2YLLA

Inhibition of the pneumococcal virulence factor strh and molecular insights into n-glycan recognition and hydrolysis
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
436
structure length
436
Chain Sequence
AMNEKLAKKKIVSIDAGRKYFSPEQLKEIIDKAKHYGYTDLHLLVGNDGLRFMLDDMSITANGKTYASDDVKRAIEKGTNDYYNDPNGNHLTESQMTDLINYAKDKGIGLIPTVNSPGHMDAILNAMKELGIQNPNFSYFGKKSARTVDLDNEQAVAFTKALIDKYAAYFAKKTEIFNIGLDEYANDATDAKGWSVLQADKYYPNEGYPVKGYEKFIAYANDLARIVKSHGLKPMAFNDGIYYNSDTSFGSFDKDIIVSMWTGGWGGYDVASSKLLAEKGHQILNTNDAWYYVLGRNADGQGWYNLDQGLNGIKNTPITSVPKTEGADIPIIGGMVAAWADTPSARYSPSRLFKLMRHFANANAEYFAADYESAEQALNEVPKDLNRYTAESVTAVKEAEKAIRSLDSNLSRAQQDTIDQAIAKLQETVNNLTLTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-N-ACETYLHEXOSAMINIDASE
publication title Inhibition of the Pneumococcal Virulence Factor Strh and Molecular Insights Into N-Glycan Recognition and Hydrolysis.
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 175
structure length 436
sequence length 436
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2011-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.90 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 AF1782-like 2yllA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2yllA01
5IFTA 1VFFA 1UD3A 1G0CA 1CGXA 4UFHA 1SYTA 4AISA 3AS0A 3VD5A 1R86A 4BCEA 4Z2JA 1UR9A 1FH9A 4YHGA 4BQ4A 2PC8A 4UFJA 1E6QM 2QMKA 4IUGA 1GOQA 2D23A 1PZ2A 1QHZA 2O9OA 3ALGA 4P7RA 3CO4A 3UCQA 3SCOA 3I3EA 4E8DA 4HOZA 1XCXA 2AAAA 3IAQA 3VUPA 2VC9A 2VCAA 5A8PA 2WSPA 3M7SA 4RE2A 3VINA 2ZXQA 2AOSA 5TD4A 1FP8A 5A6MA 1JYWA 3LPFA 1EHAA 4PYSA 3THCA 4QCFA 5I5RA 2E0PA 3OGRA 1E73M 3NJ3A 5FCZA 4NSBA 2OWWA 3AXXA 1LLOA 3GM8A 5GPRA 4PUDA 4ACZA 5M3WA 2J62A 4WIWA 3PZ9A 3ZR6A 4N0RA 3DYMA 1OBAA 5BXSA 4Z2HA 5CZKA 5I3DA 2Y8KA 1W9UA 2D3NA 2ZWYA 4PMXA 5CXPA 3QOMA 3OLDA 3OLIA 1OB0A 1H1NA 3VGBA 4WJXA 1K9TA 1R7AA 1ODUA 3FAWA 1M53A 2J78A 4ZE5A 3WDQA 2QF8A 3AIRA 1E6PA 4EANA 3WFZA 1FP9A 1UR8A 4PCTA 3HU7A 1V6WA 4JFWA 1PPIA 1HN1A 2DEPA 2UWFA 4J3TA 3EDKA 2A3CA 5I77A 2G3MA 2XVPA 5IFPA 4AD2A 1B1YA 4P7OA 4W5ZA 4B16A 1W3JA 4PTXA 2YA0A 1JYVA 1CGTA 1DWJM 1W1PA 1FHLA 4UQDA 3MMDA 3RILA 1H41A 1QNQA 2OWXA 1MW2A 2YL9A 4M81A 1KXVA 3NCOA 2VJXA 2WMJA 4FLSA 4TTGA 3WELA 3PTKA 3IAPA 3PN8A 5GQBA 1YHTA 5IXEA 4WSKA 1QNSA 2W5FA 1E72M 5JIWA 1BVZA 1GOMA 1W1VA 1QBAA 3CUGA 4DWSB 2QLYA 2E4TA 4Z2LA 5CSUA 2XVKA 2VZTA 1W1YA 3UETA 3WENA 1QHOA 2VRQA 3S2CA 1EH9A 3BLPX 3SCVA 2FH8A 2OSYA 3MUZ1 8CGTA 3BAJA 1JZ8A 1V6YA 4P8VA 3SCTA 3VIOA 1JFXA 5JBDA 2J7BA 3K46A 1JZ2A 1BSIA 1JF6A 4TVDA 5DMYA 4TVCA 2VT0A 1US2A 2DSZA 5BYWA 4BQ3A 4J3WA 1V6XA 1OIMA 5E70A 4TUFA 2PB1A 3MUAA 1R85A 1Q6FA 3DHPA 1V6VA 4OIFA 5AC4A 4HA4A 2BV9A 2V38A 2J79A 1D3CA 2VO5A 4CN4A 2OSXA 4MDOA 4WKHA 4AZ6A 1B3WA 1Q6EA 3AIUA 2O92A 4J7RA 2PWHA 5A6BD 4H41A 1KWGA 2NSXA 4MAZA 3WSUA 2DT3A 1Q6DA 2YDSA 1ZBWA 2C7FA 1EO5A 4D6EA 4J3VA 3WH6A 4Q22A 1NOWA 4W7UA 3VD9A 2QPSA 4LQ1A 3SCNA 3AOFA 3PZQA 3VD3A 2ESCA 1WDRA 3MSGA 4R27A 1H5VA 4J28A 1GUVA 4QDMA 1QI0A 4FLRA 1C91A 4J27A 4BQ5A 1PX3A 1CLVA 1OM0A 1WZMA 1H2JA 3ARYA 5KEZA 1OT2A 1K9FA 3U7BA 1GHSA 1L8NA 1QW8A 1TR1A 3L2MA 4PUEA 1UD5A 2GDUA 3IJ9A 2O9PA 1V08A 1BYDA 2EBNA 3AIBA 3DYPA 3WY1A 1GVYA 1VIWA 1CECA 1BQCA 3SCQA 3O9NA 3GYCA 4H7VA 4XV0A 3GDBA 3ZMRA 3AZSA 4KMQA 1NQ6A 3VX0A 3PZGA 3L2LA 1TVNA 2DDXA 4PMOA 1E3XA 3T09A 3BLKA 2FHFA 2VRJA 1B3XA 1KB3A 2PWFA 5D9PA 1XD0A 2Q8XA 3VNZA 2CCRA 1LWHA 1E71M 4D72A 4HMCA 1CDGA 2BHUA 5A2AA 4BF7A 1IZJA 1NWRA 3T2OA 2XM1A 3VGGA 4AXNA 1Q6GA 1E5NA 1V3HA 1XH0A 1CBGA 1WE5A 3SUVA 5ABHA 2W4XA 2GK1A 3UEQA 3BH4A 4CCEA 5HDRA 1QVBA 3T0DA 1GHRA 1XYFA 2JE8A 4AC1X 1O6IA 2A3HA 1I1WA 4XZBA 4CUCA 2VQUA 4MNKA 4X0NA 1PEZA 3RM4A 2FH6A 1UH4A 1HVQA 3GNPA 2E9MA 5BWFA 1DWGM 2XFRA 3OB8A 3CHFA 4HMDA 4P8WA 1LF1A 4OKDA 3RM9A 4J3SA 3BSHA 4CKQA 1W1TA 2DSUA 1LG2A 2ZX9A 4UZSA 4J3UA 2Y2WA 1V3MA 3ZQ9A 2WVVB 4U5IA 3A4WA 2J25A 4JFVA 1JDAA 4CCDA 1YQ2A 1XD1A 4D6FA 3HJEA 1JI1A 2Y4SA 2WMIA 5A6JA 3MV11 1XV8A 1R8LA 2DSVA 2G4FA 3AROA 1C7TA 3SUTA 3SUUA 3UG4A 4EKJA 3EDEA 3WUEA 4WSJA 1GQJA 1JNDA 3U7VA 4GI8A 4UOZA 1JF5A 2JF6A 1FOBA 3W29A 1OSEA 1R87A 3VDBA 3AICA 1QI3A 3VKKA 3FN9A 1W91A 4TXEA 1V02A 1GW1A 4QFUA 1D7FA 3ARSA 5LA0A 3CTTA 2F8QA 3UR8A 1EDGA 2JIWA 2XG9A 5A6BA 5JUVA 4H8HA 4JFSA 4HU8A 4MDPA 2ZUWA 2VR5A 1GOOA 5EMYA 1H09A 3EDJA 1W3KA 3SEPA 1JD9A 3J7HA 4PBGA 1GQLA 3CGTA 2B31A 1VB9A 1EDQA 1ECEA 3ZT5A 4D6IA 4U31A 1FFQA 2IXUA 3AMGA 2DT1A 1ODZA 4W89A 1VEOA 2ZUNA 3B9AA 1GOKA 5FL0A 3AXIA 1JNEA 4DUXA 1CIUA 2OLHA 2J75A 2W63A 4AD4A 3WNLA 2FHCA 3WL1A 1JGIA 1W9XA 3BCFA 3GBEA 4W84A 2UY3A 1HJVA 1GJUA 3VDHA 1W9DM 5DFAA 4L4OA 4W5UA 4RE3A 5E6ZA 2GJXB 5CLTA 2VVSA 2CITA 1A47A 4KRTA 3VM7A 2CEQA 3NSMA 2NT0A 1A3HA 4U5KA 1B3YA 5A1AA 3ARVA 4CVWA 3ZSTA 1CNVA 3PZOA 4H2CA 4CD8A 3MS8A 1EA9C 4Q7NA 4D6CA 1KQZA 3A4XA 1OIFA 1DP0A 1WCGA 5D4YA 2DSKA 4K68A 5JBFA 1JXJA 1F4HA 3AYSA 4HOXA 3I3DA 3W24A 2W66A 2EPLX 3EBVA 4AYSA 1X1NA 3KWXA 1C8QA 4NZCA 4QP0A 2Z1SA 1C7SA 4PMRA 4CU8A 1GJWA 2DPEA 5I0DA 3ARRA 3T0BA 1VJSA 4JL1A 1HX0A 1MXDA 5LA1A 4AD0A 2GK1B 2J77A 3QR3A 4AWEA 3EMZA 1NP0A 2V3DA 3BXWA 2WMFA 3CZGA 4UQAA 4FLOA 3WD0A 3W53A 4DM1A 4ZENA 2WHMA 2E8ZA 5DF0A 1M01A 1BPLB 3EDFA 1V3LA 3AJ7A 3FAXA 3WL0A 1VEPA 3ZR5A 1DWIM 1I75A 3O2LA 3CZKA 1ISYA 1QNRA 4LYRA 4AZCA 3M46A 3SUSA 3RJXA 3KZSA 1TCMA 1CEOA 3WQ4A 4UOQA 2D20A 1OD0A 2ZUMA 4UOJA 1BGAA 2VX5A 4TVUA 5E0CA 4UFMA 3VTRA 4XUYA 1MFUA 3ARPA 1UWUA 1H4PA 3N13A 4HPHA 1JI2A 3ECQA 5CJ5A 5IHSA 1CXEA 2D22A 3K1DA 1JZ5A 1WB0A 3RIKA 3SCUA 2WHLA 2QMJA 2VZSA 3K4AA 4MJ4A 2C8NA 1QOXA 4UQEA 2OYMA 4PMNA 5D9NA 3MU7A 2WK2A 3QGVA 4QCEA 5ABEA 3O6AA 3W27A 3W81A 3PZIA 5A69A 3ZT7A 2OWCA 4AEFA 4C7DA 1EOKA 2EPOA 5HOSA 2GFTA 4FK9A 1EGZA 3VIPA 4CU7A 3N9KA 3WQVA 3SCPA 1JDDA 1KGXA 2CERA 3WUGA 4HA3A 5I78A 3TTYA 2ZUVA 3NDYA 3AMKA 4NRRA 3MO4A 3VGDA 1V0LA 1MXGA 2WWCA 1DHKA 1KFWA 1KQYA 1HP4A 1FA2A 2V3GA 5FIPA 3UG5A 1RD6A 2WC3A 3VILA 1NH6A 2D3LA 3WF3A 1EIBA 3WD3A 2EPKX 1B2YA 2CETA 3VO0A 1PAMA 1XHGA 5CQ1A 3W4RA 5CLWA 1KXHA 3WDHA 5C70A 1ITXA 1C8XA 3OA5A 1KBKA 1UKQA 3NIYA 3VIIA 1CGUA 2VL4A 4M8UA 1OINA 3U5UA 5I2UA 1H0IA 2X1IA 4DUVA 4PMVA 1GOIA 1UKPA 3MUY1 2YIHA 1E6ZA 2WVSA 1ZBCA 4W8LA 4PRWA 3VGHA 3B8SA 4PN2A 4W7VA 2WHKA 1RP9A 4UFIA 4Z2GA 1XH1A 3N11A 5CGTA 4YN5A 4B15A 1C90A 1WAWA 2PWGA 4OBRA 1SMDA 1JYNA 2WZEA 1M04A 2W61A 1W32A 1ZJBA 2G3JA 3MMUA 4GO8A 4JCLA 2ZIDA 4B3LA 4MNJA 3WQ6A 1TA3B 2WVTA 1VFUA 4UFLA 2CHOA 2ZUUA 2WW5A 4AZBA 4C7GA 2WMKA 4KWUA 3WBEA 3WNPA 2J7FA 4JL2A 2G41A 3OIHA 4EAMA 3WDRA 2PMRA 2ZOXA 1HKMA 2X0YA 4H04A 4H8VA 1IZKA 1JZ7A 2ZUTA 2JF7A 2VX7A 2UY4A 3BAXA 3AHZA 3M07A 1XH2A 2XFYA 2W62A 3CZEA 2BVDA 3RDKA 2XSBA 2UY5A 4IPNB 4LX4A 1JZ4A 1JIBA 2WLYA 4UTFA 1C92A 2W92A 2YA2A 1L0PA 1X6NA 2V3EA 1PX8A 3AIWA 2VNCA 4D1IA 5ABFB 4ZE4A 2C0HA 5AYIA 3WNKA 1RP8A 2VVNA 4LXFA 3W0KA 3UG3A 2CBJA 1TVPA 7A3HA 4DUWA 1B9ZA 4AY1A 3T2QA 4HZ8A 2PBOA 1GVIA 2BS9A 4JIEA 1WZKA 1OGSA 4Z2KA 3T2PA 3WNNA 1BF2A 3BAWA 4P7NA 1HP5A 3L4TA 2CBIA 4S3KA 3ZT6A 2BXYA 3VMOA 3WH9A 3A47A 1QNPA 5E0FA 2DT2A 2CIPA 2ZX8A 1KGWA 4D6DA 3L4XA 1HIZA 2BY3A 1EQCA 5FKYA 1UKOA 1E4IA 3ARZA 4M24A 5GNXA 1TMQA 2EJ1A 3WF4A 4BZYA 2WKLA 4OBSA 1QW9A 3AI0A 3KL5A 2VCCA 5C8BB 4WK9A 1KBBA 3AFBA 3CBWA 1MFVA 2EXOA 2GVYA 3W82A 1JZ6A 3LPGA 1EDTA 3EDDA 3VD4A 3RMEA 2XWEA 1HXJA 1ZL1A 1GQIA 1XSKA 1VRXA 2PF0A 1CGYA 3VIMA 1H11A 2BFGA 3OBAA 1UWIA 2HISA 3AHVA 4ACZB 4U3CA 1KGUA 1BYBA 1CENA 4UFKA 1V3KA 2CESA 2XUCA 4AMCA 5DEZA 4GI9A 4AZ7A 3WH7A 1MWOA 1XRVA 2O9TA 3ZIZA 1NOFA 1VEMA 2WLZA 8A3HA 3TOPA 2JALA 1J0YA 4WKAA 3AMCA 4XX6A 2J7EA 4CVUA 4HMEA 2YBTA 1CXFA 5BXPA 4WLCA 3I3BA 1KXTA 5A6KA 2CYGA 3FNDA 3LPPA 2XTKA 1LQ0A 1TUXA 3AS1A 5DT5A 3VDAA 3L4VA 3N1AA 4MTVA 1U30A 3CPUA 1UG6A 3DYOA 1FH7A 1H49A 2WVUA 4DM2A 4WF7A 4V28A 3QHNA 1LJYA 3POHA 4TX6A 1BHGA 2XWDA 5D9MA 3AQUA 4PTVA 4AD5A 3G6MA 2XPKA 4CN1A 3VNYA 4A3YA 3N17A 1DEDA 2BVTA 1ZB5A 2BXZA 5D9OA 1TE1A 3N04A 1ISXA 2JEPA 1R7OA 1WDQA 3AS3A 4B3KA 4CD7A 3G6LA 4ML4A 5A2BA 4AW7A 5D8WA 4AIUA 5A2CA 4HTYA 3L4UA 1UA3A 5A94A 3TTQA 2J7HA 3LPOA 3ARUA 4W88A 1SMAA 1C93A 3EYPA 4S3JA 1UOKA 3F5JA 5HPOA 2O9RA 1CXIA 2RGMA 1JL8A 1V02E 3WQ5A 3NYDA 1ZU8A 2J47A 2BHYA 2WANA 4OJYA 3MUIA 1S46A 4U2ZA 4M56A 1QI2A 4LGXA 2OYKA 3WMSA 1JG9A 2CKRA 3ZJ7A 4PEEA 3GH4A 2JIEA 4D1JA 1VBRA 3K4DA 5HNNA 5BCAA 3VIJA 4F9DA 2XGIA 3RPMA 1XCWA 1NP2A 5A8MA 2WCSA 1LL6A 4AZGA 1V3JA 7TAAA 3CZJA 3WNOA 3AIQA 1LL7A 1GORA 1VENA 2ZXBA 1VFOA 4CD6A 4XZWA 3WF1A 3WQWA 3BSGA 2WC7A 3BMWA 3AIVA 2CKSA 2WNWA 1DWHM 1PX4A 1TFVA 3VIHA 2IXVA 4OOZA 4ZFMA 1E70M 1B0IA 1Y7VA 1K9DA 2WBKA 4JKKA 4GXPA 3VIGA 3CZ8A 1J0IA 3F5LA 1UR1A 4A3HA 1LG1A 1UHVA 1K9EA 1DTUA 3W25A 4M80A 5M17A 3WUFA 6CGTA 3CIVA 4HU0A 2WAGA 4W85A 1UWSA 3UERA 2FGLA 5M5DA 2VZVA 1RH9A 2WKGA 3TP4A 1W2PA 3W37A 3WD4A 3GH5A 2VZUA 1W9VA 2CBVA 2V3FA 1MVYA 2QPUA 1ZBKA 3VPLA 2XIIA 4AZIA 3K8LA 1KCKA 5BXTA 1WZAA 2WC4A 3CUIA 1LWJA 1V03A 5CPTA 1B31A 2ZICA 3AISA 1UQYA 2NW0A 4AZ5A 1CLXA 1BG9A 1FH8A 3AHYA 4W93A 1TG7A 1E0XA 1HF6A 3PZUA 2WHJA 1CGWA 1WKYA 2VURA 3MKKA 1E4MM 1C3FA 2Y24A 3VIFA 4GPNA 4IPLA 4V2XA 1C8YA 1GOWA 1K6AA 1AQMA 4MAVA 1HNYA 3GXMA 5E9AA 3MV01 5EFDA 4B9YA 3CLWA 3ARWA 4EE9A 2WSKA 1NOUA 2J74A 2YKKA 3D5HA 2WZIA 1H3GA 1E3ZA 1U2YA 2XIBA 5DT7A 1N82A 3GZAA 4CD5A 1BG4A 2E40A 1J0ZA 3PBGA 1JZ3A 3PTMA 1W9BM 1WDSA 3QHMA 3UESA 3U57A 2PWEA 3CHDA 3OGVA 1JAEA 3GNOA 5FL1A 4U2YA 2DIJA 4GQRA 2DH3A 4AD3A 4U3AA 3MSDA 4F79A 5AYBA 2NT1A 1E0VA 4KGLA 2EO7A 3NUKA 2V5CA 2EEXA 2YOCA 2WMIB 4YPJA 4UQBA 3K8KA 4IM4A 3WFLA 1MQPA 1ITCA 1SR0A 2Z1KA 4PMYA 3TONA 3BMVA 4CU6A 1UH3A 4B9ZA 4JFUA 1KR0A 4GINA 4MB1A 3LMYA 1UD8A 3II1A 3JUGA 1V0KA 2BHZA 5A6SA 5A8QA 1BVNP 1UR0A 1VBUA 4GI6A 3VM5A 3S6TA 4X0VA 2YL6A 1LL4A 4CCCA 3ARQA 2IUZA 1UZ1A 4MJ2A 2YL5A 1NWUA 5EB8A 3PTQA 3CUHA 5C71A 5BROA 4ATLA 1P6WA 1X6LA 4D71A 3WMBA 5EFFA 5CG0A 3AHXA 3L4ZA 2G8ZA 3F4VA 3T0AA 1AQHA 1MW0A 2AMGA 5A95A 1CYGA 1G9HA 3FXYA 1J11A 1QI5A 1B3ZA 1WZLA 2RGLA 5FD0A 1US3A 2XGBA 5JIPA 1E55A 3SCSA 2ZXAA 1J0KA 1FFRA 1ISWA 2CHNA 2DGAA 3WMCA 3AHTA 3POCA 1E6XM 2FHBA 3ALFA 3BAIA 1B3VA 3PZTA 1CXHA 2WCGA 4ACYA 3E1F1 1CGVA 3IJ8A 2EPMX 2VR4A 2X2YA 3AMLA 3SCRA 1HKJA 1HJXA 4Y7EA 1E9LA 4BQ2A 4HP5A 4QAWA 3W28A 1J12A 2MANA 3CHCA 1XGZA 4Z2IA 2YA1A 1V3IA 3KE0A 4U33A 3ZM8A 3ZJKA 3A4AA 3RM8A 2J7GA 2VOTA 4L4PA 6TAAA 3VIKA 1ISZA 2EPNA 2WZHA 1UKTA 1G01A 3AMDA 5AC5A 1E6SM 1UZ4A 4ATWA 3OLGA 4EK7A 4QLLA 2JEQA 4BA0A 4P7LA 3SUWA 2BNJA 3WDPP 1OCQA 3OZPA 3WF0A 1O7AA 3CH9A 4JHOA 5EBAA 1E4NA 3WEMA 4ZEPA 1E43A 3AYRA 1OD8A 9CGTA 2X0HA 4F8XA 2WMGA 1PIFA 5DO8A 1Z32X 3KL3A 1JAKA 1E1EA 1E15A 4P7QA 1UUQA 3ARXA 3QOKA 4AZCB 1ZBVA 2PI6A 3ZJ8A 2WBGA 2X05A 4AZHA 4E2OA 2WVVA 4PMQA 1CPUA 4JHZA 2YDRA 2X09A 3MANA 1QPKA 1HKIA 3GXDA 4MPKA 3VVGA 2XJ7A 5CSYA 2GJRA 1OGBA 4A4AA 4F66A 1D2KA 1JFHA 2V5DA 2E3ZA 1UD2A 4HPGA 1BTCA 3PHAA 1GPFA 7CGTA 3DC0A 4UNIA 1OT1A 5GNYA 1HJQA 1UD6A 3NSXA 2W67A 4GO9A 1EHNA 4E4PA 4JKMA 3VD7A 3WH8A 4LYQA 3SIMA 4PSPA 3NSNA 3KEHA 4PMDA 1MQRA 3IK2A 1OWQA 5BXRA 2QV4A 1W2VA 4WKFA 3AZRA 3THDA 1VFMA 1WP6A 1WDPA 2CBUA 4OOUA 1NWSA 1HL8A 1HJSA 3CHEA 4JZ5A 3AS2A 4OZOA 1KXQA 2JNKA 2XYLA 1JXKA 2YJQA 4XB3A 3GXIA 2VMFA 4MADA 1VJZA 4W8AA 4NRSA 1SFSA 3CUFA 4KH2A 3AXHA 5LYRA 4W8BA 4QLJA 2QHAA 2WWDA 3MMWA 4TX8A 2VX6A 3BCDA 3CZLA 6A3HA 1B30A 2UY2A 3ARTA 3N12A 1J0JA 2J7DA 5HBFA 1V0MA 1VAHA 1JD7A 2XM2A 1WO2A 4UZUA 1RPKA 3WNMA 2A3AA 2OSWA 2D0GA 4HA1A 2G3NA 3L4YA 2GJPA 4OUEA 3VMPA 2XVGA 2GJXA 4RL3A 4FF5A 1E4LA 4GZIA 1BAGA 4UCFA 5LA2A 3RJYA 4MB5A 3BAKA 5KZ6A 1NWTA 1W9PA 4NI3A 5F7UA 1JYXA 2OO2A 5I24A 1MQQA 1HJWA 2ZUSA 4BS0A 2D24A 2EQDA 3OG2A 2WYSA 3WIJA 4M29A 3VOCA 1KWKA 3UR7A 2VZOA 5I79A 3F5KA 1AVAA 1OGGA 3M6DA 4D6HA 4PTWA 2DQXA 2XHYA 4H8UA 4KRUA 3WKZA 1CXLA 2GDVA 3A6OA 3VGEA 3VGFA 3B9EA 1EQPA 1CXKA 1GNXA 1HJUA 1V6UA 2VQTA 4ATDA 1UWRA 3BC9A 5CPQA 4RE4A 3N15A 2JFEX 4MNMA 4TOQA 1IV8A 3DECA 4AIEA 3FHAA 3WD2A 4PCSA 1VF8A 3DHUA 1Q4NX 3OZOA 1BFNA 4W7WA 2VTFA 2YL8A 4HZ6A 1HVXA 4DWSD 4J3XA 3EMCA 4MB4A 5CPSA 2Y5EA 5ECUA 5A6LA 2BVYA 2OZNB 4CD4A 3WDIA 3ZOAA 1UWQA 3K8MA 1Q6CA 1XC6A 4AEEA 5A8NA 2J8FA 1BGGA 2DH2A 3GNRA 4MB3A 4PSRA 3VDCA 1KR1A 2E9LA 3VX1A 1EO7A 4HOWA 5E6YA 2WM0A 4FMVA 4JAWA 4AD1A 3TTOA 2YLAA 3W6MA 4UQCA 5AY7A 1QBBA 2CXGA 3OLEA 5HXMA 2DSWA 4E8CA 1WNOA 1J9YA 5IDIA 1U33A 4D6JA 2WCAA 3ZJ6A 1E40A 3TTSA 3RCNA 2VRKA 1QI4A 3VU2A 1CWYA 4LPCA 5D8ZA 1V0NA 3B9DA 1BYCA 3WD1A 1XSJA 1XYZA 3L4WA 2ZE0A 3TA9A 1NARA 3WEOA 3WUBA 1HKKA 5ABGA 3VMNA 5I6SA 3ZO9A 3WF2A 2WXDM 2PBGA 5GNZA 4GZEA 2BY1A 2FGZA 1EXPA 3PZNA 3WDJA 2WMHA 2ZX6A 2XVLA 1H0GA 2J8GA 3IJ7A 3HN3A 4X9YA 4HZ7A 1WPCA 1E5JA 4GIAA 1MW1A 4P8UA 1GQKA 1G1YA 2F2HA 4W86A 2TAAA 4GKLA 2WB5A 5CGMA 4PMUA 1FHDA 1W3HA 1J0HA 2CNCA 1I1XA 2VUYA 1IT0A 2BY0A 3WN6A 4QLKA 1UQZA 2XSAA 2GUYA 1UWTA 1ZS2A 1AQ0A 1JDCA 2GSJA 1UD4A 3PZVA 5A6AA 3NDZA 3ZSSA 2YBUA 3FW6A 2E9BA 4NF7A 1HL9A 5I23A 1G5AA 1UR4A 1J10A 1E0WA 3WBAA 1F4AA 3N18A 3FHQA 3U5YA 3HMCA 2HVMA 1W3LA 3W26A 3BGAA 4FZPA 2DT0A 4IISA 1AMYA 1UA7A 3CUJA 2F61A 3GH7A 3D3AA 4M82A 1E56A 1UYQA 3CMGA 1E6NA 4JKLA 4LYPA 2PWDA 2CPUA 3GTNA 2XVNA 2J7CA 3SURA 2DIEA 3FY1A 1J01A 1DWAM 1HT6A 4TTUA 3BAYA 2X8RA 2D0HA 2A3BA 3IANA 3WEZA 3GBDA 4GQQA 2J4GA 1TA3A 3A3HA 4F9JA 3WH5A 4FLQA 1QNOA 4KGJA 1M7XA 4V27A 1PIGA 2A3EA 1GCYA 3AZTA 1CZ1A 1XSIA 4C7FA 4ZXLA 1QHPA 1ISVA 5JBEA 2G3IA 1MYRA 1GZJA 1UKSA 4DWSA 5HPCA 1UH2A 4FZOA 1BYAA 2WPGA 3GXFA 1E1FA 4UQ9A 1ESWA 3W6LA 4DWSC 5E09A 2ZX7A 2XFFA 2VX4A 2ZWZA 4D6GA 1BLIA 4UR9A 4ZXOA 1ZJAA 5BRQA 2BY2A 4JCMA 2FDMA 1CTNA 5IHRA 3OGSA 4M1RA 4P8XA 2YLLA 4N42A 3RO8A 5ABFA 4MNLA 1B90A 3PZMA 1E6RA 1NM9A 3T08A 1TZ7A 3AIEA 2OYLA 4URIA 5FOOA 3EMQA 4R5EA 3QHOA 2D2OA 2D0FA 1KCLA 4JFTA 2W91A 4PTMA 1PJ9A 4CGTA 2E8YA 4W87A 4GZJA 3SCWA 5A8OA 3APGA 4YHEA 1J18A 4PMZA 3WQ8A 1UR2A 1GONA 1PZ3A 2YDQA 2Y8VA 2D1ZA 3W38A 1EOMA 3KL0A 5M03A 2VI0A 1G94A 1PBGA 4CN6A 1MW3A 5BRPA 5A3HA 2VCBA 2ZX5A 1DWFM 4AIOA 1M03A 3CMJA 2ZXDA
chains in the Genus database with same CATH superfamily
5H2ZA 4IWOA 3VA8A 1UD3A 1G0CA 4QEEA 1SYTA 4GBDA 1RVGA 2HS6A 4BCEA 4Z2JA 1EJVC 5FSEC 4KEVA 2PC8A 3SECA 2D23A 1WKDA 2W6RA 3PBMA 1B5TA 1T7LA 4IJBA 4ZTYA 3D2FA 5EBUA 3IAQA 2NUWA 2E5BA 2WSPA 3T6CA 1V6TA 4A21A 2DZXA 2PP1A 3TA6A 2ZXQA 5TD4A 4JTJA 1JYWA 1GOXA 1EHAA 4PYSA 3CWHA 4HPJA 2YCKX 3OBKA 3OGRA 1E73M 5FCZA 3W1PA 3W1AA 4QITA 1LLOA 3RNDA 1UBSA 5GPRA 2ONEA 1RJRA 3QV8A 1YE6A 4ZB2A 2E5DA 3ZR6A 4R5GA 5BXSA 5CZKA 1XL9A 4O53A 5I3DA 3QV9A 4XSMA 4M7SA 3IVTA 3RFAA 5CXPA 4JEQA 1OB0A 1H1NA 5TF0A 3VGBA 4L6HA 4WJXA 1LQ7A 4ERAA 1R7AA 1F3TA 2NXGA 1A80A 3LEPA 2P53A 1M53A 3MB9A 3RLHA 4ZE5A 3G8RA 4EANA 3WFZA 2HWGA 1FP9A 1UR8A 3PAJA 4TQTA 4J3TA 3EDKA 4L9XA 2VDHA 3OG3A 1HTIA 1BRLA 3HAHA 2ZYFA 5IFPA 4BI5A 4B16A 3P0XA 3SQLA 2YA0A 3B03A 3STEA 3HBLA 1XDLA 7ENLA 1DWJM 4UQDA 2OWXA 1EF3A 1MW2A 4NAEB 2VJXA 3KS5A 4MG4A 4QJ1A 3ER9B 1LOLA 4ROQA 2A3LA 2WMJA 3KDNA 3W1MA 3PN8A 1OJXA 2NLYA 2BBFA 4V1XA 3EXSA 3H54A 4G7EA 5IXEA 4WSKA 1BD0A 5JIWA 3TVAA 4UTKA 4Y9MA 3TN6A 1QBAA 4ZB5A 2PU0A 4X22A 4CQDA 4GMEA 2XVKA 1SUFA 2VZTA 5C7HA 4HR1A 3R0UA 3UETA 3DZ1A 1AW1A 4N4QA 3KX6A 3QM3A 3ENLA 1KO0A 2QUTA 1QPRA 3QFWA 5EMLA 4DJFD 1ONWA 3W73A 1JFXA 2J7BA 4LEQA 2KX9A 2IPJA 4Q4SA 3UPWA 3DFHA 4YYFA 1KV8A 1BSIA 4OE7A 1JF6A 5T9CE 3BV4A 2OG9A 2PEVA 4X63A 2DSZA 4H6QA 4D8AA 3WZ0E 3T48A 1V6XA 4DB7A 3VZXA 2PB1A 3MHGA 2GDQA 3P93A 4YTQA 3B8IA 3R2GA 4JIQA 3S1WA 4IF2A 1XIIA 2XN0A 2BV9A 4HA4A 2PDHA 4GUHA 2EHHA 3BUPA 4DBEA 2V8ZA 2VO5A 4PA8A 3KOZA 5D09A 4FNRA 3MY9A 3ITXA 2ALRA 4H41A 4EZZA 2R1MA 1KWGA 4MZ8A 4FZSA 3GSMA 1E1CA 2C7FA 4L4LA 4ORMA 4J3VA 2PZNA 3WH6A 1VBGA 4W7UA 2ALDA 2GWNA 3H26A 1Z69A 1TRIA 4CNSA 4DX3A 3ZS4A 3KVKA 3AOFA 3PZQA 3ITTA 3R7MA 2YYTA 4NNCA 1ZGDA 4FLRA 1C91A 3NPVA 4AU0A 1WZMA 2AL1A 1H2JA 3W76A 3TKFA 3U7BA 4GFIA 1FWAC 5LKYA 1QW8A 3M5XA 3TQVA 2GDUA 3IJ9A 3ZZ1A 2ACQA 3H8AA 1BYDA 4US6A 4A2SA 1GVYA 2OOGA 4ZO7A 4JTGA 4IP4A 3V16A 4H7VA 4XV0A 1RY0A 4TO8A 3PZGA 3L2LA 4WQ6A 1TVNA 4WGXA 3BVTA 1K77A 2FLIA 3ZXWA 4MZYA 2IQDA 1R47A 1CDGA 1FDZA 4DCNC 2QCEA 3IGXA 5E1QA 1VS1A 3QV7A 4EZXA 3P14A 3T2OA 1GN9A 4TX9A 2DZSA 1CBGA 4NNBA 4H9TA 2GK1A 1RJQA 4HYRA 4LC8A 5HDRA 3TCEA 1GHRA 2GJLA 2VEGA 3W1UA 4C6BA 1HTYA 1O12A 2WYIA 3QBUA 4XZBA 2QGHA 4C1NB 2ZTJA 4MNKA 1EJTC 4ZQPA 2PUZA 1NDWA 5DANA 3R0DA 1HVQA 1XG4A 3GNPA 4FNQA 3RX4A 2XFRA 3OB8A 3NGFA 2ZZ5A 2XU2A 4GNJA 3PB2A 2XINA 3WLMA 1AG1O 4JQ2A 4QG9A 2WVVB 5F4SA 3W1NA 3LBCA 4EPKA 3NZRA 3S5OA 4PCFA 3PSVA 2J9ZA 4GWEA 4FNTA 1OX6A 1GK8A 7REQB 1PL9A 4R33A 2ND0A 1R8LA 4DJFA 5TAOA 1TV7A 2J6VA 3WQPA 1C7TA 1L2UA 3ABHA 3USZA 4EKJA 3IEBA 3D3FA 1YBQB 1DXFA 3V0UA 2OKOA 2ACUA 1JF5A 4I7UA 4EZTA 2PGRA 1OSEA 1YX1A 4GACA 3LRKA 1YEYA 1FWHC 2O55A 3MO7A 3FN9A 4TXEA 1V02A 4DJDC 1H1ZA 3ARSA 4Q4MA 4H6EA 3UR8A 2F6XA 4HU8A 3L65A 1GOOA 4LUSB 3W7RA 1JD9A 2X1UA 1I4LA 4NQIA 5I02A 4GA8A 3CLMA 2WV8A 4LUIA 1DQXA 3VEBA 1VEOA 3ME3A 3B9AA 2Y7GA 1XF0A 1RALA 1TPDA 1XIMA 1JULA 4PBEA 1CIUA 1W17A 5FAJA 3WNLA 5BZAA 2UY3A 3M6YA 1B4EA 3W9ZA 1EZWA 4N9BA 3RPDA 5DFAA 1SM9A 3FJLA 4RE3A 5E6ZA 2VEKA 1E2UA 5CLTA 4UC5A 1A47A 4DAFA 3GFXA 4NY2A 3BLOA 3KM8A 5A1AA 3ARVA 1ZPTA 4GZ7A 2QGYA 1EA9C 1WCGA 5JBFA 4HOXA 2GQ8A 5JVLA 2QEZA 2DZUA 4AYSA 2PTYA 2PAJA 4OECA 2H3DA 4EF9A 3N6HA 3FKKA 3T0BA 1VJSA 2Y61A 1MUWA 1MXDA 1ADOA 4G1KA 4POCA 1XIGA 4AWEA 1VFHA 1YTDA 3DX2A 1N8WA 4MFEA 2WMFA 4GH1A 2XSXA 3LHZA 3B0VC 5K4XA 4ZENA 4NXKA 2WHMA 2E8ZA 1V3LA 4ICCX 3W22A 3AJ7A 4Q4PA 1DWIM 1I75A 4M3PA 4HJFA 1QNRA 1VP5A 5EYWA 1FHUA 2I17A 2DZBA 3SUSA 2RT6A 2D1LA 2D20A 3T49A 3OQEA 2ZUMA 4E5TA 1BGAA 5BRBA 3W87A 2ZADA 4XUYA 1MFUA 4DZ5A 1UWUA 1H4PA 2VUNA 1PXGA 3N13A 3ZVHB 5J8LA 1CXEA 4JEJA 1JZ5A 2HE5A 3BG5A 1Z3NA 1XLGA 3C8FA 1TTIA 4XAGA 3TZFA 3K4AA 4MJ4A 2GL5A 1WUFA 1QOXA 4HU3A 4O8RA 4LSBA 3KVLA 4X60A 1OC6A 2WK2A 3QGVA 3TR9A 5ABEA 4QTGA 4NT0A 1EJRC 5A69A 3ZT7A 3N4AA 6XIAA 3V3WA 3ZYZA 1TPVA 4FK9A 1CB2A 1ZRQA 1O94A 4GQGA 2DZVA 2DY3A 5CJMA 4GJ1A 4NI8A 3NQAA 4ZO6A 3TTYA 1ZJHA 1TSIA 3NDYA 3RXZA 3VGDA 4IOTA 1ENUA 3E02A 1DHKA 3GE7A 4YYCA 4LB3A 1FA2A 2V3GA 3RR4A 2QCDB 1RD6A 4MZ1A 1NH6A 1NU5A 1IQ8A 3L9CA 3WF3A 1EIBA 1XFCA 4I9JA 1B2YA 2CETA 3IS4A 3VC6A 3VO0A 4FHAA 4Q4QA 2LM0A 4UBPC 1OA0A 4IMCA 4UTLA 2DZPA 1RLCL 1WXJA 4O15A 1ITXA 3OA5A 3NIYA 2VL4A 3W7EA 2J88A 5I2UA 3N14A 1H0IA 4RZ4A 2X1IA 4PMVA 1GOIA 3C2YA 2YIHA 1E6ZA 3VZYA 4WPCA 3W83A 3QNJA 1OYBA 5AHEA 4U4MA 1NAL1 3B8SA 1SJBA 2WHKA 1RP9A 4KS0A 4XZNX 3RAOA 4YN5A 4ALDA 4ZGYA 1DJXA 4B15A 2A7RA 1XIHA 3QMRA 1OYCA 1T40A 1R33A 1ZJBA 4XUGA 3MP3A 2O4MA 2ZIDA 4XBKA 4IXHA 1T0OA 3LCHA 1Q66A 4ES4A 1TA3B 2WVTA 4UFLA 4A05A 2IW0A 3B9OA 3H2EA 5D2VA 4AZBA 4U10A 3WNPA 3GR4A 3OIHA 1EBHA 1L9WA 3KVJA 4EAMA 3BE7A 4H8VA 1U5HA 1IZKA 1W0MA 3SRHA 2TODA 3H12A 1TREA 4R5IA 4A2RA 3SRFA 4N9CA 2XFYA 1XPGA 4WOQA 4LX4A 4P5UA 4I9TA 1K1DA 3QKZA 1OHLA 1FCUA 3CK5A 3BICA 1GKPA 4IQLA 5CSRA 2PDNA 1PX8A 3RU6A 4AWSA 5ABFB 4O17A 3WNKA 1E9ZB 5FF0A 3W0KA 3UG3A 2CBJA 3GK0A 7A3HA 2CLPA 1GVIA 2BS9A 3CUXA 3BQ6A 4J3ZA 5EGRA 1XYAA 4P7NA 1JR1A 2I5GA 3KDRA 3H6OA 3ZT6A 4LVAA 1XLDA 2DT2A 2QXLA 3LM7A 1X04A 1KGWA 3XISA 1LDCA 4A3RA 4H1ZA 1EQCA 4R88A 2OGYA 2R94A 4DLFA 2FZDA 2CLLA 2EJ1A 4JR5A 4CNNA 1J6OA 3W75A 4OBSA 3EJTA 1QTWA 1TJPA 4GYPC 2VEIA 1H61A 1W37A 3AFBA 4AHOA 2GVYA 2KZHA 1S38A 2EJAA 2GGJA 4C65A 4Q4KA 3PJUA 5D2WA 1XSKA 2A6LA 2F18A 3B52X 1TJ2A 1GG0A 2BFGA 3H2CA 3WLPA 3XINA 1UWIA 4ACZB 4H19A 1BYBA 5I7GA 1V3KA 3L3OM 3THQA 5DEZA 1R38A 1P0DA 4C90A 2H90A 3QLLA 4KIKB 2O9TA 1MXSA 2R24A 1VEMA 2WLZA 2YX0A 8A3HA 1FWIC 3IV8A 4QEHA 2AMXA 4HK5A 3PBYA 1SZRA 3SB0A 1EP3A 3PJTA 3AMCA 2J7EA 1CXFA 3OQ8A 3I3BA 5HUOA 3DOPA 5A6KA 4DPQA 2V68A 4IMFA 3TSMA 3LPPA 1VCVA 3T4WA 3AS1A 1KRMA 4MTVA 1U30A 3ITCA 2E68A 1H49A 2OQYA 1PDYA 1H7RA 3OEXA 3RF9A 1XRFA 4Q8NA 3G1HA 2XWDA 1D8WA 3I4EA 1V51A 4NYUA 1VCFA 2BSLA 2BB0A 4JN7A 4PB4A 4CN1A 4DYLA 3UU0A 1DEDA 1XI3A 1TE1A 3T8QA 1VJIA 4HYWA 3AS3A 1X1OA 4LS2A 3W7JA 3CAKA 4UDXX 3UY7A 3V5CA 5A2BA 5D04C 4HTYA 3L4UA 1TWWA 3CU2A 3EPMA 2QDGA 4W88A 1C93A 4RPPA 2P88A 1S1PA 1UOKA 3F5JA 5HPOA 5CSSA 1QRQA 4HHMA 4MWAC 3NYDA 2C15A 3WQ5A 4Q8QA 4ZL1A 5C7VA 2BHYA 2WANA 3B4UA 4C6PA 4M56A 3QZ6A 3N2BA 3FVMA 4N02A 4ONVA 5K9DA 3ZJ7A 2Z1WA 1VBRA 5HNNA 1Q6LA 3VIJA 4BK9A 4F9DA 1NP2A 2Y1HA 2AGTA 2FICA 1RCOB 4AZGA 1D3HA 5A5WA 4QDPA 4IM0A 1VENA 1SW0A 1I4NA 3CB8A 3STFA 2WC7A 1TFVA 1REQB 4OOZA 2BZNA 2FVKA 1U5JA 2RKXA 3NQVA 3ID7A 4JKKA 1SU7A 2WJFA 3E2VA 3HGJA 5HMFA 2G96A 2FZNA 4JTHA 1RXOB 1XCFA 1Z89A 3HFTA 2PURA 2O0I1 1VD6A 3W25A 1SPQA 4M80A 4J1OA 6CGTA 3GU2A 2V5LA 3NVTA 3KP1A 4HU0A 5CAKA 1UBPC 4W85A 2ZZ4A 3UERA 1TPUA 1W2PA 1SR9A 1W9VA 2Z27A 1ZBKA 3G24A 3VPLA 2YPIA 1YDNA 4AZIA 4HY9A 1K8YA 5BXTA 3QYSA 4IG2B 3CUIA 3NFUA 2ZICA 1M9HA 3O1NA 1Z44A 4AZ5A 3AWOA 3W88A 1FH8A 2HTMA 5LNRA 3TIMA 1TG7A 3VOIA 3SI9A 4KCVA 1CGWA 1XYMA 4JN8A 1T96A 3U4FA 4F0MA 3WO8A 2DIKA 3GXTA 4IPLA 3CV2A 1AQMA 5D05A 4XK2A 3FYOA 3AU2A 2Z2AA 3TQ0A 2NLIA 3IIVA 4O4VA 5DT7A 2BASA 1YDVA 6XIMA 1DJIA 4MM1A 3TNBA 3DFQA 2CW6A 1N55A 4KWSA 1J0ZA 2ZA1A 4ZSTA 2C13A 1TV5A 2PWEA 3CHDA 3OGVA 3GNOA 1NF7A 4GQRA 2X3XA 2DH3A 4U3AA 3MSDA 2NT1A 1EPXA 2OELA 3K1GA 1OEPA 3GVWA 1L2QA 3W1LA 1EXBA 2V5CA 3ES8A 3ATZA 4H7CA 4YPJA 3LSCA 4PEKA 1CW2A 1BWKA 1ITCA 3LSBA 4YXGA 2A4AA 4JIPA 1KFCA 2I57A 1EX5A 1UH3A 2OTDA 4W9TA 2ZZ6A 4JFUA 4MB1A 1OZMA 3II1A 1V0KA 4IPJA 2HPMA 1ML1A 2BHZA 2TMDA 1DORA 2P10A 2Z24A 3CH0A 2PRMA 4I8YA 4TR9A 3LYEA 1GTEA 2AKZA 1LL4A 4JY9A 4JHMA 3GG1A 3UNDA 3BDKA 2NQLA 1EWEA 1MEHA 5EB8A 3O6YX 5I3IA 5C71A 3KBSA 1DIEA 1KM0A 2FPTA 5DELA 3GS6A 3AHXA 3IK4A 3I01A 3T0AA 2C1GA 3FXYA 4I8DA 2Z0VA 1WZLA 3PC0A 2RGLA 5FD0A 3R12A 5F2IA 1PSCA 3UCCA 2G37A 2XGBA 3QGKC 2PMQA 3TSDA 5JIPA 3A21A 1IXQA 3OBEA 1GW9A 4OVXA 4J9JA 1IIGA 3WLNA 3P8JA 2VGGA 1J0KA 2G5WA 3H4GA 1FFRA 1VFSA 2CHNA 1XQKA 3GDRA 4Q3MA 3W1QA 4FXSA 3CQIA 4JIHA 2F1BA 5AHFA 2H9AB 1P7TB 3TE9A 5C54A 1XIDA 3ITOA 3VNDA 2WCGA 4ACYA 3NQFA 4RPQA 4C6LA 4X2RA 5J04A 1JQXA 1G6CA 4L7ZA 2EPMX 3AMLA 2X2YA 1MEIA 5C0QA 3SSJA 1JPMA 1XXXA 1EIXA 4BQ2A 2OEJA 4S23A 4FAMA 2N3KA 2BXVA 2YA1A 1OYAA 3H22A 1L6WA 1UZHA 3ZJKA 4FR6A 4HIBA 3TFCA 6TAAA 1UP3A 3VXGA 1JPIA 1AMKA 1PKNA 5H6HA 3GC2A 2WJZA 3C0JA 3HMJG 4QLLA 4PUNA 2JEQA 4BA0A 4P7LA 1UOZA 1IXNA 3MMTA 1IZCA 4HQVA 3T05A 4HNNA 2ZC8A 3WF0A 1D7KA 2W27A 3DFSA 3CH9A 1FRBA 4UCGA 1BWLA 2V30A 4JHOA 4A8NA 5EBAA 2ZZ2A 1OD8A 4QS6A 1Z32X 1SO5A 1UUQA 3ARXA 1S5WA 3QOKA 3IRSA 5D02A 4AZCB 2QNEA 2PI6A 1W8GA 2X05A 3UZJA 2X09A 3LHUA 5REQB 3E5BA 3W1TA 3FIGA 4IX2A 3PK7A 3VVGA 3B0PA 1RLDA 2XJ7A 2GJRA 4A4AA 1D2KA 3O63A 1FWEC 2XIOA 3T46A 1H7OA 2V5DA 3C5QA 4EOUA 2R1KA 4X3ZA 3QVQA 4IQDA 4MF4A 2ABBA 5I3FA 5J5DA 4GO9A 4Z17A 5AB3A 1LT7A 5KBPA 1EHNA 3G1RA 2D69A 3LCFA 3TMLA 4KETA 4XAPA 2G0WA 1XIFA 3SIMA 4M6QA 5D2YA 1KW1A 4TV6A 3THAA 1MQRA 5BXRA 1XRTA 4DF0A 3THDA 3TYUA 1WDPA 4LUTA 3MDWA 2CBUA 1NWSA 2RAJA 1PKMA 3PWGA 3AS2A 3HA1A 1FKXA 1GYMA 2XYLA 4XB3A 1VJZA 3GI7A 5LXXA 1W3NA 3GDMA 1MDRA 1FDJA 4GC3A 2QHAA 3KOXA 3B4YA 3EOOA 1FWDC 2QUVA 2HROA 4R9OA 2UY2A 3N12A 2PGFA 3COTA 4AX6A 3A13A 3FGCB 4MY9A 1RPKA 4OT7A 3WNMA 1YNYA 4HA1A 2GJPA 4OUEA 5LIXX 4RL3A 4JNEA 2YCLA 4KFNA 2ZZ3A 4FF5A 3SQMA 3N19B 3RJYA 1XIJA 3T47A 3ATYA 4JPGA 1W9PA 3HG4A 2CZEA 3S47A 2Y89A 3OYZA 4IMAA 1C29A 4BS0A 4R7JA 3WK2A 5AZ1A 2QXWA 1EP2A 3WIJA 5HJLA 2VZOA 4RLIA 1B9BA 3F5KA 5K2ZA 1K6WA 1OGGA 3CQJA 1H7WA 4PTWA 3S2JA 1HO4A 3N3MA 3DCPA 4IWWA 1R46A 3IUDA 5T9BG 1H1YA 4FIQA 3ITGA 1F05A 3O16A 3RITA 1YTKA 3UZZA 3B9EA 1PCKA 1EQPA 1CXKA 3QJAA 1HJUA 4J35A 2VQTA 3E0IA 3QNIA 1UIOA 3W86A 4ATDA 4LRTA 1UWRA 3BC9A 4RE4A 2JFEX 2OZ0A 3P8IA 4XBJA 3R1ZA 4PCSA 1VF8A 2JNSA 3DHUA 1Q4NX 3WQGA 2YL8A 3EMCA 3QC3A 3NZPA 3KTSA 4UNKA 1X96A 1Q4WA 4PUWA 2DH2A 3VDCA 3LZ3A 4HOWA 5JQ9A 2WM0A 2PDFA 5AHNA 2ZCGA 3LNPA 4F2TA 1ZFJA 4M6VA 1WX0A 3BW4A 3EX3A 1J9YA 2QR6A 4D6JA 3QSTA 3ZJ6A 1E40A 4H9VA 2OJPA 4FEZA 4JN6A 3WCZA 3CV5A 3NZ1A 4AEOA 5DX7A 3VU2A 3MHUA 4LPCA 4ADSA 3F1QA 1KM5A 3UWWA 4YL2A 1XSJA 5AYXA 2BOGX 3TNOA 3R8RA 3N9RA 1XYZA 2QCGA 5C6MA 3FD9A 2FMOA 2E67A 1NARA 3WEOA 3WUBA 5ABGA 1RBLA 4GVIA 3NO1A 1QOPA 4BR1A 2OW7A 3WF2A 2P0IA 1ZCOA 4PL1A 2BY1A 2FGZA 1GYLA 5I03A 1TTQA 3JZEA 4FPSA 2ZA2A 4PMJA 4YCPA 1S5NA 2Y6ZA 3C0QA 3O06A 3KS6A 3FXGA 4GIAA 1M7OA 1MW1A 4P8UA 3PG9A 5U4NA 1G1YA 2F2HA 2X40A 3KHJA 2WB5A 4MSSA 5RUBA 1F9CA 1FHDA 5C9WA 4Q4RA 1XW8A 4GGHA 1IT0A 4HZMA 3TN4A 3LHYA 2OMAA 1EP1A 3BVJA 2F7QA 2NVCA 3GD6A 7XIMA 4G5DA 1UWTA 2Z29A 3IIOA 1AQ0A 2GSJA 1MZHA 4EZNA 3PZVA 4NIRA 3FW6A 3B8TA 1Q85A 3KLKA 4NAFB 5I23A 1G5AA 3CEPA 5CBJA 4EAYA 3IUIA 1F4AA 3WYZA 3N18A 3HMCA 3WLLA 5G2IA 1YXCA 4IIEA 1AMYA 1UA7A 4H3DA 3RX3A 1RA5A 2F61A 3R58A 1XFBA 2ISSA 4AC7C 3M0JA 3UZ5A 3VE9A 1RZMA 3S2NA 4LYPA 3U0HA 3GTNA 4ZZ9A 2DIEA 5DMNA 2X8RA 3P5ZA 1JGMA 2TPSA 4CQ9A 1JUEA 1GNTA 3A3HA 3WH5A 4FLQA 3GVRA 4M6PA 5E5CA 1SGJA 1WV2A 1CZ1A 3ERPA 2R9RA 3LXBA 1XSIA 3E0FA 3UFYA 2P3EA 4GX8A 3U3HA 3QH2A 3ZWSA 3EOEA 2Q8ZA 3M0XA 3B0UX 3TW9A 4FZOA 2WPGA 3EB2A 3GXFA 1S3TC 5DBTA 3D4ZA 3UYIA 3BMXA 1DJYA 1VPQA 6REQA 3QY8A 3IJ6A 2HK1A 1PZ1A 3UYCA 3XIMA 3TC3A 4MWAB 3TTEA 5IHRA 3L68A 2CLOA 1NIUA 4HNOA 4JL9A 2V5BA 1TV8A 1RR2A 3CYJA 5D2TA 4NZ4A 3B8DA 3OVPA 5B80A 1EPVA 2E6YA 2W91A 2HCVA 4A3QA 4OTKA 3AUJA 4ADUA 8TIMA 1PV8A 1GONA 1PZ3A 2PCQA 1TQTA 5CCZA 4D2JA 2D1ZA 3W07A 3BG9A 5A3HA 2OEMA 3V75A 1W5MA 2VCBA 2V2DA 1M03A 2ZXDA 1R2RA 5IFTA 2ZZ7A 2BVWA 2XIMA 3VE7A 4GK8A 4UFHA 2Z26A 3LVTA 1B4KA 1R86A 3AS0A 1FH9A 3ES7A 3V36A 4LUYA 1QWGA 5AVNA 1E6QM 3MC5A 2QMKA 1GOQA 2CLMA 3LLDA 2XIQA 2O9OA 4P7RA 4ZOBA 4UMAA 1YXDA 3BLDA 4MMWA 4JTKA 4HOZA 1XG3A 1XCXA 4L1XA 2VCAA 5A8PA 4GCXA 5FA5A 2J9XA 2GA9D 1XYCA 3E0VA 3MCNA 3T40A 3M7SA 3VINA 1RJPA 2PDQA 2MI7A 2Q13A 3THCA 1ZUAX 3LLFA 3TLQA 5CZ0A 2E0PA 3AWNA 3NJ3A 2OWWA 2OU4A 2ZRZA 3E6EA 3EWDA 2C16A 3M0KA 3LTSA 1OBAA 1LZOA 5FF2A 1IEVA 3TJLA 1TV2A 2Y8KA 4PMXA 5H8PA 1KNWA 3OLDA 1UPPA 3Q2DA 5FJTA 2Y7DA 4LT9A 3T7VA 1YDYA 2HXUA 2J78A 4DI8A 3M16A 3V5OA 4IIBA 4PCTA 1R3YA 3Q94A 4BF5A 3DAQA 3H2NA 2XVPA 3CZSA 3GXNA 5LNUA 1B1YA 2BLEA 3VAVA 1IXPA 4W5ZA 4K8HA 4QJ5B 4PTXA 5JXQA 1EJUC 1JYVA 3M5ZA 4C1NA 1W1PA 3PG8A 4GXWA 1FHLA 1QPQA 1H41A 1QNQA 2QJGA 4LF1A 1KXVA 3NCOA 1KFBA 3LGGA 3C7NA 2RJGA 3I7QA 3K2GA 4FX7A 3GRIA 3F7JA 3VABA 1TX0A 1YHTA 3Q84A 3H70A 4S2BA 3WMLA 1FWTA 2OEKA 5FEPA 1GPWA 1W1VA 4PRTA 4DWSB 2CLFA 4UUIA 2QLYA 2HNHA 2E4TA 3KRUA 4Z2LA 1Q7MA 2RDUA 2IQ0A 2F84A 1TMLA 5MKGB 2O7QA 2INFA 3TCSA 2VRQA 3A98A 5T26A 2A21A 2YIAA 3RV1A 1EH9A 5AC7A 3SCVA 2RDTA 3N29A 2OSYA 1XYBA 3PP7A 4JYEA 1M1BA 1V6YA 3VIOA 2QJIA 3L5AA 3HPFA 3VNKA 4BQ3A 4J3WA 5AOUA 5E70A 5K9XA 3UPMA 2F6KA 3LHVA 4UTWC 1EFZA 1HWWA 4BJHA 2F2KA 1W5PA 1H5YA 2V38A 2J79A 4V15A 3EZ4A 1D8CA 4J7RA 5CZTA 2PWHA 2QDEA 4F0HA 2C1HA 4NZJA 1HL2A 1CCWB 2YW3A 2DT3A 1QK0A 3EWWA 3W71A 3I10A 1ZBWA 3NZQA 5BOFA 4KIRA 2WOQA 5CBIA 3VD9A 3A23A 2GVJA 4QROA 2HV5A 3LDVA 2MNRA 3TN3A 3IVUA 3GU1A 4RNJA 1XLIA 2ESCA 4R27A 3HQ1A 4JLCA 4C1KA 2PDXA 2PY6A 1GUVA 4BQ5A 1PX3A 3EWUA 3TOYA 4E3VA 2INZA 5KEZA 1K9FA 3SIZA 1GHSA 1L8NA 3FKRA 3FSUA 2HEJA 3A22A 3L2MA 1F5ZA 4PUEA 2O9PA 2VOMA 4HPNA 3QMTA 2EBNA 4JOMA 3DYPA 1POJA 1CECA 2VP8A 3O9NA 1TO3A 3EOLA 3GYCA 3L5MA 4YIWA 2QIIA 4D9PA 4MLRA 3VEAA 4KMQA 4A3UA 3CIWA 1J93A 1A5LC 4PMOA 1E3XA 2FHFA 5FJRA 2PWFA 1GYNA 5D9PA 4LWWA 3GVQA 4Z1DA 3P60A 3GAKA 2BHUA 2VHLA 2XM1A 2X5CA 1Q6GA 3TYBA 4UTMA 3SUVA 1J5TA 1WXYA 2Z1BA 4MFDA 1WXZA 3SJ3A 4CCEA 3T0DA 2AQOA 4HK6A 2JE8A 4AC1X 1VCGA 5FIGA 1QX1A 1BF6A 1QU4A 1PO9A 3G2GA 3EJQA 2PLMA 4EF8A 4BFAA 3TLLA 3KBVA 4RXGA 4ZO9A 4FOKA 2E9MA 1DWGM 2XH7A 3QR0A 2G50A 4EZYA 3CPRA 1JCMP 1B3OA 1TZ9A 3A5FA 2ZRYA 3GNDA 2ACSA 1QW7A 2ZX9A 3AYVA 2Y2WA 1FTXA 1V3MA 3ZQ9A 2YCEA 4DBSA 1JDAA 1OF8A 3B40A 1YQ2A 1A4LA 2C0AA 4CNOA 3WLJA 2WMIA 5A6JA 1NELA 4O12A 4N2YA 1XV8A 2DSVA 2QDHA 2A0NA 2CC0A 1Z41A 3SUTA 4GLEA 4DJFC 2XH2A 1JNDA 3U7VA 4GI8A 1JPKA 3EAUA 1MNZA 3W29A 3VDBA 3AICA 3VKKA 1EC9A 3N2CA 3GTIA 3GY1A 4WUIA 1D7FA 4O54A 5LA0A 2YBVA 2XG9A 4O0KA 3SFWA 4JFSA 4LY4A 2ZUWA 3QZAA 2YIVX 3EDJA 4DO7A 1GNLA 2YCIX 1W3KA 3J7HA 3S5NA 1GQLA 3UJEA 1FWBC 2A7NA 1VB9A 2FFIA 4UR8A 3REQB 4D6IA 4U31A 1FFQA 3I65A 1ME9A 1PIIA 4CLMA 3AMGA 5LIKX 1A5CA 1ODZA 4W89A 1BXCA 3UD6A 1DQWA 3OIXA 1PTDA 4DUXA 4YWIA 1SO3A 2OR2A 2OQHA 3MCMA 2VC7A 3ELFA 2W63A 4JNZA 1IR1A 4W84A 2CZDA 1FWFC 3WLTA 3ITLA 3VDHA 4J2PA 1ECQA 3TSBA 2JQXA 2VVSA 4OHQA 5T91A 3VM7A 4HHLA 3PPHA 2ZVRA 4UTHA 1UROA 1A3HA 1IIHA 4U5KA 1CNVA 3EJUA 3RN6A 4Q7NA 4O1BA 4D6CA 1YNPA 1KQZA 1OAOA 1DXEA 1WOBA 3M0ZA 3UWZA 2HNEA 1JXJA 3QY7A 3A5VA 3W24A 3VKAA 3EBVA 4Y6GA 3SQSA 3GC5A 5TBOA 3KAVA 4EXQA 4HYBA 2OPJA 3W1XA 1W3IA 1DJZA 1M6JA 4GISA 4DHGA 4PMRA 1GJWA 3GDTA 3DKJA 3SGZA 2BGQA 1JQVA 3GO2A 2C91A 3UXDA 4HNCA 1DOSA 3E2SA 1LUCA 3OU8A 3TK7A 2NSOA 3BXWA 3CZGA 3WD0A 4OFCA 1QNVA 4DM1A 5AFDA 1AH3A 2PDPA 2HS8A 1OY0A 5DF0A 2EX3B 4IL2A 1KM3A 3MSRA 3FAXA 3VK5A 1Y5WA 3WL0A 4MKNA 1OFDA 4M0MA 3M46A 4HVXA 2IKGA 3M7WA 4JWEA 4UOQA 3D0CA 1OK4A 2NQHA 3E3HA 1EF2A 2VX5A 4TVUA 4UFMA 3VTRA 4NJJA 3BUDA 3ARPA 3CB3A 5G1YA 1JI2A 3K1DA 3DX4A 4KRZA 3RIKA 1GVRA 3SCUA 4F3HA 2WHLA 1MSSA 4A35A 2BGSA 4XZ9A 1DIDA 1PZ0A 5D9NA 3I6EA 5HQLA 4QCEA 4B2DD 1H60A 1UIPA 4DXXA 1MO0A 3W81A 3PZIA 1OG6A 4AEFA 4KEUA 4C7DA 4UNLA 4DQWA 3QYQA 1KRCC 3BGJA 5CPOA 3UJFA 3VIPA 4LJ3A 3THUA 4CU7A 5LZLA 3PY2A 5IBXC 1R3VA 2RH9A 2CERA 1DE5A 4I5RA 4RE0A 2GZXA 1X98A 2ATMA 5I78A 2PP3A 3CAQA 1E9YB 4LH8A 3E49A 3O0KA 1O5XA 3QPEA 5FEXA 1KQYA 1HP4A 3OVQA 4DIAA 1KLYA 2Q01A 4Q33A 2FIQA 5CKSA 4DVOA 1X38A 2V69A 4M1BA 1HXKA 3CL6A 1XHGA 1V8EA 1TQXA 3LZ5A 1DXIA 2EAWA 4MGGA 3W4RA 2Q6ZA 3PNUA 4NJGA 4IQEA 2OKTA 1ZZMA 5EMKA 1C8XA 2V5JA 1KBKA 4L1GA 5TNVA 2J27A 3VIIA 4EZVA 4M8UA 2PDLA 4WHBA 4MJZA 4ICNA 4JYDA 1X1ZA 2A7PA 2PLJA 3UW6A 5G2WA 4IGNA 2ZBTA 2FPYA 4JNMA 1AH4A 4Z2GA 3QTGA 3S2LA 1XH1A 2A2IA 1H51A 3N11A 4NVTA 5CGTA 3PJWA 1C90A 1ZLPA 1S2CA 1NDZA 3R25A 4GY7A 4OBRA 2CXEA 1JYNA 2WZEA 3KDOA 4LALA 2W61A 5C5BB 1W32A 3TROA 2G3JA 3Q67A 4JDYA 3W7MA 3WQ6A 1GVFA 1VFUA 3LMZA 2FFCA 2ZUUA 3SGUA 1LORA 2QJNA 3UBPC 4K6AA 4C7GA 3WBEA 4Q8UA 1IGSA 2G41A 1MJGA 2PMRA 5AC6A 1HKMA 1XBVA 1JZ7A 2PGWA 3BAXA 2UY4A 4WVXA 3AHZA 3G18A 3BVXA 3M07A 1XH2A 3KRZA 3A4JA 4DY1A 1AZ2A 2W62A 1U83A 1K7EA 2BVDA 3C86A 2J66A 3CZNA 1A4MA 1FWRA 2I9EA 4IPNB 5DQPA 1JZ4A 2E09A 1X8CA 3QW4B 2P3ZA 4JQ4A 4O1CA 5HWNA 1XLMA 1K7FA 3VZZA 2W92A 3RLVA 2V3EA 1HG3A 4NXSA 5AYIA 1CX9A 4TU1A 1F8MA 3TQPA 4ZB0A 2FJKA 4RV3A 2ZRUA 1TVPA 2AL2B 1NQKA 3TYCA 4HZ8A 5K9CA 4JIEA 3WNNA 1YNQA 5M1TA 1FX6A 1BF2A 2Z00A 1DIOA 5LGZA 4YLWA 9RUBA 4B2DA 2CBIA 1PHQA 4NILA 3G1YA 2BXYA 4GQ0A 3WH9A 4C5YA 1QNPA 2Z6IA 5E0FA 5CH9A 2ZX8A 1KA9F 3TEVA 1REQA 3CPGA 5HR7A 5L9FA 5FKYA 3MBDA 3ARZA 3IPWA 2A85A 3WQDA 5GNXA 1F3EA 1TMQA 1EUNA 2GOKA 4JX4A 1QW9A 3AI0A 4MPQA 3KL5A 4F01A 4WK9A 1W8SA 4B3ZA 4MHBA 1H7NA 3U2OA 1U1UA 3LPGA 1EDTA 4LF2A 3QRHA 3RMEA 1HXJA 4IZGA 1ZL1A 1VRXA 2PF0A 4DZHA 3NGJA 3VIMA 4PUJA 3O8AA 4U3CA 1CENA 2ND1A 3SY8A 3G9GA 5LNSA 2CESA 2XUCA 2P76A 4AWTA 3ACOA 1XRVA 3FVDA 1NOFA 5FJPA 2ZRWA 5A6TC 1VYRA 3ICJA 3F2BA 4RZBA 2JALA 4EWJA 1UZDA 4JS3A 1XLEA 4WKAA 4LV4A 2AQWA 3W74A 4HMEA 3TYZA 4XVDA 4FS9A 2F38A 1LQ0A 1VLIA 3G1XA 1BRLB 4V33A 5DT5A 1UP0A 3W2KA 4MVAA 5AZ0A 1RCQA 3DYOA 1F3WA 4DM2A 2WQPA 3I68A 5D9MA 6ENLA 4IW0A 2GOUA 4AD5A 5DRCA 4N6FA 2EWFA 2BXZA 3N04A 3TWBA 2JEPA 4G7EB 1R7OA 3UCDA 2Q8LA 4EPBC 4B3KA 2R6OA 3PB0A 1A0DA 5IRPA 1OADA 3G6LA 3SGGA 3D52A 4BI7A 2WPBA 2XZ7A 5XIMA 4KPLA 4HR1B 1UA3A 3BQ5A 5A94A 3TTQA 1TPB1 3BPWA 3CVRA 2HPIA 5ABTA 3EYPA 5AHMA 3HV8A 4PE8A 1A5SA 1A49A 1V93A 3W7NA 2O9RA 3G3DA 1OFEA 3HG2A 4ML9A 1ZU8A 3YPIA 1NVMA 2J47A 1BQGA 1H7PA 5FF7A 2VR2A 4OJYA 1AODA 1S5TA 1T41A 4U2ZA 1W1B1 3FJNA 4WXYA 2OYKA 5EMMA 1JG9A 4D1JA 2I1OA 3K4DA 5LSMA 4EWND 2NXHA 3H4XA 2F9RA 1XPYA 2XGIA 4JBRA 1O7DB 4K39A 2WCSA 2R8WA 1V3JA 4O13A 3P82A 4M5PA 3WNOA 3AIQA 3T4CA 1EJWC 1GORA 4G8TA 1VFOA 2PRHA 3B05A 3T07A 1E1CB 3AIVA 3QQ0A 2CKSA 1Q3NA 2WNWA 4ZFMA 4QAIA 4HU4A 4O16A 2CU0A 3MCOA 4A3HA 1LG1A 4DO6A 3BLLA 2ANUA 3MZ2A 1HQTA 3RMJA 1DTUA 1P4CA 2PE4A 3NR0A 3LERA 2CZVA 3WUFA 3TH6A 3HQPA 4XD5A 1R34A 1ADSA 3C3UA 2QUNA 1UWSA 3TC7A 2FGLA 4RNFA 2VZVA 1ZSXA 3VKCA 3TP4A 3DDFA 1OFAA 5EA9A 1ITUA 5FJJA 3GH5A 3ER8C 3LOTA 1MVYA 3C6CA 3WJZA 3N2TA 1WKEA 1Q6RA 2XIIA 2DUZA 3K8LA 3DI1A 1WZAA 3TXVA 2NX1A 5HWMA 3GU9A 5CPTA 1B31A 4FXFA 2GJNA 2YB4A 3AISA 4GCAA 3F2CA 2NW0A 1LOQA 3DI0A 1BG9A 1VIZA 4MOZA 5G4WA 3AHYA 1Q65A 1DKZA 2Z0IA 3PZUA 3EWCA 1EEPA 3MKKA 3CM4A 2Y24A 4NJIA 3HO8A 3VIFA 3LHTA 1K6AA 2EG8A 2GF4A 4B9YA 5EFDA 3CLWA 3TW6A 4EE9A 1NOUA 2J74A 2YKKA 2NV1A 2WZIA 1E3ZA 4FIRA 4AVMA 5BU9A 1U2YA 1N82A 4H2HA 5J5RA 3KOFA 3GZAA 3LQLA 3UPBA 3B97A 1W1ZA 4HJWA 3B0XA 4HHPA 1WDSA 1XLAA 1JAEA 2QAFA 3O3RA 3STPA 2FKPA 2DIJA 3DPQA 4NJHA 5REQA 3NPXA 4JX5A 1FVPA 1EJ7L 4DN1A 3H7RA 3W7HA 5TKYA 4UQBA 1OC7A 4JTIA 3LXCA 3R13A 1SR0A 3JRKA 4XQ6A 3ZWTA 1M3UA 3DG6A 3CIXA 3BMVA 3GVGA 4S3CA 1KR0A 3O3OB 2V2CA 3H24A 4HT3A 2HZGA 3O0FA 3LUTA 3BUIA 3DEQA 4KW2A 2YL6A 4IFRA 4X0VA 4CCCA 4RZ6A 2YL5A 3T8LA 3GG7A 3GHSA 3Q65A 3WJYA 2FZ9A 1DJQA 4ATLA 4LEFA 1X6LA 3WMBA 1KKRA 5EFFA 4PGLA 3UP8A 1JUBA 5E0KA 2B7PA 3FSTA 1PUDA 4Y8EA 1G9HA 2FYMA 3WG6A 2QCCA 4FB7A 3HG5A 2UBPC 2GQAA 4K1WA 4QXIA 2CFFA 4ORIA 3MVTA 4BWLA 3SCSA 3SZ8A 3BUQA 4E38A 1YWMA 5HJYA 4DEFA 4K7YA 1IF2A 2DGAA 2YXOA 5T8GA 4O57A 1RUSA 4INFA 1E6XM 5CJNA 3ALFA 1OABA 1CXHA 3I7SA 5DY2A 3U2EA 2E6DA 2G4JA 3E1F1 1CGVA 3CQ0A 3IJ8A 4LBSA 1Z42A 2VR4A 5H91A 1HKJA 4E2BA 3UGVA 2FGBA 3KBNA 2ON3A 4HP5A 4I5UA 1J12A 2MANA 1TUFA 3IRDA 4Z2IA 1GTHA 2QUMA 1XKYA 1UUMA 4U33A 3ZM8A 2DW7A 7PTDA 1DBTA 1KCXA 1RBOB 3T4AG 2OVLA 2WZHA 1UKTA 1G01A 1O5RA 3AMDA 5AC5A 4DWDA 3OA3A 1ZALA 5CC3A 4RXFA 4ATWA 3NEVA 3R94A 1A5AA 2BNJA 1FUYA 1HKWA 1KM1A 1T8XA 1S5MA 3GFZA 2O7SA 4AY7A 4ZEPA 3B8UA 1M5WA 3AYRA 9CGTA 2X0HA 2OLAA 1P0KA 1PIFA 4I9AA 1LROA 4P7QA 4ERGA 4GY1A 3GXPA 4J4KA 4LCSA 1ZBVA 3VFCA 2WBGA 5G1TA 1F61A 4RUBA 4GKTA 4PMQA 3MANA 5TIMA 5GJPA 1KM6A 3GXDA 2E1DA 4EACA 4M51A 3NM1A 5LXEA 1JFHA 3GNNA 3EXTA 4MLJA 1HFBA 3DC0A 3FA4A 5K7JA 4X9SA 2A5HA 4O52A 4XKYA 1W9MA 3VYLA 4E4PA 2ZRVA 4JKMA 4Y8FA 3EJSA 4LYQA 4UTWA 1GZ1A 4PSPA 3WX7A 3T81A 3IK2A 5AECA 2QV4A 1W2VA 3L21A 4WKFA 1WP6A 1S5VA 4O1DA 4OQVA 1U5VA 2Q09A 4QSHA 3CHEA 4JZ5A 4P2VA 4OZOA 1KXQA 1C8VA 4F0RA 1JQKA 5EMUA 4NKCA 1JXKA 1KV5A 2ZQ0A 2EGZA 4AX7A 4O0QA 4W8AA 8XIAA 2ISWA 3EA1A 5I3KA 3AXHA 5LYRA 4W8BA 4QLJA 3MMWA 2GSHA 6A3HA 1NDVA 3P3BA 1TQVA 1AJZA 5F4WA 1WO2A 2KHOA 2V82A 4UZUA 1DJWA 1TELA 1R5EA 1TIWA 3VMPA 4EPDC 2GJXA 3PVFA 4GZIA 1E4LA 4AG0A 1N2VA 2AQVA 1SW3A 1NWTA 4NI3A 2ZVIA 3W6YA 5F7UA 3B04A 3BV7A 4QJ4B 5I24A 2JKPA 1HJWA 3VKJA 3BJTA 2F1AA 2ABAA 4GHRA 2VEPA 3OG2A 2WYSA 3IIPA 3UR7A 2GGHA 1XLJA 1VH7A 4A29A 4LNYA 3SDOA 1K8XA 3SSZA 2DQXA 3GKAA 4XBSA 4H8UA 4KRUA 4X2PA 3DPOA 3CL7A 3K5XA 5AKQA 3A6OA 3VGEA 3A64A 3VGFA 3IJQA 1DPMA 1GNXA 1OZQA 5IOBA 4Y96A 3GUGA 1UJQA 1XYLA 3W1RA 1KRAC 3O05A 5HINA 4KIEA 5CPQA 3N15A 1OC5A 3FHAA 1R3SA 4LVFA 3LNMA 3OZOA 1BFNA 2VTFA 4DWSD 1XLBA 2QCFA 5CPSA 1S2UA 1W5QA 2Y5EA 5ECUA 5A6LA 2PFHA 4CD4A 3WDIA 1XR2A 1UWQA 1FBAA 1PWLA 3K8MA 1Q6CA 1Q6OA 1KR1A 5KSWA 3VX1A 1UJPA 4Y90A 5E6YA 1SJAA 2E6AA 3UZYA 2YLAA 3NM3A 4UQCA 2LXYA 1ZAJA 3W2NA 4S3DA 5HXMA 4G1NA 3PAOA 5EPDA 3HIJA 4EXBA 2VRKA 2W0UA 4JQ1A 5D8ZA 4Z42C 1GGOA 2PDBA 1M41A 5F1VA 3S1GA 3EB4A 2ZE0A 3TA9A 3QF0A 3ZO9A 3U2ZA 2WXDM 2YFNA 1AFSA 4GZEA 1R30A 4PUMA 1EXPA 1J79A 4AAJA 3EX2A 4H83A 2WMHA 2XVLA 1H0GA 3PUEA 4OGZA 4Q4OA 4IFKA 3WLSA 1XISA 3NNTA 1E5JA 1F8IA 3UITA 3A3WA 5GJMA 4IGMA 2X3WA 4PZVA 4W86A 4WX2A 1KBLA 4PMUA 2C14A 1W3HA 2VUYA 4XISA 2Z0OA 5I3JA 3QLDA 1CB7B 1ICPA 3R89A 5MF5A 4Q8PA 4G9PA 5C2XA 2GUYA 4CQBA 3R8HA 1ZS2A 4A6GA 5A6AA 4WEVX 5I09A 3B8VA 2YBUA 3S5ZA 2E9BA 2WYHA 1Q5MA 2FTYA 1UR4A 1J10A 3HV9A 3T0TA 1E0WA 1P0EA 1AH0A 2VFIA 2POZA 2ZRXA 4XZIA 3U5YA 3H4WA 4DI9A 3W26A 4M0XA 3TR2A 2X42A 2FTWA 3N2MA 3CUJA 3L23A 1WYIA 3PPGA 4MJMA 1MEWA 1UYQA 3VNMA 1E6NA 2PWDA 2XVNA 1IGWA 4FOJA 2PDJA 1J01A 1DWAM 1HT6A 4G2DA 3AXMA 5CZSA 5D30A 4REQA 3IANA 3CNYA 4ZA0A 4A8IA 1UC5A 2J4GA 4PTNA 3RO6A 4LVBA 1QDSA 1X8FA 4KGJA 3L66A 3PWIA 1RQBA 4JTAA 1GCYA 4G56A 4FSAA 4QHRA 1OX5A 1QHPA 3DGRA 1PDZA 5JBEA 5G4EA 3P61A 5SWUA 1G4EA 1UKSA 1I2RA 2OFJA 4DWSA 5HMSA 1UH2A 1BYAA 1C9DA 4NSWA 5MKGA 5AC8A 2P0OA 1R2SA 1M65A 5FAGA 1S3HA 2ZWZA 1BVWA 1IEQA 4UR9A 1F73A 3K4WA 4L65A 5BRQA 1RPXA 4JCMA 2DFAA 3RGTA 1ZCCA 5C55A 3VNIA 3OGSA 1Q8AA 4M1RA 3M0IA 4N42A 4NU7A 3RO8A 1B90A 3H53A 3PZMA 4RR4A 4CNPA 1FCBA 3T08A 2GQ9A 3AIEA 4WY0A 4Q8VA 3G1DA 2BOFX 5KZMA 3QHOA 2D2OA 4JXCA 1KCLA 4JFTA 5DXXA 5DN1A 3SCWA 3APGA 3GW3A 4PMZA 4YCOA 3WQ8A 5CBBA 2YDQA 3LBOA 5FF4A 2IPWA 4F40A 2PRLA 5M03A 1QATA 2VI0A 1DHPA 3PFRA 1PBGA 4CN6A 1MW3A 1SJDA 2F6UA 3BTNA 4IP7A 1R3TA 1VFFA 3LV6A 3URBA 3JR2A 2Q3OA 4LB4A 1EGVA 4R34A 2OW6A 4EZRA 4LFYA 1RQHA 4AISA 3VD5A 2YXXA 1PWMA 1QFEA 1UR9A 2O0TA 5IBXA 4E0CA 2C1IA 4BQ4A 4FF7A 3LMFA 2TYSA 2WJDA 4IUGA 3CO4A 1EX1A 3MI6A 3UGRA 3UCQA 3SCOA 3I3EA 3NQCA 2AAAA 2VC9A 4K36A 5C5YA 4C6FA 4MY8A 4E2DA 4NZ5A 5H8UA 3PJXA 2BG5A 1X97A 3QGAC 4RE2A 3KOYA 2AOSA 4O28A 4FALA 1OFBA 1FP8A 5U7SA 2UV8G 2Z28A 4HD5A 3LPFA 4QCFA 4GBUA 4NSBA 2ZDRA 3AXXA 2F7RA 4XG1A 3GM8A 1YRRA 4ZBCA 4OUIA 5M3WA 2J62A 1TX2A 4WIWA 3PZ9A 2PD5A 3W7IA 4O11A 3PULA 1YTEA 3MP4A 2TRSA 1W9UA 2D3NA 3QOMA 3OLIA 3CWNA 5EY5A 2Y5JA 3FAWA 5EL1A 4L1WA 3WDQA 2QF8A 3VOGA 4HNUA 3GR8A 1HGYA 3AIRA 1E6PA 5HANA 3HU7A 4JFWA 3A12A 1XIEA 3LCLA 1UCWA 3NL3A 4GC4A 3B3DA 2UWFA 4UMBA 1W1IE 2A3CA 1SW7A 1L6SA 4AD2A 3UR2A 5AYZA 1W3JA 1CGTA 1DJNA 1TQJA 2VFHA 4PULA 1XDJA 3RILA 3NQ7A 4M81A 1GVOA 2P50A 3DH7A 4FLSA 3LN3A 4TTGA 3WELA 3OHMB 3PTKA 3AYTA 3URAA 1VYSX 3OK8A 3CL8A 1IR2A 2QUUA 2W5FA 4LCQA 1GOMA 2CLIA 1KBJA 1V7YA 1ZJIA 5CSUA 4XSLA 1W1YA 3NQ8A 3WENA 3DX3A 5I06A 3TJXA 3M0HA 3D4YA 1XLFA 3FJ6A 2FH8A 8CGTA 2VGBA 2REQB 3H21A 3BAJA 1KFJA 1JZ8A 4UTTC 2E28A 3EEZA 3SCTA 5HJXA 4O0ZA 3L0GA 3O3NB 3GTXA 4TVDA 5DMYA 4TVCA 2YIBA 1YPIA 2VT0A 3DBNA 1US2A 1OIMA 3IWPA 4TUFA 3BSMA 4L4MA 3MUAA 5KZDA 1Q6FA 2E7FA 3DHPA 1V6VA 1QWNA 4N6EA 4OIFA 3LHWA 4IUOA 1D3CA 1DYSA 3FOKA 2OSXA 4AZ6A 1B3WA 4YTSA 1Q6EA 2O92A 3E38A 3T42A 5A6BD 2NSXA 3WSUA 3QV6A 1VPXA 4CQAA 4S3EA 4XIAA 2YDSA 1H63A 5HQEA 1N8IA 4KERA 1NOWA 2QPSA 4XAFA 2J9YA 3SCNA 1XICA 2UZ9A 3G5EA 1WDRA 1QT1A 3KCJA 4DAIA 3L3PA 3M0MA 1NSJA 2WSRA 3EKGA 1CLVA 3M64A 2HSAA 3E2QA 3ARYA 4S2CA 2XZ9A 4DNHA 2JBMA 3MKCA 3BO9A 3OP2A 5GVJA 1KM4A 1RHCA 4H9UA 2GAFD 1V08A 3NEHA 3AIBA 3UNTA 3WY1A 1VIWA 3V1PA 1IHIA 4Z0JA 4RZ5A 2RUSA 2DDXA 3T09A 3BLKA 1B3XA 1ZY9A 2PTDA 1TQWA 1XD0A 1LWHA 1UC4A 3IACA 4HMCA 1RA0A 4BF7A 1LM1A 1NWRA 5H8MA 4PB3A 4ZOAA 3G1AA 3PSWA 3HGRA 1XQLA 2X1SA 5CC5A 1E5NA 1V3HA 1I4DA 5DCDA 1WE5A 4DJEC 4QNEA 3BH4A 3WLRA 3GZ3A 1W56A 3QZEA 3I6TA 4B5NA 1O6IA 1I1WA 4CUCA 3VFLA 3VKHA 4X0NA 1PEZA 3RM4A 2FH6A 4WRHA 1Q6QA 1UH4A 4EZUA 1SU6A 3DX1A 3DBPA 2NCZA 3CHFA 3S6DA 4J3SA 2AAMA 3ONBA 3UVAA 3BSHA 4CKQA 1W1TA 2DSUA 1LG2A 2PLKA 4UZSA 2R14A 1PYMA 2DVUA 1RV8A 1OX4A 4JFVA 3N2OA 3EA2A 4CCDA 1XD1A 4D6FA 3NOEA 4LAMA 2Y4SA 1QOQA 3OJGA 1OVDA 2QCHA 2V9DA 2OT0A 3R11A 1DE6A 3AROA 4H9ZA 4JGDA 2PDGA 4WSJA 1JDFA 4GUFA 4UOZA 2JF6A 1RCXB 2FZMA 3EKZA 1R87A 3DU0A 4JDBA 1XJBA 2BTMA 1W91A 3UY8A 1GW1A 3WFAA 4XD6A 5HNUA 1O60A 2F8QA 4GVFA 1EDGA 2JIWA 5A6BA 5JUVA 5B7YA 4KBXA 1SO6A 4H8HA 4AQLA 3P7YA 5EMYA 2YXGA 1H09A 2Y88A 5F2LA 2PZ0A 3CGTA 4U28A 2B31A 2GVLA 2JGYA 4NUWA 4F0SA 4WJ8A 3DHFA 3USBA 1EDQA 1DKXA 1OFPA 2IXUA 4WSHA 2Y0FA 3NQ6A 2DT1A 4MY1A 1BEUA 5CG7A 3C52A 4FOUA 3BLIA 1DV7A 3AXIA 2QJHA 2IPFA 2DZTA 4CCZA 3F4WA 2FHCA 5CPLA 1JGIA 1EC8A 1W9XA 1SFJA 1SSDA 1HJVA 3UA4A 1GJUA 1W9DM 4YWSA 2XIJA 4IMEA 3UXIA 2CITA 2QVNA 2CEQA 3AXKA 2Y85A 3NSMA 2NT0A 1GVEA 4KCUA 5HMEA 3ZSTA 4CD8A 3WLQA 3EWZA 4C6DA 5KZEA 5LHEA 3NOYA 2PLCA 3N9SA 4YTUA 3I3DA 2A79A 2W66A 2EPLX 3KRSA 3KWXA 1C8QA 4XAYA 5LNVA 2Z1SA 4CU8A 2R1LA 2DPEA 5I0DA 3F4CA 3ARRA 1HX0A 3H55A 3QN3A 2XH4A 5LA1A 4OU1A 2YGYA 4AD0A 1O68A 3QR3A 2BX7A 4H6HA 2H8ZA 3D47A 4OWGA 2V3DA 3DFNA 4FLOA 4AHQA 3W53A 3KAOA 4ZOCA 5I00A 1TMHA 1BPLB 3M0YA 4LYRA 3DPPA 3TFXA 3LG3A 3UZXA 4H8SA 3KZSA 1RBAA 1TCMA 1CEOA 3MUCA 1VZWA 3WQ4A 1OD0A 1F76A 4FO4A 4GUGA 1XGDA 4UOJA 1NFBA 5E0CA 3H2OA 4Q32A 3KBJA 1I9CB 2RHGA 1PYFA 3ZLFA 2B7NA 4ZQOA 4H00A 2D2HA 3URNA 4AF0B 2AL2A 4GNVA 4HYVA 1YIXA 2VFGA 5LIWX 4HSNA 2QMJA 4BHYA 2HQAA 3KZPA 3DESA 1XLHA 4UQEA 2ZZ1A 2OYMA 4PMNA 4C6MA 3GHTA 4IM3A 1RAKA 3R10A 4LVDA 1W1A1 2OWCA 1MRAA 1EOKA 2GFTA 4DXVA 1EGZA 3F03K 3OHIA 3L0KA 2QCLA 5XINA 2C08A 2BMBA 4I5XA 1KGXA 2B7QA 3WUGA 4HA3A 4ICMA 3KHDA 1AUSL 1JDEA 3BLEA 3AMKA 2WWCA 1KFWA 1SSGA 3U9IA 1GT8A 3FJ4A 2QKFA 3UG5A 2QPXA 2WC3A 3VILA 1LQ2A 3ABOA 4RDWA 2D3LA 3ANYA 3WD3A 1PTGA 1PAMA 4HSOA 5CLWA 1R3RA 1TPEA 1KXHA 2HK0A 3WDHA 5C70A 4NASA 3R79A 3UXAA 1CGUA 4O19A 3N25A 3MUY1 2DJXA 3W72A 1WUEA 1L6FA 1ICSA 1BXBA 4PUUA 1QK2A 4W8LA 2E25A 2HXTA 3TAKA 4PRWA 4US5D 3STGA 4W7VA 4UFIA 2WNQA 4DO4A 2QULA 3HB9A 1MMFA 4NJKA 2YI8A 4DF2A 2PWGA 3EOSA 3GWQA 3H7VA 1EWDA 4JY8A 3SRKA 3LCGA 3MMUA 4IM2A 1P0NA 4JCLA 2PD9A 4RCXA 4EZWA 4MNJA 1ITQA 3E96A 4EXAA 1SJCA 3PLTA 4B5SA 2BP1A 2X16A 1FY6A 2ICSA 3GIPA 3P62A 2WMKA 3D51A 4KWUA 2RDXA 3PR2A 1V7AA 5DBUA 3GX9A 2ZOXA 4KEZA 2X0YA 4XKMA 4H04A 2H8XA 4HGXA 4TV5A 2ZUTA 2VX7A 3S5YA 5D03A 4DLMA 4LVGA 1Z6KA 3I2WA 4GJIA 4XD4A 2XSBA 2UY5A 5JH1A 4MUPA 6REQB 3SY1A 1C92A 3KUMA 1B54A 2CWNA 3LI0A 3P67A 2NUYA 2VGFA 4MIMA 2VNCA 3HPZA 4ZE4A 3IIXA 2FVMA 4KFOA 2X30A 3W2JA 1FWJC 2VVNA 4QBXA 4IX0A 1VHCA 3U8GA 4QISA 3G0SA 4F0LA 4DUWA 4B5WA 3KBMA 1B9ZA 1OQFA 4AY1A 3T2QA 3RX2A 2WSYA 5ENLA 1UW9A 4AVOA 1R0MA 1WZKA 1OGSA 3T2PA 4O14A 1HP5A 3L4TA 5C2GA 1IT8A 1EEXA 1TQSA 5D37A 3VMOA 4UB9A 3TU9A 1Q2SA 1TVLA 2I7GA 1DL3A 4IT1A 2D73A 3S6OA 3FEMA 4D6DA 3L4XA 3PUGA 1R3WA 1HIZA