CV7A 3SCNA 2HK0A 1SUFA 1OC5A 3ITTA 3PBMA 1QPQA 1RALA 4QR6A 2H9AA 3VC5A 5FF4A 1X38A 4L1WA 1XKJA 4LVAA 1Q6FA 4BS0A 2V6AA 1JCLA 3B8UA 4Q32A 4NJGA 4OE7A 4QJ4B 3N2OA 2NCZA 4QLJA 2BXVA 4URIA 1BFNA 2J7HA 5AHFA 4MLRA 5GJMA 5FL1A 2PPGA 4LYRA 2BVWA 1OG6A 4M5PA 1RJPA 3WUFA 2QVNA 3RYSA 1P1XA 1E6QM 2ELBA 4RW3A 2OT1A 2HZGA 5FLEX 3V5FA 3GG1A 3AJXA 3LX9A 1V4YA 3ZR6A 3RAOA 1LUCA 3RX2A 2GK1A 2XSBA 2ZZ6A 1DJNA 3H55A 3L3OM 3MZNA 4G56A 3NSNA 3KDOA 1IR2A 1JPMA 2C8NA 3HGOA 4H9YA 1NWTA 1Q6DA 4O15A 3THQA 1ZFJA 3H7UA 1AJ2A 3DYMA 1KRBC 3OPSA 4UMCA 3B0UX 4JHZA 5D2YA 4AVMA 3G22A 3LPOA 3GW0A 3HQOA 2YW4A 2OZ0A 3BG3A 2YL9A 4IPIA 3EWBX 4NAFB 5XIMA 3V4BA 4YVVA 4F0RA 1R34A 1KXQA 2OZ3A 2YCLB 3M5VA 1EJSC 1EP2A 1YYAA 4PUJA 3NL2A 3DZ1A 4GXWA 3C6CA 2OW6A 1ZBKA 1S5NA 4MJMA 1E1CB 3KDNA 1NY1A 3DKLA 5JMUA 4KT2A 5A95A 2ZUSA 2D20A 2V82A 4I6VA 4QISA 4JLCA 3UWQA 3FAXA 5I6SA 3PZNA 4ZQOA 1TA3B 2X41A 1UKOA 1V7YA 3NPWA 1B2YA 2E0PA 2PTXA 4QLKA 4V33A 3VNDA 2PGEA 3DN5A 5EA9A 2VJXA 3QPZA 3BARA 5AVHA 3MBFA 1W31A 1XSJA 1XIEA 5C54A 4O10A 2CESA 4NZ1A 3ITYA 4AWUA 4GZEA 3V3WA 3DH7A 3GHSA 2DZVA 3T8QA 5E84A 4MKSA 4GRSA 4IM2A 5D9PA 1IQ8A 4EX4A 1OADA 1PKLA 2VNCA 3LHYA 3DERA 2Z25A 1YBQB 3AYVA 1UZ4A 5DQPA 3NDYA 3W02A 1E56A 4GY0A 3WNKA 4J28A 1MQPA 2OCZA 1DYSA 1QNPA 3R58A 1XSKA 5A2BA 5EGRA 5K4XA 3F4DA 3L2LA 2Q01A 2EJ1A 2VGGA 4AHOA 4LC6A 2ZFAA 3GFXA 3H7RA 4TVDA 3PANA 4F0KA 1VP5A 1BQGA 2F6KA 4K2SA 1EL3A 3G77A 3ABOA 5DMLA 1JYVA 3M7WA 5HBFA 5ABFA 4FO4A 4P7QA 4G6CA 3MP5A 4JBRA 3GBEA 4P7NA 2Z0IA 1WPCA 5HANA 3PZUA 1IT8A 4ZQPA 1OA1A 1E3ZA 3I4KA 1XYZA 4TX8A 3FSTA 2WJDA 3BV7A 3VNJA 1QWGA 3WMLA 4C6PA 1PTDA 3CM4A 2BDQA 4LUJA 4IGNA 4S3BA 4GC4A 3G8RA 5AC7A 3T8LA 3AMLA 4BF9A 1R3VA 4FAMA 4WJEA 1MZRA 4J3TA 4DBEA 3M0KA 8TIMA 2J24A 4GHRA 4UQAA 1MXGA 4OOUA 3TROA 4N4PA 2QUMA 2HVOA 3A4JA 5GNXA 2CZVA 4MY9A 3UYIA 2FZBA 1DWAM 5IOBA 1H7WA 3UY8A 1JXKA 1REQB 3W1MA 2CPUA 5AC6A 1OYBA 3C2VA 2FVLA 1A3WA 4IXHA 2B4GA 3I3DA 2OZ8A 4D8AA 1JDAA 1KCLA 2D73A 3BL3A 2CZDA 2X0SA 3R8HA 5DMMA 3NQ7A 4Q6JA 3SZ8A 3LPPA 4WCJA 4B9ZA 2CZFA 4KIKB 1XLFA 3BANA 1OX4A 3TTEA 3W28A 2PMQA 5CPSA 3M0YA 1BXBA 1DJWA 4XK2A 3LOTA 2EO7A 4C6CA 3PG9A 2F18A 2F9RA 5GNZA 1F3XA 3UPBA 3P2VA 3TAOA 1EO7A 3OYZA 3RG6A 1XCXA 3RN6A 2WC3A 3GM8A 4JKMA 1UD8A 1JDDA 4GLEA 4MVAA 3ARWA 3PJWA 1J93A 3LSBA 5FIPA 3VEAA 1WKYA 2Q13A 3TAKA 2ISFA 2I5GA 1V6UA 4NF7A 2A7PA 5EMKA 2XSXA 4NX5A 1Y2OA 3W88A 2EXOA 2EPHA 3HIJA 2PDFA 3DCPA 3LTSA 1J0JA 3W00A 3TW6A 2XGBA 1NF7A 1TQWA 2ZVRA 4C7FA 2PCQA 4I7UA 3AXMA 3VPLA 3T81A 4HR1B 1JCTA 4N9BA 3GR8A 3TTOA 3N18A 4JTAA 1M03A 1MW1A 3C0SA 1DJQA 5FF3A 3S5SA 3TTSA 4L1GA 2VQUA 1DQXA 3L4XA 5M17A 1Z3NA 1ME9A 2F38A 5C5BB 3L0NA 1XL9A 2JKPA 3MSRA 1OFBA 3H2MA 4QXIA 4DJDC 5F7UA 3RUBL 1ZJHA 1SU8A 3W6LA 2E6FA 3RMJA 4L5ZA 3AS0A 2X2GA 4LEFA 4N6EA 1KBIA 5K9XA 4XTDA 3KRUA 1EYWA 4LCSA 3UA4A 1SZRA 2WZHA 3PZIA 5HWNA 3D5HA 4BWLC 5A6LA 1UD3A 4QS5A 1SO3A 6XIMA 2GUBA 4G1NA 1H7NA 4IOTA 2D0FA 5BCAA 1XKYA 4JL1A 4JTHA 4E3VA 1AL7A 1IEVA 3CL7A 1AVAA 3V75A 2J74A 3ZJ7A 3LSCA 4D1IA 4CU7A 2FVMA 5JQ9A 1JXJA 3QV8A 3P5ZA 3IAQA 4IJBA 4EF8A 4W84A 1E0XA 3E0LA 4AHPA 1FTXA 3W1PA 2XVPA 4FHAA 4O50A 4KWWA 4WDTA