2YLLA

Inhibition of the pneumococcal virulence factor strh and molecular insights into n-glycan recognition and hydrolysis
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
436
structure length
436
Chain Sequence
AMNEKLAKKKIVSIDAGRKYFSPEQLKEIIDKAKHYGYTDLHLLVGNDGLRFMLDDMSITANGKTYASDDVKRAIEKGTNDYYNDPNGNHLTESQMTDLINYAKDKGIGLIPTVNSPGHMDAILNAMKELGIQNPNFSYFGKKSARTVDLDNEQAVAFTKALIDKYAAYFAKKTEIFNIGLDEYANDATDAKGWSVLQADKYYPNEGYPVKGYEKFIAYANDLARIVKSHGLKPMAFNDGIYYNSDTSFGSFDKDIIVSMWTGGWGGYDVASSKLLAEKGHQILNTNDAWYYVLGRNADGQGWYNLDQGLNGIKNTPITSVPKTEGADIPIIGGMVAAWADTPSARYSPSRLFKLMRHFANANAEYFAADYESAEQALNEVPKDLNRYTAESVTAVKEAEKAIRSLDSNLSRAQQDTIDQAIAKLQETVNNLTLTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibition of the Pneumococcal Virulence Factor Strh and Molecular Insights Into N-Glycan Recognition and Hydrolysis.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
molecule keywords BETA-N-ACETYLHEXOSAMINIDASE
total genus 175
structure length 436
sequence length 436
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2011-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.90 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 AF1782-like 2yllA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2yllA01
1UH3A 5A6BD 3L2LA 1JFXA 3NSMA 5C71A 3GXIA 4NRSA 3MSDA 1BQCA 1XHGA 2XJ7A 1NH6A 3QHOA 2OZNB 3W25A 1KQYA 2Y8KA 2VVSA 1KQZA 1B3YA 1LG2A 2PBGA 4AEEA 2WVVB 4AZIA 1HN1A 3K8LA 2WC4A 1ISWA 1UH2A 2XSBA 3VU2A 3WQ4A 1OB0A 3ZIZA 3VM5A 4AZGA 2D20A 3IAPA 1XD0A 4JKKA 4QAWA 2OSYA 2D0FA 2CBVA 2NT0A 3BCFA 1H49A 3MV01 2ZX5A 3IANA 2PWHA 4MPKA 4TVUA 3SUTA 4LQ1A 3VMNA 3PZ9A 5CJ5A 3I3BA 3E1F1 4MNJA 3ZSTA 2ZUNA 3VIHA 3DHUA 1DWFM 3VX0A 1HT6A 4PCTA 2E9LA 1TVPA 3A47A 4A4AA 3QHNA 2OWCA 4ML4A 5CLTA 1MFVA 5CLWA 1JXKA 2B31A 5EFFA 2O9RA 1OD8A 4CCEA 5CSYA 3WQ6A 4DWSB 5E0FA 4LYPA 4TUFA 2VI0A 1XH2A 2YIHA 4W8AA 3VKKA 3VOCA 1EA9C 1XYFA 6A3HA 4DM2A 5BWFA 5D9NA 2C0HA 1XYZA 4DUWA 3PBGA 1W9DM 2BVTA 3M07A 1R86A 1ZBWA 4BA0A 1OGBA 2WMHA 2WSPA 1V0KA 1UKQA 2ZUSA 1OM0A 3GDBA 1B2YA 1ECEA 1LL7A 3UG5A 3EDFA 1OGSA 3POCA 4UTFA 5A2CA 1UD6A 3SCOA 1MFUA 1ZB5A 2PWEA 5A8OA 2RGMA 4PTMA 4E2OA 1C3FA 1JYNA 3WQWA 4U3AA 2VZUA 1PIFA 2UY3A 4OBRA 2GVYA 4FLQA 4AIUA 1OINA 1NWRA 4EKJA 4J3WA 4D1IA 3WENA 2DT1A 3AHVA 2WM0A 3AXXA 3VIGA 2WPGA 2VX7A 2YJQA 3RM4A 4R27A 1QI0A 1WZLA 1BFNA 2CBIA 2VCBA 1OBAA 4M82A 3TONA 1J9YA 2EPNA 4F79A 1QOXA 1CECA 2PWGA 2Y2WA 3ARYA 4D72A 5E9AA 3LPPA 1TR1A 2EPKX 2JE8A 1TA3A 1JZ8A 2UWFA 1MWOA 4PMDA 4FK9A 3CZEA 1B3ZA 1WPCA 5I24A 4UNIA 4MTVA 4W7VA 2VQTA 2MANA 1GPFA 3W26A 4PTVA 5I2UA 2IXUA 2YKKA 1E6RA 4AIOA 3ARRA 2XIIA 1QW8A 2W66A 1QNQA 3S2CA 3VGBA 4U5KA 2E8YA 3KL5A 5A6SA 1CGTA 2QLYA 4Z2JA 4CN6A 3DYPA 3WQ8A 1LG1A 3U57A 1M04A 1DEDA 1W3JA 1VAHA 3ZJ8A 4B16A 3W24A 1H2JA 1CGXA 3AZSA 1B1YA 1MXDA 2QPSA 1OCQA 1XSJA 1UWRA 2GJPA 2F2HA 4PMQA 1C8QA 1HJVA 3BSHA 2J77A 1XD1A 2D3LA 4UQBA 3WF1A 2WVTA 1H0GA 3BMVA 1ESWA 1EQCA 2WAGA 1EGZA 3OIHA 2XFFA 1E4NA 1KBKA 1EDTA 3RO8A 4KRTA 1L0PA 4HA4A 5BXTA 1EH9A 1HX0A 1E71M 3TP4A 1UG6A 4GI8A 1E5NA 2Q8XA 1HF6A 3WH6A 4JFWA 3ZT6A 3NSNA 4MB3A 4XB3A 3VINA 2FH6A 1UR0A 3AS0A 3W37A 3DYMA 3N18A 3ALFA 1E6PA 1WP6A 1QI5A 2Y24A 2E4TA 1CGVA 1FH9A 3AOFA 3T08A 2V3GA 1EO7A 3AHZA 2J74A 4LYQA 5GQBA 4LXFA 1E4MM 3VGHA 1EQPA 4GIAA 3RMEA 3WBAA 3VIIA 1CIUA 2DQXA 3VO0A 3GTNA 4P8XA 1JYWA 1QHPA 1ISXA 5FCZA 4DWSA 3ARSA 1J10A 4Z2IA 1O7AA 3CTTA 2CPUA 4ZEPA 2IXVA 4AZBA 1JXJA 1JDCA 2D3NA 1FFRA 1J01A 3T2PA 2VUYA 1E6ZA 2UY4A 3QR3A 2EO7A 4Q7NA 1UR1A 1VF8A 3WD1A 4XV0A 3U5YA 3WD2A 5A95A 3WD4A 1E0VA 1BAGA 5ABGA 1JFHA 2Y5EA 1W9UA 1ODZA 1Q6GA 3BH4A 1SFSA 1GHRA 3GBDA 2J47A 1BLIA 1JZ2A 3QOMA 1OIMA 2ZXAA 1VFUA 3N15A 2DSVA 2VZVA 4OKDA 4QFUA 1GJUA 4TVCA 3NCOA 5FIPA 3U5UA 1E0XA 1TVNA 1GOOA 2CNCA 3SCPA 2GK1B 3EMCA 1NQ6A 2XWDA 2X2YA 4KGJA 4U5IA 4J3UA 5CSUA 1JD9A 2J4GA 4FF5A 1DWJM 1E6NA 1KXQA 4MNLA 1JGIA 2CIPA 3AQUA 3L4XA 1WDRA 4TOQA 4D6DA 1GOKA 1BF2A 4ZE5A 1UR9A 4MJ2A 4N0RA 5A2BA 1GW1A 3VGGA 3AMKA 1UA7A 2QMKA 1GCYA 5AYIA 4N42A 1K9EA 5A6LA 5E6YA 5I78A 1CXLA 2ZUMA 1GZJA 2E3ZA 3VILA 3WEMA 1RH9A 1BG9A 1EHNA 3ARZA 3WUGA 3BAYA 2YDRA 2XFYA 5I23A 3MUZ1 1MVYA 4XZWA 2J7BA 4WLCA 3RIKA 3AYRA 1XCXA 1X1NA 3ARXA 2A3HA 7A3HA 4WSJA 4W7UA 4PMNA 3AISA 4NZCA 5GNYA 2VR4A 3W29A 2DSKA 4CU8A 4AMCA 2FGZA 1LL4A 4BQ3A 3ALGA 2G8ZA 4AD4A 2ZOXA 1GJWA 2XFRA 1TG7A 1V3KA 4U3CA 5IFPA 2WSKA 1FA2A 4W84A 2X0HA 1VEOA 5CPTA 4AZHA 1GORA 4HA3A 3W6MA 2XGBA 1ZS2A 2YDQA 1CXKA 1UR2A 8CGTA 4S3JA 3WQVA 4BZYA 5A94A 2ZX8A 1V03A 2WB5A 4QLLA 4MNKA 4HOXA 2EEXA 2FGLA 3CZJA 1SR0A 9CGTA 2DSUA 1ZBCA 4PUEA 4EANA 4JAWA 4AD3A 3NIYA 2BY0A 1W1VA 4PMUA 4A3HA 3O2LA 1UQYA 4HA1A 4H41A 3VDCA 1TZ7A 5CXPA 3J7HA 3CMJA 2V3DA 3LPGA 2OWWA 2A3AA 3PZQA 4UQEA 3ZT5A 1XGZA 3MV11 2VC9A 4JFVA 2WNWA 1GOIA 4J3VA 4S3KA 1VBUA 4QP0A 1J0JA 3SCNA 1W91A 1UYQA 1IV8A 1KR1A 2AAAA 2BVDA 2V38A 3QGVA 1WKYA 1Q6FA 1GQKA 3WF2A 3OGRA 3ZM8A 3CGTA 2BXZA 1B3XA 2XM1A 1G0CA 3A4XA 1E3XA 6TAAA 3EBVA 4W87A 4CKQA 2WHLA 4C7GA 4R5EA 2CHOA 1ZJAA 3WDRA 3L4ZA 3GYCA 2JIWA 3WF3A 2ZXQA 4GZJA 2BV9A 4MDOA 1B3VA 3ECQA 2AOSA 4GQRA 4PN2A 1MW1A 4H8HA 4PCSA 3ZSSA 3T0BA 2E40A 2VURA 4L4OA 2C8NA 4W5UA 3GH5A 3RILA 3VDAA 3SEPA 1BGAA 1QVBA 3OG2A 1Z32X 1PJ9A 3GZAA 3WL0A 1V02A 2E0PA 1FP8A 1UD2A 2QPUA 1JZ6A 1G5AA 4H2CA 5I77A 4W85A 1KR0A 3MUAA 2FHCA 2DSZA 2XWEA 3MANA 1W9XA 2GJXA 3EYPA 3IJ9A 1KXTA 1CGWA 3ARTA 5EMYA 1G9HA 1UR8A 3AHYA 2CHNA 3SIMA 3SCSA 4E4PA 1RPKA 3JUGA 5HDRA 2O9TA 2JALA 4PMXA 1W3LA 1SMDA 1W32A 2WZIA 5FL0A 2CETA 3VIKA 4GI6A 1V02E 1MQQA 3RCNA 3FHQA 3PN8A 1BG4A 4UFMA 4M81A 4ACYA 1ZL1A 4J27A 2V5DA 1VIWA 3II1A 1GVIA 4OOUA 2G4FA 3WUBA 5FL1A 5E6ZA 2VNCA 3SUVA 3CUFA 3CHCA 2ESCA 4ZXLA 3W28A 1ZJBA 1VJZA 2WLZA 3IJ7A 3CUHA 1UWQA 1D2KA 4HOWA 3AYSA 1S46A 4OBSA 1B0IA 3PHAA 1HXJA 1CZ1A 5DFAA 4AEFA 4HOZA 5LA1A 2V3EA 2GUYA 2YA2A 4HZ8A 4HP5A 4IISA 3AROA 1C92A 3T2QA 2JF7A 3LMYA 7TAAA 1IZKA 1W1TA 3AMDA 1H3GA 3BXWA 3L2MA 2J7GA 4D6CA 3VTRA 1E9LA 2CKSA 2YLAA 3A4AA 3MUIA 3AS1A 1W3HA 2J79A 3M6DA 2VTFA 2A3BA 4EE9A 3TTYA 4JFSA 3MMWA 4Y7EA 1CEOA 4HPHA 3HMCA 4HMDA 4ATDA 2YOCA 2J7DA 2BNJA 3BCDA 4UQ9A 4FZOA 3NDYA 4PMZA 4AD5A 2PBOA 2J7FA 1CGYA 5BRQA 3FAWA 4JL1A 2GFTA 2WANA 4AIEA 4UCFA 1ODUA 1QNPA 4J3TA 4WIWA 3FXYA 3VMPA 1NOWA 2WMJA 2ZWYA 4CD4A 1RD6A 1GOMA 4OIFA 4IUGA 2VR5A 3ARWA 2FHFA 2VRQA 3NYDA 1E70M 4Z2KA 1MW3A 2PI6A 4WKHA 1WE5A 4U31A 1WAWA 4JFTA 3WNOA 2J78A 1VEPA 1J0KA 1N82A 5GNXA 1QNOA 3AMCA 3AIVA 5AC5A 4AY1A 4E8CA 4WF7A 5A2AA 1UA3A 5D9PA 3IJ8A 4W86A 1JDDA 4YN5A 3VDHA 3GH7A 1C7TA 1WDSA 2VO5A 1U33A 4QLKA 2WMKA 1E6XM 1KWGA 3WUFA 1HL9A 3WSUA 3KE0A 1J0ZA 4PSRA 4UOQA 1GNXA 3WEOA 1UD5A 2EBNA 2DSWA 4D71A 1HJWA 1ZBVA 2E9MA 2X05A 3BLKA 5A8PA 1V0LA 4PRWA 3AFBA 3ZR5A 3RPMA 1DP0A 1ISZA 5A6JA 1HNYA 4QCEA 3SUSA 2VX4A 2DEPA 3CUJA 4JIEA 1UOKA 4H8UA 1SYTA 2Y4SA 2VCAA 1B3WA 1JD7A 1KGWA 1H41A 3PZGA 2J75A 2J7CA 2W92A 2V3FA 1KGUA 2XUCA 4FLSA 3L4WA 1QI3A 2BFGA 4JKMA 4UQAA 2WCAA 2FHBA 1RP9A 1C8XA 1KFWA 3RDKA 3VIPA 1JI1A 4PYSA 3VUPA 1EXPA 3GXDA 5A8NA 2HVMA 2YL9A 1WZAA 3AIBA 4WK9A 1JF5A 3ARVA 4X9YA 2EJ1A 2X8RA 1M53A 1JL8A 4CU6A 4MNMA 2W91A 3K1DA 5I79A 4JKLA 2YBTA 4ZXOA 2BHYA 1G1YA 2WKLA 1M03A 5LA2A 3AI0A 3BMWA 3FAXA 5A6AA 3WEZA 3AHTA 3KL3A 5JIPA 4QLJA 2JFEX 3DECA 4PMVA 2ZUUA 1ITCA 1LF1A 4P7NA 2W62A 4RE3A 3UCQA 3MSGA 1MQRA 1XSIA 3VGEA 4EAMA 3AXHA 4UFKA 1TUXA 1KXHA 4H7VA 1JYXA 4AISA 3WMSA 1V0NA 2ZXBA 3WF4A 4D6FA 4XX6A 2DGAA 4X0VA 4CGTA 3FN9A 1C91A 1NWSA 1OWQA 2WMIB 2XGIA 4P7QA 1V6YA 1QNRA 1OT2A 4PTWA 4WSKA 2DH3A 4AZCB 1A3HA 1JIBA 5E70A 2WCSA 4YPJA 4F66A 3QHMA 1V3HA 2NSXA 1QHOA 3WDJA 5CG0A 2YL6A 2XPKA 4AD1A 2W5FA 2J25A 2JEPA 3VNZA 3DYOA 1E4IA 3LPOA 4CCDA 1CTNA 3UEQA 5JIWA 5E09A 3POHA 4BQ5A 5D4YA 2CERA 1US2A 1FHLA 3WKZA 1E1EA 3WH7A 1HP4A 2VJXA 3T0DA 5M17A 1DTUA 4M29A 4RE2A 4F8XA 5EFDA 3W27A 2CEQA 5GPRA 2CXGA 1R8LA 1W9VA 2XHYA 3PZOA 3OGSA 4GO9A 4UR9A 5D8ZA 5JBEA 1AQMA 2GDUA 4NRRA 1VFMA 4UZUA 2ZIDA 1I1XA 1UKPA 5I0DA 1H09A 1UKSA 1BYDA 3WNLA 3GNOA 1GONA 4KRUA 5BXPA 1Q6EA 1E1FA 1NWUA 4HTYA 1HKJA 5HOSA 1UH4A 4D6HA 3OBAA 1AQHA 3AICA 2ZXDA 4HMEA 4AZCA 4M56A 4MDPA 3ZO9A 2G3IA 1KB3A 2G3JA 3HN3A 1UUQA 1H1NA 1CLVA 1DWHM 3CO4A 4U2ZA 1JNDA 3HU7A 3CMGA 1R85A 2D0GA 1D7FA 1X6LA 1OSEA 3CPUA 4NI3A 3VVGA 4AD2A 3AZTA 1W2VA 3OA5A 4PBGA 3RM9A 1BYAA 2JNKA 1B30A 1OT1A 1KCKA 3WBEA 3BAKA 2VOTA 4DWSC 3T0AA 3NSXA 5BXRA 3G6MA 5M03A 4V27A 4ZE4A 3AIRA 4CN1A 3W0KA 5ABEA 3AMLA 3UETA 1CYGA 3TTOA 3B9DA 1KXVA 3BAWA 1NWTA 4DWSD 1XSKA 4B9ZA 4PUDA 2VQUA 3AMGA 4TXEA 4AW7A 3A6OA 3KZSA 3PTKA 1PEZA 2D1ZA 4TVDA 1BPLB 5CPSA 3MO4A 5DT7A 3KWXA 1ZBKA 3HJEA 3K8MA 3RM8A 2AMGA 2DH2A 2IUZA 5DT5A 5JBDA 4P8VA 3W81A 3ARPA 3AIEA 1NP2A 1UHVA 2WHJA 2XIBA 4KMQA 4ATWA 1C90A 1WDPA 1XV8A 1KWKA 3UR7A 4HMCA 3GBEA 5DEZA 2V5CA 4FLRA 4W8LA 1E40A 3OLEA 4JHOA 3ZT7A 2W63A 4CU7A 4PMRA 4UOZA 1QBAA 6CGTA 3W82A 2BVYA 3DHPA 5I6SA 2WCGA 4HZ7A 4D1JA 1I75A 3WNMA 1LQ0A 2OWXA 3F5KA 1WZKA 3VD5A 1FOBA 4AWEA 2OYMA 3EMQA 3N1AA 1C93A 5TD4A 2VT0A 3WDQA 4Z2HA 4ZENA 4UFIA 3L4TA 2A3EA 1CENA 1VBRA 4XZBA 3ZJKA 4FZPA 4L4PA 2D2OA 1WO2A 1U30A 3K8KA 1C7SA 3L4VA 1PX4A 3VPLA 4IM4A 5I3DA 1JZ3A 2BXYA 4FMVA 1J11A 1UWUA 3WFLA 1J0YA 3WL1A 2YDSA 3K4AA 4V28A 3WD3A 1GOWA 1US3A 1XCWA 5KZ6A 1M01A 1HKKA 4RE4A 1V6WA 1UWIA 3CHDA 2XVNA 3SCTA 3F4VA 3WDHA 1UD8A 1VRXA 2WBGA 3PZIA 2D24A 1U2YA 2HISA 1AVAA 1NP0A 4U2YA 1QI4A 5ABFB 5IHSA 5HXMA 1MXGA 1VFOA 3N13A 4ATLA 2D22A 4B3LA 4UFJA 2W61A 1E43A 1Q4NX 4B9YA 4H04A 4C7DA 3WFZA 3M7SA 4D6GA 3OB8A 3VIMA 2DT3A 2VCCA 1JZ5A 3ZJ7A 1PIGA 1DHKA 3GNPA 4M1RA 5HNNA 1CPUA 1L8NA 3O6AA 3CHEA 1ITXA 2DDXA 2WMFA 3PZVA 4UQCA 2NT1A 5BCAA 4GZIA 4OUEA 4AC1X 4UQDA 2XVPA 3SUWA 1C8YA 1JG9A 2WC7A 2ZX9A 4X0NA 1CGUA 4GQQA 3W4RA 2PWFA 3SCUA 4DUXA 2W67A 5D9MA 1XC6A 3UG3A 2UY2A 3CIVA 4D6EA 2EXOA 5FOOA 1H4PA 3VIOA 5CPQA 1LLOA 1D3CA 1WCGA 5LA0A 3MKKA 5BRPA 2GJRA 3KEHA 4CN4A 1B31A 1JNEA 3W53A 1XH0A 2YLLA 5HPCA 2WWCA 2BY3A 1H0IA 2WMIA 2DIJA 1YQ2A 2XG9A 3CZKA 1FHDA 4LGXA 4E8DA 1UKOA 2O92A 3N04A 3MS8A 3OLGA 3PZNA 1E4LA 3VDBA 3A3HA 1GOQA 5FD0A 4QCFA 4M80A 1CLXA 1OGGA 1UZ1A 1J18A 2OLHA 4A3YA 4OZOA 4W93A 4F9JA 3L4YA 3AS2A 3UG4A 3KL0A 2ZICA 3EMZA 4HPGA 4LPCA 1TA3B 1BVNP 3WH9A 3EDJA 4B15A 5JUVA 4M24A 1W9BM 3CH9A 3GM8A 3THCA 2X09A 1W3KA 2CYGA 3T2OA 5GNZA 1CXEA 3TOPA 2OSWA 1KCLA 3PZTA 1CNVA 4RL3A 1NM9A 1V08A 2OO2A 3APGA 2GK1A 1AMYA 1MYRA 1RP8A 4UOJA 2XYLA 5DO8A 2YBUA 1EIBA 4Z2GA 3F5LA 1A47A 5KEZA 4TTUA 3T09A 4P8UA 2WZEA 1JI2A 2WW5A 5M5DA 5A69A 3B8SA 3OGVA 1QBBA 5M3WA 2OSXA 4M8UA 1HVQA 5BYWA 3BC9A 4UZSA 4CD6A 4MB5A 5A8MA 1MQPA 3I3DA 5A6BA 2XTKA 3F5JA 1UWSA 3VD4A 2EPMX 5CGMA 2VZOA 4W89A 2WVUA 2QMJA 3K4DA 1MW0A 4AZ7A 1HL8A 3CZLA 1WZMA 2Y8VA 3EDEA 1E15A 1V6UA 2XVLA 5HPOA 2G3MA 3CZGA 5BXSA 3UR8A 2D23A 1ISVA 3WF0A 2NW0A 3PTMA 1QHZA 2DT0A 1UQZA 5FKYA 1EOKA 5E0CA 1FP9A 4J28A 4MAVA 1JZ4A 1K9DA 3N17A 3N9KA 1HJXA 5ABFA 1E0WA 1HVXA 4TX8A 1TFVA 1UD3A 2CKRA 4WKFA 2PC8A 4AD0A 2J8FA 3WH5A 1PBGA 3NUKA 1MW2A 2YL8A 3TA9A 2GJXB 1QNSA 1E3ZA 4H8VA 2WVSA 1X6NA 3SCWA 2WXDM 1J12A 5A6KA 1KBBA 5BROA 4MB4A 4URIA 4J3SA 1F4AA 3PZMA 2XM2A 5DMYA 2J7EA 4PMYA 4CCCA 4Z2LA 1DWAM 4JCMA 3WELA 5JBFA 2F61A 1FH7A 3W38A 3VX1A 2EPLX 4TTGA 2VL4A 5HBFA 5CQ1A 5I5RA 4W5ZA 3BAIA 2DT2A 2O9OA 5C70A 2X0YA 2PWDA 1BYCA 1GHSA 1VFFA 5F7UA 3D3AA 5C8BB 3CHFA 2RGLA 4K68A 1W2PA 4NSBA 3WNNA 4GINA 1FH8A 1WNOA 4MAZA 5ECUA 1JAKA 2XVGA 3SUUA 5LYRA 4HU8A 4W88A 1PAMA 3K46A 2BHZA 2BY1A 1VEMA 1HJUA 2J62A 4BCEA 3U7BA 3PTQA 4GO8A 5A8QA 2ZUTA 2OYKA 4GXPA 1J0HA 3GXMA 4CVWA 3VD7A 5ABHA 3OLIA 4BS0A 2WHKA 4BF7A 4WKAA 1YHTA 3VIJA 2QF8A 3B9EA 3ARQA 4P8WA 2JF6A 3ZMRA 4CVUA 1E6SM 3AZRA 1Y7VA 2CBUA 3BGAA 3U7VA 4KWUA 2WYSA 3M46A 2JEQA 4GI9A 1WB0A 4F9DA 3MUY1 2YA1A 1R87A 2WBKA 1LJYA 2BS9A 5AC4A 1BVZA 1NARA 3WH8A 3EDDA 2J8GA 1E6QM 2VZSA 5IXEA 1V6VA 1OD0A 2XVKA 2E9BA 3IK2A 4NF7A 2Z1SA 3GXFA 3RJXA 1M7XA 4WJXA 1FFQA 1OIFA 3GH4A 1V3IA 3VIFA 4UFLA 2PMRA 3WY1A 7CGTA 4PMOA 4W7WA 3VMOA 1LWJA 1JDAA 4YHEA 3AXIA 1R7AA 1NOUA 1P6WA 3WIJA 3BLPX 3VD3A 3NDZA 4D6JA 5CZKA 2WVVA 1WDQA 4AZ5A 1E56A 3D5HA 4JFUA 1HJQA 4C7FA 4GPNA 1QW9A 3AS3A 3CBWA 3ZJ6A 3VNYA 2GDVA 4TX6A 2WZHA 4LX4A 1GVYA 5EB8A 4PEEA 1EDQA 2VZTA 1DWGM 2WWDA 1TMQA 1EOMA 1GQLA 3WDIA 4P7OA 1V3MA 2QHAA 3CZ8A 1TE1A 4IPNB 1V6XA 3OLDA 3L4UA 4P7LA 5A6MA 1ZU8A 4Q22A 1BHGA 1BYBA 2CBJA 4P7RA 2YL5A 3FNDA 2D0HA 4B3KA 2PF0A 4JHZA 4DM1A 5EBAA 2WLYA 4FLOA 3WQ5A 1R7OA 2VX5A 3BSGA 3EDKA 1V0MA 1J0IA 4MJ4A 8A3HA 2ZE0A 4MB1A 2VMFA 1SMAA 3VD9A 2A3CA 4W8BA 1UZ4A 2WC3A 4JL2A 4KGLA 2ZUVA 1B9ZA 4PTXA 1E5JA 1GQIA 1JF6A 4D6IA 4CD7A 3N11A 3FY1A 3VGFA 3I3EA 1AQ0A 1LWHA 1EHAA 2XSAA 1Q6CA 3WNPA 1VJSA 3G6LA 3OZOA 4LYRA 4HZ6A 4JZ5A 1XRVA 2ZWZA 3MMDA 1CWYA 3B9AA 3IAQA 1GUVA 3AJ7A 4YHGA 1DWIM 4QDMA 1CBGA 3WNKA 2WMGA 1JAEA 2CCRA 2JIEA 2CITA 3WMCA 1K9TA 1XH1A 1PX8A 2O9PA 1PZ2A 2ZX7A 5AY7A 1PX3A 2C7FA 3BAJA 4PSPA 4OJYA 4DUVA 2EPOA 1UR4A 1VB9A 2PB1A 4JCLA 2ZUWA 2VX6A 4V2XA 1PPIA 4J3XA 3SCVA 3ZQ9A 3AIWA 3FW6A 3VM7A 5IHRA 3SCQA 3VGDA 1W1PA 1G01A 2TAAA 2EQDA 3CUIA 1Q6DA 1CXFA 2Z1KA 1E72M 3GNRA 1CDGA 2YA0A 1HKIA 2DPEA 2UY5A 1PZ3A 3FHAA 5A1AA 3WDPP 4BQ4A 5CGTA 1CXHA 3THDA 1H11A 4UFHA 2WHMA 3SURA 4MADA 3ZOAA 2OYLA 1E55A 3BAXA 3MMUA 1HJSA 4CD5A 2VRJA 1EO5A 2DIEA 1BTCA 2QV4A 1I1WA 2X1IA 2BY2A 4IPLA 2ZX6A 1E73M 4BQ2A 3ARUA 1K9FA 4XUYA 4ZFMA 1F4HA 1QI2A 4OOZA 1JZ7A 1IZJA 3AHXA 3N12A 1VENA 4AXNA 1JYVA 2CESA 1UWTA 3RJYA 4GZEA 1O6IA 1G94A 3DC0A 3CLWA 3TTQA 3W6LA 3WMBA 4AYSA 4EK7A 3AIUA 1V3LA 1W9PA 4ACZB 1UKTA 4ACZA 3TTSA 4HU0A 1HKMA 3PZUA 3OZPA 1QPKA 2J7HA 1BSIA 3ZR6A 4U33A 2G41A 5A3HA 2F8QA 1ISYA 1UD4A 1V3JA 3SCRA 2VVNA 4J7RA 3UESA 4AZ6A 3WN6A 1EDGA 3CUGA 2G3NA 3O9NA 1HP5A 1W1YA 4KH2A 1HIZA 1K6AA 5AYBA 1KGXA 1IT0A 2W4XA 3MU7A 2BHUA 1CXIA 3WD0A 5D8WA 2GSJA 3NJ3A 1TCMA 2WK2A 1NOFA 1LL6A 1H5VA 3S6TA 1GQJA 1B90A 3AIQA 5DF0A 4CUCA 5IFTA 4CD8A 2FH8A 2FDMA 3UERA 3LPFA 3WUEA 5D9OA 1BGGA 2WKGA 3A4WA 2E8ZA 3QOKA 5IDIA 2VRKA 4GKLA
chains in the Genus database with same CATH superfamily
1UBSA 2PGWA 2PDFA 1E1DA 2XJ7A 1NH6A 4KIRA 2HS8A 3W25A 1KQYA 2Y8KA 4NXKA 4F0RA 2VFHA 4AFYA 2WVVB 4M7SA 3WQ4A 1OB0A 2OFJA 3LCXA 4PB3A 4H6IA 4JWIA 1XD0A 4JKKA 4JIPA 3DFTA 2D0FA 2CBVA 3CV1A 5U7SA 3BURA 2ZX5A 3SUTA 3PZ9A 3I3BA 4GVGA 2ZUNA 3VIHA 2ZZ4A 3DHUA 4RDZA 1HT6A 4UDYX 2PCQA 3NM3A 2YPIA 4A4AA 3IGXA 3N6QA 2PDGA 3SY1A 5SWUA 3QHNA 2C19A 1JXKA 5EFFA 2O9RA 4CCEA 3DG7A 3WJYA 4EXQA 5IOBA 3WQEA 3R13A 5E0FA 4TUFA 3T55A 5HMEA 1Q63A 3R5EA 3TC3A 3W1MA 2V69A 2VI0A 2RUSA 4ROPA 3H21A 4LAKA 1X04A 4DM2A 4AF0B 1F73A 3LGEA 3C8FA 1W9DM 1KNWA 3PG8A 2BVTA 3I65A 1P7TA 4BA0A 5FEWA 2GOKA 1P43A 3WK1A 1EJUC 1FHVA 1MSSA 1ZAJA 5LIYX 2ZUSA 3O16A 3G22A 1XLKA 2ZZ1A 4IM3A 1Z41A 2FLIA 4UTFA 4O53A 4L6OA 3SCOA 1MFUA 3RYSA 1D8CA 1DJYA 1JYNA 3WQWA 3T46A 4Q8QA 3D50A 3TW7A 4OBRA 4FX6M 4EKJA 3IIZA 5CZJA 2PDHA 1VS1A 3CQJA 2ZTJA 1R47A 4X60A 5C7VA 5G4HC 2QXLA 4IGMA 4E2BA 1WZLA 1BFNA 2YDAA 3F2BA 1J9YA 5G2IA 2VP8A 2PGEA 2PWGA 2Y2WA 3GYEA 1POKA 1TR1A 3LPPA 1T0OA 2EPKX 1TA3A 1JZ8A 5REQA 3S0CA 2OODA 3UW6A 4QJ3B 3CZEA 1JCXA 1MDRA 3UXAA 3QTPA 3NQ6A 1GPFA 2AL2A 4PTVA 3W26A 2G5WA 1WKFA 3P5ZA 2YKKA 4R33A 2DZAA 4DBEA 3GHRA 3MO7A 4XSMA 3GUWA 3VZXA 5CC7A 2WOQA 1FWRA 5JXQA 2BX7A 3Q58A 3SR7A 1FWDC 4FX8A 5LNVA 1H2JA 4NUWA 5KETA 1B1YA 4US5D 3QKZA 1TQTA 1OCQA 3CL8A 2AKMA 4EVZA 4ZB5A 1KA9F 4AX6A 4EWJA 3GVQA 4JTUA 2CC0A 1CI1A 4XBKA 1K03A 2EKCA 4KT2A 1H7OA 1ME9A 4D8JA 1ESWA 3P80A 1EGZA 4PCFA 4JPGA 1US0A 1E51A 5C7HA 4LEFA 1E71M 1QWUA 4Y9MA 1TX0A 4PRTA 3URBA 1HZYA 3ELFA 3FJLA 3BLLA 1FTXA 1EEXA 1EJTC 4HNLA 1K6WA 3N25A 4ZB0A 4C6BA 4LV4A 1XLFA 3QNIA 3G1VA 3G9GA 1F8MA 4ZO7A 3ALFA 1WP6A 2E4TA 1CGVA 1RPXA 1WXYA 3TV8A 2V3GA 2J74A 2OR2A 3NQ8A 2DQXA 4R5IA 3VO0A 2WZTA 1QATA 3KZPA 1AODA 3W01A 1ISXA 5MHBA 3M5ZA 3Q2DA 4K39A 1O7AA 3WLLA 3TH6A 3UZYA 4ZEPA 4UTTA 2IXVA 3K13A 2XSXA 4P5UA 3T2PA 1FCVA 2VUYA 3G2GA 1M7OA 4NVTA 1QRQA 3VC6A 1QNVA 5FEPA 1E0VA 3WYZA 1YEYA 2X1SA 1A3XA 1W9UA 1Q6GA 1SFSA 1GHRA 1TJRA 3PWIA 1ONRA 4IPJA 1BLIA 2A7NA 4EZWA 2ZXAA 2VZVA 4OKDA 1GJUA 4TVCA 1TVNA 2CNCA 5HMFA 4I9JA 2J88A 4MY8A 5E5CA 2X2YA 1RQHA 4I7UA 1N55A 1JD9A 2J4GA 4FF5A 1DWJM 3W22A 5FI8A 1ZUAX 2ACRA 3FEQA 2NX1A 1JGIA 3T44A 2A0NA 4PMJA 3AQUA 1NU5A 4A8LA 4HQVA 1QWKA 4TOQA 4D6DA 3LXBA 3MP4A 5A2BA 1OX4B 1A0DA 2Q71A 3AMKA 4JTDA 1UA7A 1EKOA 5AYIA 3EEZA 2BDQA 1RY0A 4F40A 1K9EA 2EGZA 4ZQMA 5I78A 1CXLA 2R82A 3D52A 2ZUMA 4PUUA 4ERGA 3L21A 1BG9A 1S5WA 1EHNA 3ARZA 5F2MA 3ERPA 3T42A 5I23A 2D1LA 1MVYA 3IGUA 2J7BA 1EF2A 1J5TA 3AYRA 1YXCA 4GZ7A 2FPYA 4IOTA 4K37A 3ARXA 3QQ0A 1F6PA 2A3HA 7A3HA 4W7UA 4PMNA 4DBDA 3EB3A 1VFLA 4DXXA 3EA2A 4XZLX 3W29A 1W3NA 2QUVA 4CQDA 4HNVA 4FS9A 3KM8A 1Q7MA 2XFRA 1G69A 1WOBA 1FA2A 4HA3A 1A80A 2XGBA 3VE9A 1ZS2A 2OVLA 1Z3NA 2A3LA 3O6DA 3PJWA 4EZUA 2GA9D 1A4MA 4BZYA 5A94A 4WRHA 4PEKA 3RU6A 4MNKA 3UZWA 1H61A 3W72A 3W75A 3B53X 5D2TA 3M0LA 4CQ9A 1Q4WA 1SR0A 1FCQA 1VCVA 2PD5A 9CGTA 4QJ1A 1ZBCA 4LAUA 2QJIA 5F1VA 4AD3A 1SR9A 2BY0A 4HN8A 4A3HA 1XIJA 2Z1WA 4MOZA 1UQYA 3VDCA 2XGZA 1TZ7A 2V3DA 4LCRA 3B3DA 2OWWA 3EKZA 3PZQA 4V1XA 3PLTA 4C6EA 3W02A 4HZMA 2Q13A 1UASA 4J3VA 1PXGA 1J0JA 1IIGA 4MFEA 5JVLA 4NQIA 4LNCA 3PPFA 3LUTA 3V18A 3PUOA 1UYQA 3UJ2A 1IV8A 2BVDA 2V38A 1TV8A 3PULA 1Q6FA 3WLSA 4LUTA 2VEIA 3EOOA 3ZM8A 2PP3A 3KCJA 4O1BA 4CEUC 3S1WA 2X3VA 4MSSA 2WHLA 5T8GA 2ZFAA 3KOYA 3QV9A 4C7GA 1MJGA 1IEWA 2CHOA 4X22A 1ZJAA 3GYCA 2NQHA 1LLWA 3P0XA 2D2HA 2BV9A 4N2YA 3TYZA 3NG3A 5DELA 3W1AA 3ECQA 4GQRA 3IJIA 2VR2A 4HR1B 3AC0A 4MWAD 1BKSA 4H8HA 2VURA 4M6UA 3SRKA 3F7WA 1ADSA 3M4HA 1KM0A 4KCWA 1BGAA 2PPGA 4L9YA 4HHMA 4FSAA 1PJ9A 2QDGA 2A79A 5LNUA 2OQLA 5HMSA 4EZPA 1EB3A 2DSZA 2J9YA 2PGFA 4B5VA 3IJ9A 1CGWA 4ZZ9A 1SFTA 4B5XA 1Q13A 2AMXA 3V4BA 4JNYA 1G9HA 3MA8A 5EA9A 1UR8A 3CVRA 5HDRA 3TYAA 2JALA 4PMXA 4BF5A 1P0DA 3FDGA 5FL0A 2A7RA 1UIOA 1LUCB 1V02E 1VBGA 3RCNA 3FHQA 2POZA 3AJXA 4J40A 4QROA 4C6NA 4M5PA 3A21A 4TQTA 5DCBA 4Q8NA 3TJXA 3II1A 1HTYA 4OOUA 2O7SA 4RZ6A 2OLAA 3EB4A 1IEQA 3NNTA 4Q32A 3A9BA 2GL5A 4ZXLA 4FEZA 1RV8A 3GG8A 3CKDA 3IARA 3T8LA 4RX0A 1D2KA 2Z6IA 3E3HA 4H6RA 4HOWA 2DP3A 1HXJA 1CZ1A 5DFAA 1O7DC 5EBUA 3QR0A 3DPOA 3LCFA 5HJXA 2YA2A 3LV5A 4JGDA 3BGJA 4O1AA 3QWEA 3NOEA 1F2JA 3AROA 3GHTA 1XIBA 4F0MA 1XGEA 2ACSA 4ALDA 4EZQA 3BXWA 4ORIA 3L2MA 4O14A 3VNKA 4D6CA 3DFQA 2HPMA 1E9LA 3VE7A 3FJ6A 1GW9A 4AVOA 1Y5VA 3M6DA 3CT7A 2A3BA 2ISVA 3H55A 1CEOA 3NQMA 1KFKA 4ATDA 3CHVA 1Z44A 2BNJA 2YX0A 1ADOA 2Y5JA 3KAWA 3RX2A 2ZE3A 3VOHA 4FZOA 3DG3A 3NDYA 1R3SA 3LQLA 1LYXA 4LANA 3O8AA 1XLDA 4WIWA 3GI7A 3LHUA 2ATMA 3FXYA 4HSHA 2W9MA 4OGZA 3MDWA 1NOWA 3DX5A 3LTYA 4LC8A 3TSMA 1UCWA 3WFAA 6REQB 8XIAA 2GSEA 3BUDA 3MBDA 2HVNA 3R10A 1EYWA 4Z2KA 1JJKA 1TPH1 1XICA 1C9DA 4JFTA 4RW3A 3WNOA 3W7OA 1J0KA 1N82A 1O5XA 3UD6A 1QASA 2GUBA 1DL3A 1EWDA 1YDYA 4H19A 4H9TA 3AIVA 7REQA 5AC5A 1K7XA 1UA3A 5DY3A 3AO0A 4W86A 1JDDA 1WA3A 1XYLA 1F5ZA 3Q45A 5EMLA 4YN5A 1C7TA 2QVHA 1N2VA 3WLPA 1XLBA 2WMKA 1KWGA 3OQ8A 3WUFA 5TF0A 3WSUA 3KE0A 2YW4A 4PSRA 4DJFD 3WEOA 1UD5A 5TAOA 1HJWA 4MZ8A 3VFLA 4L64A 5A8PA 3A64A 2A6LA 3ZR5A 4Z0SA 4MUZA 3OEXA 4HB7A 3FK4A 2Z7GA 1EWEA 1IHIA 3WLMA 3CUJA 3G77A 4H8UA 4JIEA 1KFCA 1SYTA 1PWMA 3WZ0E 1KGWA 1JD7A 3APTA 4H1ZA 3PZGA 3PP7A 2C13A 3PM6A 1GGOA 2AQWA 4DZHA 1DYSA 1TMLA 3HFTA 3L4WA 2FHBA 1OCJA 4XK2A 4H9MA 2OLSA 3TLLA 1PHQA 2AGTA 4PYSA 1I2OA 3NO5A 3S83A 3FSUA 3GXDA 1WZAA 3EX6A 2P5NA 5H8UA 1BXCA 3HQ1A 4X9YA 3O3RA 2PDPA 3ME3A 1S5TA 3H70A 1JL8A 3FEMA 3LCHA 4MNMA 2KX9A 4C5ZA 3VKBA 2OGYA 1LT7A 1M03A 1W1IE 1RY8A 1XKYA 5FEZA 4XTIA 1TQXA 2UV8G 4L80A 2YGYA 2JFEX 3F2DA 1GQNA 2ZUUA 4O52A 1YLVA 3AUOA 2W62A 4RE3A 4KRZA 1H63A 1LQAA 1XSIA 3PTDA 3OWGA 3AXHA 5H1WA 1TUXA 2C3ZA 1WX0A 4AISA 2TODA 3WMSA 3LTPA 3I2WA 1F76A 4CGTA 1OWQA 3CAQA 1I0DA 1QNRA 2HBXA 2Q12A 2DH3A 1YIXA 4AZCB 2H3DA 3PPHA 2ZZ2A 5F2LA 3CL7A 3BG5A 3WDJA 2YL6A 5CAKA 3DYOA 1I4NA 1AW2A 1VYPX 4FZIA 1ICPA 3TVAA 3B9NA 5JIWA 5D4YA 1E2UA 2CERA 4I9AA 1JVNA 4WX2A 2W0UA 3WKZA 1E1EA 2Y88A 4UMCA 2GDQA 1XJBA 1FWBC 1DJNA 3P2VA 3W27A 2DW6A 2ZRZA 3E12A 1TQVA 4JN7A 3PZOA 4K36A 4P61A 4YJ5A 5D8ZA 5JBEA 1AQMA 4R7WA 4YVPA 3BVUA 2A1YA 2E77A 4WHBA 3BARA 4PCNA 5I0DA 1H09A 1NIUA 1OABA 3UJFA 3WNLA 4Y8EA 2OBLA 2DZUA 4R3UA 1ZALA 3QJAA 1Q6EA 4RXGA 4NXSA 3CV6A 3ACOA 4GBDA 1NWUA 5HOSA 1OC6A 4NNAA 4D6HA 5XIAA 1AQHA 1EGVA 4M56A 2NVAA 1LTDA 4GYPA 5CKSA 1RLDA 1WQ5A 1FWFC 4K8EA 2G3IA 3T8QA 2G3JA 5BU9A 3HN3A 3I6EA 3M6YA 1HGWA 6ALDA 4DYJA 3CO4A 4JR5A 1OZMA 1ONXA 1R85A 5C54A 2D0GA 1DQXA 3S1VA 5AVHA 1AJ0A 1OSEA 1R2SA 5FACA 4MLJA 5CC5A 3VKHA 1BYAA 3SN1A 4I5UA 4JTKA 2JNKA 1VBHA 3CLMA 3WLKX 3T0AA 5D38A 1PS9A 4RNFA 3P14A 1GVFA 3KTSA 3G6MA 4NASA 4V27A 3AIRA 1A50A 1RD5A 6PTDA 4GIYA 3DHFA 3UETA 1XIFA 4DF0A 1NDVA 1KXVA 4XSLA 1XSKA 2QDEA 1S2AA 4XZNX 2VQUA 1X39A 5DMMA 1JRCA 2BP1A 4TXEA 2CLFA 4H00A 4QAIA 1PEZA 1QUMA 3B9OA 4K8HA 1EBGA 2XISA 1BPLB 3S4TA 3UF9A 1PYFA 3O0KA 1S2VA 3KWXA 3WCZA 5I09A 1ZBKA 3F1QA 3HJEA 2Q01A 2J66A 2IUZA 3GTFA 3IJDA 1L6YA 3W81A 3VCNA 3GC4A 1O5RA 4FA3A 3ITVA 2RT6A 1NP2A 2WHJA 4HTBA 4BWLC 3MB9A 1H50A 1IT7A 3QGKC 4KMQA 4JNMA 4YTSA 3GBEA 2B7PA 3ITCA 3KXQA 4PMRA 4UOZA 3LEPA 5L6UA 1QBAA 1ICSA 3W82A 1OF8A 3DHPA 3QSTA 4ZBCA 1I75A 3WJSA 5F1UA 3VD5A 4AWEA 1OFEA 3STFA 2OX1A 3EMQA 3EWCA 5EKYA 2VT0A 3WDQA 1T6MA 5BOEA 2A3EA 1R9XA 1VBRA 1VQTA 4BI7A 4L4PA 2D2OA 1TWZA 2EFKA 4AYGA 1XLHA 3LYEA 3PK7A 3TZFA 4KF1A 1M5WA 3L4VA 1PX4A 1PE1A 4HU4A 2Y7GA 1J0YA 3WL1A 2D4CA 4DZAA 4WPEA 3K4AA 3P74A 4GYJA 5K4ZA 1PZ1A 1M41A 3VEBA 4KBXA 3O63A 4DF2A 5KZ6A 1DKXA 1HKKA 2YCJA 4RE4A 1V6WA 2JGQA 1SGJA 1G67A 2Y7FA 3SCTA 4C60A 1UD8A 1Z9AA 1V4YA 2WBGA 3S5SA 1OFPA 2D24A 3CV7A 1U2YA 4NX0A 3FX4A 2HISA 2ATSA 5HXMA 5CEWA 2HPIA 3DUGA 3ITXA 4DN1A 4GC4A 3NL3A 4JBRA 1Q4NX 4H04A 2OQHA 5AHFA 3CH0A 3W73A 1VYRA 4D6GA 1B3OA 3RRAA 4YVVA 2VCCA 3DFPA 1PHWA 3ONBA 3A24A 3GS6A 3ZJ7A 4MY9A 3T05A 3VNDA 3SQLA 3P81A 3GNPA 1YE4A 4LSBA 4LFYA 1L8NA 2ZTKA 1ITXA 2DDXA 3CYVA 2INFA 4UQCA 2P3ZA 2NT1A 4OUEA 4R85A 4MM1A 2WC7A 1I6NA 4GYPC 2FFCA 4NKCA 1GJPA 3CZNA 2YCLA 3HPXA 3W4RA 2OXNA 1SW3A 2W67A 3ZVHA 3SQSA 3R79A 4AAJA 1OVDA 3RMJA 2SFPA 5FOOA 1QPNA 1XYMA 4U28A 3LXCA 5CPQA 3OZYA 4I90A 1JCLA 5BRPA 5LHFA 1B31A 3AUJA 4JX4A 4IICA 4IWOA 1XH0A 2BGNE 2HXTA 2BY3A 4I8YA 1H0IA 3GDKA 4E8DA 1W8SA 3DG6A 1UKOA 3N04A 4FNSA 3STPA 2DZSA 1ZAHA 3VDBA 3A3HA 2V5JA 3TN4A 1AJZA 3U3HA 2B7OA 1GOQA 4IL2A 4NY2A 1NY1A 1CLXA 2NCZA 1J18A 1DBTA 1QO5A 5HR7A 4A3YA 4OZOA 4W93A 3UG4A 4Q7IA 3KL0A 2ZICA 4HPGA 3O6CA 3QFWA 1B54A 3WBWA 3EDJA 2VFEA 1W9BM 2P76A 1H7XA 2BGSA 3KOXA 1XLJA 2I5QA 2CYGA 3NYZA 5GNZA 3PZTA 3WK3A 2IQTA 2OO2A 1AMYA 5LKYA 2XINA 2YXOA 3NQEA 1SUFA 2XYLA 4PGLA 3N9RA 1S2CA 4Q4PA 3ABQA 2YBUA 3S3GA 4QSHA 4Z2GA 3RCYA 2H8XA 4PR4A 4PH6A 3OP2A 4P8UA 2WW5A 5M5DA 2WO5A 3TX9A 1HVQA 2FPTA 1YYAA 1A5MC 3FJ4A 5DBUA 1KM6A 5G1TA 3F5JA 1XGDA 1JPMA 2HMCA 1L6FA 4F48A 2QMJA 2BOEX 1HL8A 3CZLA 1PYMA 4GG9A 1E15A 1K8CA 1XLIA 1I8JA 2EWFA 3UR8A 2D23A 1BTMA 3ZXWA 3TNOA 3DDGA 4HYWA 4XKMA 3Q67A 2RDUA 1K9DA 3RG6A 1Q66A 2JGYA 4MWAB 2C79A 3AU2A 5HULA 2BOFX 4AD0A 4C6PA 2EFLA 2YFNA 1PBGA 3TA9A 3ID7A 3IVTA 4H8VA 4BI6A 3MPGA 2WXDM 1J12A 3NXFA 5A6KA 4HNUA 1EJRC 1Z42A 1A5SA 3T48A 2FIQA 4HMNA 1EP1A 2PTDA 4J3SA 3T0TA 4I9TA 2J7EA 4B5NA 3L12A 2C1IA 3G1SA 5RUBA 4XG1A 3B8WA 3WELA 2PWVA 1C29A 4W5ZA 3LA4A 3HTWA 5C70A 1S1RA 2E67A 2DIKA 4UTTC 1VFFA 4UR8A 1PUDA 1LOSA 2V30A 4IFOA 1VRDA 3BUQA 3D51A 4DWDA 5ECUA 3IIOA 5LYRA 1EJSC 1HJUA 2J62A 3CUZA 4MFDA 3W2MA 4YCOA 2Z26A 2ZUTA 4GXPA 3GXMA 4EPDC 1B57A 4BS0A 1DTNA 3HAJA 2WHKA 4GGHA 3JW7A 1OYBA 3U4FA 4P8WA 4JOMA 4F0KA 2JF6A 3WLTA 4JNZA 3M0ZA 1Y7VA 2C6QA 1Q2SA 1TTIA 3M46A 4B5WA 1TB3A 3MUY1 4EX4A 2WBKA 2YBVA 1BVZA 1XIHA 3WH8A 3EDDA 2VZSA 2Z2BA 3TU9A 4GIRA 3BTNA 4NF7A 2Z1SA 4WGHA 5CSSA 1W0MA 1NELA 1OIFA 3R0UA 1YBQB 3VIFA 4WXYA 2VHLA 3TNBA 2XIOA 5FSEC 4W7WA 3VMOA 3W1TA 1JDAA 5CC6A 2OOFA 4LVAA 3CV2A 1JULA 3BLPX 1VFHA 1XP3A 4XD3A 4HYVA 3IWPA 3RPTA 2TRSA 3D5HA 1OK4A 3L66A 1L2UA 3AS3A 4O11A 3VNYA 3O05A 4LX4A 2R6OA 5IBXC 4PEEA 2RDTA 1EDQA 4INFA 2VZTA 1P0BA 1DWGM 2WWDA 4QITA 1Q6RA 3VNJA 4UCGA 4P7OA 1X6UA 3T4WA 4CNPA 1OC7A 1V3MA 3TUUA 3BQ6A 3Q84A 3DH7A 4M0XA 3CZ8A 4HHHA 5A6MA 1S1PA 3L5LA 1BHGA 2ZRWA 1TTJA 3M3WA 3CPGA 5AHLA 3FNDA 3TN5A 5EBAA 3WQ5A 2I7GA 3U0HA 1F6KA 2XH7A 3A22A 3EDKA 4MJ4A 8A3HA 1UW9A 2ZE0A 4WGXA 2QDDA 1U5JA 1SMAA 4HNOA 1UZ4A 2WC3A 1SZEA 1UP2A 2FJUB 2BBFA 1ECQA 1GQIA 1KV5A 1JDEA 4IWWA 1EC9A 4IF2A 1AQ0A 3RGTA 1LWHA 4Z08A 4JQ2A 1UP0A 1A5NC 4HZ6A 3HA1A 2V67A 3JR2A 5KMYA 1YPXA 5FF2A 1GUVA 1KCXA 4LVGA 5CJMA 1I4DA 4FB7A 4AG0A 1JQKA 1CBGA 5FEXA 2WMGA 1RAKA 3MMTA 1OY0A 4FO4A 5AY7A 4PSPA 4IL0A 2EPOA 1UR4A 5J5DA 1IWBA 2PB1A 3A5VA 2ZUWA 3EJTA 4J3XA 5D03A 4OE7A 3EJQA 3B40A 3AIWA 5FF4A 2PURA 3SCQA 2ISFA 3VGDA 2TAAA 1G01A 1GZ1A 1Q6DA 2MI7A 2HCVA 3GNRA 3LX9A 1LCOA 2I5GA 1GPWA 3HGOA 2YA0A 4JX6A 4O1EA 4ENLA 3WDPP 5I07A 4E8GA 1CXHA 1H11A 3CWOX 3PFMA 2WHMA 3SURA 1TPWA 3PAJA 1HJSA 5FF3A 1Z6KA 4IQJA 2VRJA 1JPKA 4OUIA 1HGYA 2DV0A 4LUSA 3QKEA 2AQVA 1I1WA 4GH3A 1WKEA 1MNSA 3WJXA 2RAJA 3RV0A 2BY2A 3UY8A 2I9UA 2ZX6A 5AYYA 4BQ2A 1TRDA 1K9FA 3UWVA 3PVFA 1UPPA 3UXKA 1JZ7A 5AB3A 2YYTA 2Z0IA 4AXNA 3PUEA 5I00A 3TW9A 2ZVIA 1UWTA 3CLWA 3O06A 1V3LA 1ZGDA 1UKTA 3HG3A 3U48A 2QCDB 3PZUA 1JCTA 4N6FA 2G41A 4S3GA 4N9EA 1ISYA 1QJWA 5K9XA 4S3BA 2DW7A 1V3JA 2V2DA 3RN6A 2NLIA 2VVNA 3LD5A 4S39A 3FV9A 3UESA 3WN6A 2LM0A 4O15A 1KRCC 1HIZA 5AYBA 3P82A 5D8WA 2GSJA 2Y0FA 1NOFA 1GVEA 4ICCX 1G4EA 4PUWA 1BEUA 1GQJA 5DF0A 3JZEA 2I9EA 3G0XA 4CD8A 3VKJA 3ANVA 1T41A 3EOLA 3WUEA 2E8ZA 2J6VA 2TSYA 1UH3A 4JN8A 2VGIA 3S5ZA 3OVGA 1JFXA 3GXIA 1E1CA 3K4WA 1ADDA 1BQCA 2GGGA 1QXLA 1XHGA 1IEVA 3QHOA 1AH3A 4YTUA 3QC3A 3GD6A 3M7WA 1B3YA 1LG2A 4AEEA 4AZIA 1HN1A 1DOSA 1TQWA 2OBMA 1UH2A 3LRMA 2XFWA 4XISA 3ZIZA 3OHIA 4AZGA 2HV5A 4C6KA 4FOJA 4IIFA 4F2BA 1SM9A 3DERA 1TPEA 2QCNA 4J4KA 1H49A 3LZ3A 3MV01 2PWHA 2ZC8A 4TVUA 5CJ5A 3BVXA 4BWLA 2A85A 4NAEB 2OZ0A 3DPPA 5FESA 3IV8A 2OMAA 4JWDA 3HZ3A 4PCTA 2E9LA 1TVPA 2NUXA 4IXXA 3MSRA 1P0NA 3RLVA 4ML4A 5CLWA 1MFVA 4JHMA 3EOUA 1K70A 2B31A 1YBQA 2Z1VA 3M43A 4MG4A 6TIMA 2YB4A 4OECA 4RDWA 3VKKA 3VOCA 1RQEA 3CWNA 1EA9C 1YDNA 4F01A 1Q3NA 3F03K 2VWSA 3FOKA 3BW2A 3SIZA 5HNRA 1S3HA 1E9IA 4C6LA 3PBGA 1R86A 1ZBWA 2V63A 5EMMA 4O0ZA 1V0KA 5AKQA 3DHDA 3GDBA 4QQ3A 1K8YA 2V0OA 1AD1A 4GY1A 4XIAA 5M2FX 4JQ1A 1PS3A 4Z0JA 1ZB5A 1F6YA 1S5VA 5A8OA 4PTMA 4LVDA 4Y9NA 1C3FA 2ADAA 3KTCA 3TW6A 4U3AA 2QT3A 4JIHA 1PIFA 4QDPA 1NWRA 4J3WA 2DT1A 2VEFA 2YJQA 2ZA3A 3FCPA 1QI0A 1RXOB 2GWNA 1TQSA 2VOMA 3QA8A 1ME8A 4AWSA 4ZFCA 2VCBA 4M82A 4UNLA 4F79A 4IH3A 4JTTA 2NQ5A 2XIJA 4EZNA 5DX7A 3IUIA 4XUGA 4KIEA 2FMOA 3OG3A 2X1TA 4M6PA 4RV3A 3UWYA 4B4FA 3W84A 1WBJA 1WPCA 5I24A 1R3YA 4MTVA 4W7VA 3N2TA 4HNCA 4DJDA 1Q65A 1TYGA 1E6RA 2FICA 7ODCA 3CS2A 4EZSA 3VGBA 4U5KA 3R0DA 2DVTA 5KSWA 3N4EA 2PY6A 3NQ2A 3BZJA 3SJNA 3SO7A 2Z1XA 5AC6A 3WQ8A 3L9CA 4AMAA 2PDWA 1DEDA 1W3JA 1VAHA 3NQFA 2B7QA 4GVIA 4K38A 3QFEA 5A6TC 3TAKA 1KKOA 3GHSA 2HTMA 3FVDA 3NZPA 4KFNA 3C3UA 1UPMB 1R46A 2PU1A 2GJPA 4FI4A 4PMQA 3BSHA 1OQFA 2E25A 4WDTA 3NZ1A 3MHUA 2FDSA 4JQ4A 4Y9PA 3VKDA 2P10A 2RJGA 2ND1A 4GY0A 2DZTA 3OIHA 1E4NA 1KBKA 3PB2A 1EH9A 3KHJA 2EG7A 4D2JA 1IGWA 1M6JA 4GI8A 2Q8XA 3NSNA 3VINA 1RK5A 2QIWA 1VLIA 3R4IA 1LRTA 1UR0A 3G1FA 3SADA 3D0CA 2ZVRA 4FALA 3N18A 2FB3A 4O1DA 1S2TA 4JWEA 3R7MA 1E6PA 3LI1A 3NL5A 4C6IA 3AOFA 1FH9A 3V1HA 3SRHA 4RKAA 1P0EA 1BQGA 3VGHA 4GIAA 1KM1A 3RMEA 3VIIA 3GVWA 2ZKMX 3NPVA 3I01A 1XC4A 2PFHA 4QS5A 5FCZA 3W7HA 2IPJA 1A5UA 3H4GA 2OZ8A 4BJHA 4Z2IA 2JKEA 3CTTA 2I1OA 5DANA 4AZBA 1JDCA 1SJDA 3UWQA 1LT8A 1E6ZA 2EO7A 3AAMA 2PP1A 2W3ZA 1VF8A 4EZVA 2X40A 4XV0A 1XRSA 5D2VA 4KFOA 1W1ZA 4YNGA 1DXIA 2PC4A 3GBDA 3GIPA 3H4XA 4DIAA 5EYWA 2XH2A 1F3XA 3I6TA 3QOMA 2QVNA 4DJFA 5BOFA 1ZWWA 4GD0A 1VFUA 4QFUA 3NCOA 5FIPA 3U5UA 1E0XA 4H4IA 4HPNA 2CZ5A 1PIIA 2XWDA 2RAKA 3ZFHA 2Z4GA 4QQUA 3DDFA 1XG3A 2I57A 1H5YA 1E6NA 1KXQA 2XZ9A 3GKAA 3L4XA 1JQXA 3TR9A 1GOKA 2OO6A 4N0RA 2QGYA 3TFXA 1GW1A 2PRMA 3CYJA 4MKNA 4LTSA 2HDJA 3U4AA 1GZJA 2E3ZA 3VILA 3WEMA 1RH9A 4QXIA 1ML1A 3QY8A 5F4SA 8XIMA 3MUZ1 4PRRA 5DMNA 3RIKA 1XCXA 3L2IA 4WSJA 5GNYA 4P2VA 4A6GA 2DSKA 4MY1A 3DI1A 4QEEA 1EFZA 1I4TA 1QFEA 5FJOA 1FWNA 3ALGA 2G8ZA 1GJWA 3PBYA 3VOFA 4C6DA 4U3CA 1P4CA 5IFPA 4DJEA 4AZHA 4MWAA 3B0VC 4NSWA 2ZCGA 3HPFA 1EBHA 5J8LA 2EJAA 3W6MA 2WNQA 2WPBA 2YDQA 1O5QA 1UZDA 3VKAA 1VJIA 1K8XA 1V03A 3DN5A 1K1DA 3GNDA 1ZTVA 2NX3A 5LIKX 4ZQPA 1XDLA 3E0WA 1KFJA 2HZGA 2NQJA 1NAL1 2YCEA 1QU4A 1Z69A 2ISWA 1ZENA 3KP1A 5BU6A 4JAWA 1ZNNA 4EANA 1B4EA 3QQ1A 3HMJG 2C08A 3O2LA 1FWSA 1XRFA 4H41A 1V7YA 5CXPA 4DB7A 4F2TA 4NYYA 3CMJA 1KLYA 3NA8A 2WJFA 2A4AA 4NZ5A 4UQEA 3P7YA 4FOKA 4S23A 1GOIA 4H6HA 3LCIA 1WBHA 1HFBA 3BV4A 3SCNA 2TMDA 1TPUA 1KR1A 3QGVA 3EB2A 3CQ0A 3VCRA 5D33A 3T81A 4NNCA 3CGTA 2XM1A 3ATZA 4C91A 1G0CA 1A3WA 2WQDA 3PWAA 2QKFA 4I6VA 5E9XA 4W87A 3AXMA 1AH0A 3WJWA 1EPVA 4ZODA 2P88A 5G1MA 2WJZA 4JTSA 1RJRA 1DJZA 4AQLA 2DY3A 4PN2A 4H9VA 1MO0A 4DO7A 2PEVA 2E40A 1TQUA 2C8NA 3GH5A 3NQBA 4R5JA 4H9ZA 3RILA 3SEPA 3TMLA 3TWAA 1A5BA 3REQB 4J3ZA 2QYGA 4NI8A 3VK5A 2WSRA 5K9DA 1UD2A 2F6UA 4GX9A 3W7PA 3UJEA 1W3TA 1G5AA 2QXWA 4LUTB 2DUXA 4DPQA 1KR0A 4YIWA 5K3VA 1Q7ZA 2EF9A 3MANA 1SZNA 3BWWA 4RJEA 4HVXA 3ARTA 5EMYA 1IWPA 3H2EA 4IT1A 1PZ0A 2CHNA 3JUGA 4NAFA 2CLKA 3E0IA 3KDRA 1W32A 3R94A 2HEJA 2WZIA 3VIKA 1TV4A 4ZO9A 2HWGA 3SDOA 4M81A 5AZ1A 1GVIA 3EZ4A 2G4FA 5E6ZA 1RA0A 2VNCA 3MVTA 3LRLA 1ZJBA 4UBPC 2WLZA 2KHOA 3AYSA 1S46A 1B0IA 3PHAA 2IPWA 3Q37A 1QOQA 2NWRA 1PWLA 5C5BA 3M0HA 1PCWA 1FCBA 2Q8ZA 2HK0A 4YMZA 1YXDA 1LLZA 3VOIA 5C5YA 1HKWA 3ZWTA 3T2QA 1IZKA 3AMDA 4KCVA 5DXXA 1E0TA 5I03A 3O6YX 1ZCOA 1WV2A 3GXPA 2YLAA 3A4AA 3MUIA 1O7DB 4LAMA 4A8IA 3E0VA 2VTFA 3R12A 3DFOA 3SM0A 1O12A 1DE5A 1ZZMA 4RV8A 1JCJA 3WK0A 3HMCA 3P8JA 2P0OA 1Y5WA 1IR2A 2J7DA 4IIDA 3UNTA 4GH1A 2IS7A 4PMZA 3TZNA 2FPVA 3S5OA 4AD5A 2PBOA 4GCAA 1CGYA 2R1NA 3P5YA 3M5VA 3CEUA 4JL1A 1TWDA 3G5EA 2WANA 2J9ZA 4O28A 4UCFA 5I3KA 1JQVA 3QMRA 2A7PA 1X03A 5C2XA 1X8CA 3FD9A 2WMJA 3LGDA 1PTAA 1IXQA 1UPXA 4OIFA 3O0FA 4IUGA 4LV9A 1JDFA 4O13A 3E5BA 8RUCA 3HG2A 2PI6A 1G6CA 2J78A 1VEPA 1KC7A 4L4MA 5GNXA 1QNOA 4MJMA 3TEVA 3GFXA 3CL6A 3F2CA 2P53A 5CGQA 3GUGA 4E8CA 1EYEA 4WF7A 4PBEA 5A2AA 3P84A 1EJVC 3WLIA 3E96A 3I7SA 4Q6JA 2PZ0A 3IVUA 3VDHA 3R43A 3BVTA 1OA0A 1U33A 4W4QA 3SOGA 3N73A 4QNEA 3TWBA 1SJBA 3IIVA 4M1BA 1J0ZA 2QR6A 5IM51 4UOQA 1OCNA 2CLIA 2E5BA 1XUZA 4D71A 5I7GA 1ZBVA 2E9MA 5K9CA 1P6BA 4G9PA 3BLKA 1UUOA 4MYXA 1V0LA 3W7LA 4RW5A 5TKYA 1KM3A 3R8GA 1R5YA 1HNYA 3SUSA 2VX4A 4KW2A 1UOKA 4EPEC 3TSDA 3VA8A 3BLIA 1OZQA 4ROQA 1DORA 2Y4SA 1PB0A 3W7JA 2VCAA 3MKCA 1Q6QA 2X1UA 1H41A 2BVWA 1FDYA 1G4PA 1ZJHA 4JL9A 2J7CA 2W92A 4RUBA 1XF0A 3H22A 1FY6A 5EMJA 4H83A 2BFGA 4JKMA 4LUIA 3W7DA 4WY0A 4WY0B 1JI1A 4AXKA 5FAGA 3RLHA 1HWWA 1LRNA 2HVMA 2YL9A 4B5SA 5A8NA 4HU3A 2FTYA 2W6RA 1JF5A 2X41A 2GQ9A 3F4WA 5G5IA 2X8RA 3D46A 4FR1A 1S5MA 2FVKA 4DYLA 5LGZA 2YIVX 4ZXOA 4DHGA 2BHYA 4AB4A 3P61A 2Q02A 1LBFA 3BOXA 5LNSA 5A6AA 4CQAA 3NR0A 2F7FA 3I6RA 3SJ3A 1EC7A 1O5KA 4Z1YA 5JIPA 1B9BA 1Q2RA 1V51A 4PMVA 1LF1A 4Q8PA 3CT2A 3S2LA 3UCQA 3F7JA 5JH1A 1MQRA 4EAMA 1MDLA 4WQ6A 5KZMA 3LLXA 4H7VA 3ES8A 3R0KA 2QULA 4XX6A 3FN9A 4O0QA 3UU0A 5EMKA 4P7QA 1OX5A 4X61A 3PWGA 2RAIA 1U83A 2WCSA 4HJFA 2B4GA 1W5PA 4QS6A 5HWJA 5CG0A 2XPKA 4AD1A 4JWCA 1HTIA 2XH4A 3DFHA 2F2KA 4E5TA 3LPOA 2PD9A 1CTNA 2EG6A 1TZ9A 1FWEC 1US2A 3NGFA 3NAVA 1HP4A 2YW3A 3B52X 1HUVA 3T0DA 1XXXA 1DTUA 3EXRA 3KP0A 4F8XA 2CEQA 5GPRA 1R8LA 1W9VA 4GO9A 4UR9A 2DUAA 1VFMA 1GONA 3T78A 5JMUA 4DY1A 1E1FA 1VZWA 4HTYA 1M3UA 1UH4A 1JPIA 3ITTA 1CLKA 3VZYA 1PSCA 4ADSA 3PJXA 3OJGA 4ZQRA 3ZO9A 2PF8A 1H1NA 1CLVA 3KX6A 4JDBA 3CMGA 1X6LA 4ILSA 4XZIA 1WKDA 4UTKA 1AL8A 3F4CA 3NDOA 3AZTA 2YIBA 1B30A 1UOZA 3WBEA 1KCKA 3BAKA 3N4AA 2CHRA 2VOTA 4IMAA 3BLOA 4DWSC 3R25A 2ZADA 4ZA0A 5LNWA 1U5HA 4LJ3A 3SBFA 1ZPTA 4QGCA 4MPQA 5ABEA 3RX3A 3PFRA 5MF5A 2Y6ZA 1THFD 4Y2WA 1LORA 3MYOA 3TYUA 4QJ5B 3B9DA 1J6OA 4EIVA 3W7QA 3MHFA 4GACA 3EWUA 4PUDA 3WQDA 4IMEA 3AMGA 2J27A 4AW7A 3A6OA 3KZSA 2QIIA 1XLEA 2GWGA 1I45A 2D1ZA 3N3TA 5CPSA 2F6XA 5HINA 1XQKA 1HW6A 3RM8A 3MJMA 4XIMA 1Y8BA 2DH2A 4JDYA 4IFRA 1RCOB 5DT5A 3LERA 3G0SA 1IIHA 2PMQA 2VXNA 4UC5A 2ICSA 2AGKA 4ZOAA 5B7YA 2I16A 2O7QA 1SU8A 4E38A 5DCEA 1WDPA 3W23A 1CT5A 1KWKA 5LZLA 5LHEA 2PDMA 4FLRA 4UIOA 4JHOA 1MUMA 3ZT7A 2W63A 1TQJA 3H2NA 4UMAA 4D1JA 4O54A 1BRLA 1JRBA 2OWXA 3F5KA 1BRLB 3LSCA 3LLLA 1FOBA 3NM1A 1UR3M 3LENA 3W1QA 4HK6A 2X3WA 4Z2HA 4UNKA 1P5BA 4A2RA 4ZENA 4O10A 4KCTA 1AZ2A 2AAMA 3ZJKA 4BFAA 5C9XA 1QOPA 1WO2A 3EX1A 4PUNA 1C7SA 2OO0A 4F4RA 2D73A 4FMVA 1UWUA 3WFLA 4DUOA 4KFPA 2FB2A 3BMXA 1GOWA 1US3A 2FJKA 3RK8A 1YXYA 3WLQA 1XPGA 4DJEC 3E2SA 3PG9A 3WO8A 3WDHA 4ICMA 3B8UA 1GEQA 3PZIA 3VNMA 3NGJA 3IJ6A 3VNIA 2IKJA 4XZMX 1NP0A 1QI4A 4DZ5A 5ABFB 1QAPA 2WNNA 1VFOA 1QX1A 2H9AA 4FNPA 4UFJA 1FDZA 1TIWA 5D09A 3KFTA 4XZ9A 5CZSA 2IMRA 5FJRA 3THUA 4EXAA 2VWTA 4KS0A 3B0UX 2DT3A 4GI4A 3B0XA 1VBJA 1PIGA 4DJDD 5FSDC 4M1RA 4QISA 1CPUA 2DJXA 3LM7A 1DJXA 3CHEA 1S3TC 3O6AA 4A05A 3FKKA 2FYVA 3TN6A 7XIMA 4AC1X 4UQDA 3SUWA 1JG9A 1ELSA 4QDWA 4JYFA 2QV5A 3V5CA 3W7GA 2C0AA 1IQ8A 4K6AA 4B4HA 3C7NA 3UG3A 3DCPA 3CIVA 3GR8A 4AX7A 3W2KA 1LLOA 1KFBA 3KLKA 4NJHA 3RFAA 5LA0A 2IKHA 3C6CA 3QPZA 3KEHA 4AHQA 1JNEA 3W53A 4GNKB 3VZZA 4DBWA 3GKFA 1K77A 2YB1A 4RCXA 2O92A 3MS8A 3OLGA 2FYMA 1XIGA 4Q4MA 1FX6A 3L65A 3A3XA 2X5CA 3RR4A 4GABA 2PLJA 1SO5A 3ABOA 3BUVA 3CWHA 3FSTA 1QR7A 5EL1A 3M16A 3H23A 1RK6A 3UPBA 3WBXA 3ABXA 4U10A 5JU6A 3M0VA 1BVWA 2GUUA 1TA3B 2WYHA 2XN1A 3GXTA 2MUCA 1UUMA 1HKVA 3CO8A 4IPPA 1L6SA 2YSWA 3GM8A 3THCA 3M41A 1EXBA 1CXEA 3TOPA 1KCLA 4KEUA 5LGXA 5I3HA 1NM9A 1X97A 1L8PA 3IUHA 1GTHA 1MYRA 4JIRA 3EJSA 1F3EA 2TPSA 4UOJA 2IPFA 4L6HA 5DO8A 3OHXM 4A21A 3M1ZA 3QEZA 4WPCA 3F5LA 2G95A 3N14A 5KEZA 4TTUA 3T09A 3SSZA 5A69A 3B8SA 1NFBA 1U1JA 5M3WA 1YMYA 3RHGA 3KRSA 4XQ6A 5D2XA 9XIMA 4M8UA 5BYWA 3BJSA 4UZSA 3OBEA 3DZ1A 3W1RA 1SVDA 1MNZA 6REQA 5A6BA 1NFGA 2HK1A 3UQNA 4J2PA 1UWSA 2EPMX 3PANA 3LBOA 1SQ7A 4AZ7A 4LS2A 5HQEA 4MVAA 3UWEA 3LI0A 2PSNA 4GUGA 4JTIA 1V6UA 2XVLA 3FLUA 2X3XA 2G3MA 3CZGA 5KZDA 1L2QA 4DI8A 1AZ1A 3AYTA 1OK6A 4HPXA 3WF0A 4HD5A 1UQZA 1EOKA 4R9XA 5E0CA 4J28A 4MAVA 1VC4A 2VFFA 3N17A 5CPMA 1KCZA 5ABFA 4CLMA 1E0WA 1HVXA 3Q94A 5L9FA 2CLOA 4TX8A 3GDTA 2Q6ZA 3CIWA 3DIPA 3GAKA 4WKFA 2BOGX 4Q6XA 4DJDC 1MW2A 4MKSA 3WK2A 1QNSA 1E3ZA 2WVSA 4HNTA 2A2IA 3FYYA 4HBKA 4JNEA 1DIDA 3EOEA 3PJTA 1XISA 1YPFA 2YCIX 5DLCA 2QJHA 2QDHA 4DJFC 3PZMA 1KRAC 1MXSA 5EMUA 3AWOA 4PMYA 4Z2LA 1DWAM 3TKFA 5JBFA 3NL6A 3LY0A 4JYEA 4Y9OA 5CBJA 2OX4A 4TTGA 2VL4A 5HBFA 3BLBA 2GVEA 1VYSX 2O9OA 2PWDA 4DJED 3BV7A 1YKWA 2E5DA 2ABAA 5CAHA 4AHOA 1GHSA 1NSJA 5F7UA 3D3AA 3S5NA 2RGLA 3M0MA 4A2SA 2VENA 3WNNA 3OBKA 4WZHA 4GINA 1NF0A 2F1AA 1TWSA 1ZQ5A 5LNRA 4W88A 2BHZA 4BCEA 4IP4A 2YI8A 3U7BA 4NHVA 1KBIA 4GO8A 1UROA 3UVIA 1J0HA 3VD7A 3KDOA 5ABHA 4C1KA 4GVHA 2PDIA 4O18A 3HFYA 1T40A 3ZMRA 3W1UA 4S3EA 4CVUA 3W07A 4AU0A 2BODX 3C0QA 3LXAA 3L23A 3U7VA 4IJCA 2WYSA 2W27A 2JEQA 1WB0A 4F9DA 2YA1A 1R87A 1LJYA 2BS9A 4GUJA 3F4DA 1SUXA 5IXEA 3HURA 1V6VA 5HWMA 2XVKA 1ZP3A 4Q8TA 2CZFA 3GXFA 3CAWA 4Q4OA 3C0JA 3IGHX 4UFLA 3SFWA 2PMRA 4BI5A 4I5RA 1XPYA 4RK8A 1DE6A 4JY8A 2VM8A 3UGVA 3N19B 5AYZA 4NX5A 1P6WA 4DCNC 4GKTA 4H6KA 1GYMA 2EX3B 3SGZA 4I7VA 1BKHA 2B7NA 3IVSA 2CLLA 2VEKA 3ICJA 4JFUA 2FKPA 4UMBA 2HSAA 3HIJA 4E2VA 4GIEA 2GDVA 2WZHA 4YTTA 5FAJA 4XO7A 4KWVA 1EOMA 4S2BA 2AQOA 3OODA 4PUKA 3H7RA 1TE1A 2HNEA 1DXEA 4IPNB 3OLDA 1Q8JA 3L4UA 1Q7QA 1REQB 2QUTA 4Y8FA 2D0HA 1ZP4A 3V5OA 2PF0A 4JHZA 2E1WA 4BEUA 4BHYA 2VX5A 1UJPA 1V0MA 3UPWA 1HO4A 2ABBA 3VD9A 2A3CA 4W8BA 3WMLA 2ZUVA 4TV6A 4PTXA 3VNLA 3N11A 3FY1A 3VGFA 4RZ4A 1EHAA 2CFFA 1Q6CA 1VJSA 2P1FA 3ENLA 4ATMA 2X30A 3WQGA 3NQGA 1U5VA 1CWYA 3ERCC 3H24A 5D2YA 3HB9A 3OYZA 3C2VA 1AG1O 4L9ZA 2HROA 3AJ7A 2FZMA 2CCRA 1IE7C 3GU2A 3EEGA 2CLEA 1PX8A 1I2NA 1PZ2A 5FJTA 3O3NB 3H4WA 2DORA 3VDGA 3FJNA 3BAJA 4OT7A 4OJYA 3E38A 3UZZA 1RUSA 3LMFA 1OJXA 2RFGA 3G3DA 2Y89A 3S9ZA 4BK9A 3N2BA 3T7VA 2DQWA 3MWCA 3SCVA 1W5QA 3ES7A 1W1PA 2PODA 2EQDA 1CXFA 2Z1KA 1H7RA 4R5LA 1CDGA 3T49A 3SGUA 2DPEA 2UY5A 1PZ3A 4ZTXA 1MUCA 3B8DA 4F2UA 5A1AA 1XBVA 1F3TA 1R38A 3R2GA 5CGTA 2G3FA 2Z29A 3R1ZA 4EZXA 2CZVA 1LRQA 4HHLA 1E55A 5HUPA 2X2GA 2Y61A 1T96A 4AHPA 4C6CA 1TPVA 3EXTA 1AFSA 1BTCA 3P3BA 3BQ5A 3LU2A 2JKAA 3SY8A 4IPLA 1LOLA 2E68A 2DZVA 4MGGA 2VDGA 3W7KA 1OYAA 3SAZA 1F4HA 3IRSA 4LCQA 4NL1A 3PPGA 4H01A 1TPC1 6ENLA 2ASHA 2OELA 1TWIA 3EX3A 5KBPA 2WKJA 4GZEA 1O6IA 4EK7A 5G2HA 3TTQA 3WMBA 3W74A 2ZC1A 4FIQA 4G5DA 2FZ9A 1G4TA 3BDKA 1HKMA 4QG6A 3BVJA 3OZPA 1BSIA 2F8QA 3WX7A 4QEHA 2R94A 4CQ8A 2DVXA 3TC7A 1DJGA 3UPMA 1KW1A 4AZ6A 1EDGA 1MRQA 2G3NA 1OHLA 3W87A 4KH2A 3ER9B 3UA3A 4B2DD 1KGXA 4O50A 2W4XA 3W83A 3WD0A 3RLGA 2QCHA 3W85A 2ALRA 4PO2A 1LL6A 3S6TA 2PGRA 1XS2A 1B90A 2A21A 3TJLA 4FNQA 3RRXA 4IHCA 2FH8A 1RVGA 3MI2A 1DHPA 3TIMA 2WKGA 5E93A 1D8WA 2VRKA 5A6BD 3L2LA 3SW6A 4QR6A 5C71A 4GOAA 3MSDA 4NRSA 1ZY9A 3QRHA 1XM3A 1EIXA 2QZRA 4LUJA 1AJ2A 1N8FA 3MSYA 2VVSA 4LAZA 4UTWC 1KQZA 2PBGA 3K8LA 2WC4A 1OYCA 1OX4A 4JTGA 3BANA 4EAYA 4KESA 4ORMA 4ZTYA 4QAWA 2NT0A 3BCFA 3BUIA 1M9HA 3IANA 4LQ1A 3QM3A 3VMNA 4DXKA 5ABTA 4R7OA 2V5KA 4PCPA 1A5CA 5DQPA 3VX0A 4F0HA 2R9RA 2WJEA 4MUPA 4YVXA 1KFLA 3VI2A 3INPA 4DLFA 2QEZA 4HA0A 1OG6A 4GX8A 2OWCA 3R89A 3RITA 5CLTA 3CZSA 5C9WA 1GT8A 3QTGA 1AQFA 1E1CB 4E3CA 1MEIA 3WQ6A 4DWSB 1H7PA 4LYPA 1KO0A 2JNSA 2PDQA 1XH2A 2YIHA 2ISSA 1XYFA 1TELA 6A3HA 5D9NA 4JTCA 4QE1A 4DUWA 3HGRA 3MYPA 3M07A 1TTQA 2Y85A 2WMHA 2WSPA 3R6IA 1UKQA 1OM0A 3C2YA 1B2YA 1ECEA 2NV9A 3W7NA 3LK6A 4PODA 3EDFA 3POCA 5A2CA 1UD6A 2RAGA 2PWEA 3VKCA 4DAFA 3P62A 3TXVA 4MIMA 3FXGA 4LS0A 4FLQA 4AIUA 1OINA 4WDXA 3RAOA 3NQAA 4D1IA 3H2OA 1TPB1 4Q8VA 1ZHAA 3AHVA 3AXXA 2WPGA 1JR1A 3TJIA 3RM4A 4R27A 1TCDA 3G1YA 3KVJA 5A8GA 1N8IA 4JICA 1OBAA 3TONA 2EPNA 3UY7A 3CAZA 2NV1A 3QE6A 2QUNA 1CECA 2VGBA 3GVVA 3LMZA 5BMXA 2UWFA 4OFCA 1MWOA 4FK9A 1JEZA 4HNNA 3W7IA 2E6AA 1LQ2A 4QE5A 3CASA 3QY6A 4KEVA 1QK2A 2IXUA 3ARRA 1QW8A 2W66A 2XDFA 3ZVIA 1FWIC 2H8ZA 3S2CA 1A49A 5HNUA 1DQUA 4B5UA 2PDXA 2E8YA 3HF3A 3QZAA 1CGTA 1GVQA 2QLYA 5G1YA 3E2QA 2ZQ0A 1UBPC 2I56A 3I10A 3APYA 1M04A 3CU2A 2QCLA 4UTWA 3NURA 4B16A 3W24A 1CGXA 5EGRA 5AN7A 5HMDA 3EWYA 1OC5A 2QPSA 2H9AB 2GF4A 1XSJA 3V36A 1UWRA 2F2HA 1HJVA 3HM7A 3DC8A 2QCMA 1XW8A 4H7CA 4EZOA 4IQLA 4UQBA 3NEVA 3WF1A 3UR2A 1RCXB 2WVTA 1H0GA 4DRSA 1EQCA 2WAGA 1O94A 4JTEA 4KIKB 3W00A 4KIKA 3RO8A 1L0PA 5BXTA 4RDYA 2BSLA 4LU0A 1HX0A 3VAVA 1XBXA 3TP4A 1UG6A 1HF6A 3A98A 2ND0A 4JFWA 4XB3A 3QF0A 1G7VA 4G7EB 4QG9A 5XINA 4YYFA 3A9IA 4O1FA 2E6DA 5HA7A 4PULA 4IIEA 2Z27A 1DJQA 4ZGYA 4PTDA 4TR9A 2Y24A 3MCMA 2ZZ7A 3T08A 3BJTA 1EO7A 4NZ4A 4LVBA 2Z7KA 4LYQA 5GQBA 4LXFA 2G96A 3GDRA 1EQPA 1Q45A 3QVQA 3WBAA 1CIUA 4L65A 1MEHA 5KITA 4GFSA 3GTNA 3NZQA 5FJIA 3MP5A 4P8XA 1JYWA 1QHPA 4Q4KA 3V5FA 4DWSA 3LN3A 5I02A 3ARSA 4EWND 1J10A 2R91A 3BG9A 4PB4A 1MEWA 3L5AA 2OKTA 5D02A 4UXDA 2Y70A 4WJEA 2D3NA 4GJIA 4UTLA 4ZR8A 1J01A 1H62A 3ITGA 2QJNA 5AHNA 3QR3A 4OBTA 1UR1A 1POJA 1O4UA 3U5YA 3WD2A 4O4VA 5A95A 1VPXA 4PBFA 4J5NA 3WD4A 1BAGA 4GHRA 1FWJC 5CBBA 3R8RA 3FKRA 4DX3A 1Z89A 2J47A 4D8AA 4S3DA 1JZ2A 2R1MA 2ANUA 1OIMA 1EEPA 2A6NA 2DSVA 4CNNA 4K2SA 4IGHA 3FDKA 3EMCA 3PR2A 3QZ6A 3MC5A 4U5IA 1JUEA 2X42A 5CSUA 4GJJA 1I4LA 4HGXA 4AWTA 1YNQA 2OW6A 1WDRA 3D3FA 1BF2A 1U22A 3WQCA 4MJ2A 5AYXA 3VGGA 4Z17A 1GCYA 4ZB2A 1Q85A 4Z42C 5E6YA 4M6QA 2Z0VA 3WUGA 1DJIA 3AWNA 3MBFA 2EPHA 7ENLA 2YDRA 2QGHA 3R8HA 2V81A 4WLCA 4XZWA 2YIAA 4S3AA 5T9BG 3T07A 3E02A 1MI3A 2NXIA 2Z2AA 1TREA 4S3FA 1TJ1A 2VR4A 2Q8LA 4CU8A 1IXOA 4K1GA 4AMCA 3ER8C 3LCGA 4WDUA 5EPDA 4BQ3A 4RPQA 1ITQA 1V8EA 1TG7A 1V3KA 2WSKA 4W84A 3QXBA 1M7JA 4NZ3A 5CPTA 3ZYZA 2BTMA 3QR1A 2P50A 2HNHA 2VFGA 4UDXX 3V1PA 1CXKA 4FAMA 5BRBA 4S3JA 3IGSA 5C9UA 1J4EA 1AMKA 1TJ0A 3GG0A 1ENUA 2Y5SA 4K1WA 4QLLA 1LROA 4XVEA 2BZNA 5I06A 3RV1A 2DSUA 2V0TA 4G6QA 1W1VA 3DFNA 2E1DA 1TR9A 4GGBA 1I60A 3BW4A 3G8EA 4HA1A 3I39X 5FJUA 1KD0A 5HUOA 4Q8OA 5G4WA 3GK0A 3HPSA 3LHTA 3MV11 4TU1A 4KKXA 2NXHA 1JPHA 1A0EA 1VKFA 5U4NA 3OIXA 2WNWA 4S3KA 1VBUA 4QP0A 2C18A 2WSQA 4M3PA 3OA3A 4PE8A 1W91A 2AAAA 3MHGA 3CUXA 3OGRA 4GCXA 2D2GA 1B3XA 1E3XA 1DJWA 4JEJA 2C91A 2QJMA 1LOQA 1TE6A 2GOUA 4UTJA 1GN9A 1TV5A 4QHRA 4MLRA 3N6HA 4EZRA 1XR2A 3GFYA 5CG7A 1M7PA 5D32A 2ZXQA 4GZJA 2ZZ6A 3OPSA 4MDOA 1RA5A 1B3VA 2AOSA 3THQA 4IPIA 3T9PA 3LCLA 4L1WA 4A22A 4PCSA 5CJNA 1H7WA 3HJZA 3DGBA 1XI3A 1QK0A 1SZGA 2Z25A 4IIGA 4IMGA 3UXLA 3VDAA 1QVBA 1Z32X 4XAFA 2GGJA 4GMEA 1T8XA 3UXIA 3WL0A 4C6MA 1V02A 2E0PA 3PB0A 2QPUA 5I3FA 2NUYA 2HBVA 3B0PA 4H2CA 4W85A 3MUAA 2FHCA 2XWEA 1EJXC 4JXCA 3HPAA 3EYPA 3M64A 2Z24A 4Z1BA 4Q4QA 2OZTA 3AHYA 3KBMA 3SCSA 3V7PA 2O9TA 3OVPA 1W3LA 1SMDA 2Y8UA 4E6MA 1M68A 3MCNA 3WG6A 2CETA 3SRDA 1MQQA 1YTEA 3C2FA 3EKGA 5DBTA 4YWSA 5K2ZA 4UFMA 1BG4A 1F3WA 1LQ7A 3M47A 4WOZA 4ACYA 1ZL1A 1RLCL 3QYSA 3NTYA 4J27A 3G1RA 2V5DA 1VIWA 3WUBA 4LNYA 4B90A 5DN1A 4E81A 1ZAIA 5K7JA 4YWIA 4DNMA 3W28A 4N6EA 3LBMA 3CUHA 1UWQA 4IJBA 4JTQA 4QJ4B 3N6JA 4DI9A 1EP3A 4AEFA 2EHHA 4JTJA 4CNTA 2GUYA 2H3BA 2BWGA 1HL2A 2LLEA 4HP5A 2F9RA 5BWAA 3C4UA 3TC6A 4PA8A 4GY7A 1VP5A 1PL9A 2J6XA 4A8RA 2JF7A 3LMYA 7TAAA 1W1TA 1H3GA 2E6FA 2ISDA 2J7GA 4H6EA 3PJUA 2CKSA 4TX9A 1T7LA 2OEJA 3AS1A 4MZ1A 3QW3A 1W3HA 4EE9A 2R8WA 4AIBA 4US5A 4S3CA 4Y7EA 4C5YA 4ERAA 4HMDA 1X1OA 1FXPA 3TOYA 4EZZA 2PRLA 4ERIA 4UQ9A 3G18A 3I04A 1MMFA 3W71A 1P1XA 2QF7A 2Z28A 5HAOA 3A13A 3A12A 1JGMA 5BRQA 3FAWA 1GYLA 3Q65A 4AIEA 4YS1A 3UNDA 4KWWA 4J3TA 4IGSA 2P8CA 5FLEX 3BSMA 2DVUA 1V79A 2PDLA 4XZHA 3PY2A 2POTA 1GOMA 3ARWA 2FHFA 2VEGA 3KOFA 3NYDA