2YLLA

Inhibition of the pneumococcal virulence factor strh and molecular insights into n-glycan recognition and hydrolysis
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
436
structure length
436
Chain Sequence
AMNEKLAKKKIVSIDAGRKYFSPEQLKEIIDKAKHYGYTDLHLLVGNDGLRFMLDDMSITANGKTYASDDVKRAIEKGTNDYYNDPNGNHLTESQMTDLINYAKDKGIGLIPTVNSPGHMDAILNAMKELGIQNPNFSYFGKKSARTVDLDNEQAVAFTKALIDKYAAYFAKKTEIFNIGLDEYANDATDAKGWSVLQADKYYPNEGYPVKGYEKFIAYANDLARIVKSHGLKPMAFNDGIYYNSDTSFGSFDKDIIVSMWTGGWGGYDVASSKLLAEKGHQILNTNDAWYYVLGRNADGQGWYNLDQGLNGIKNTPITSVPKTEGADIPIIGGMVAAWADTPSARYSPSRLFKLMRHFANANAEYFAADYESAEQALNEVPKDLNRYTAESVTAVKEAEKAIRSLDSNLSRAQQDTIDQAIAKLQETVNNLTLTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibition of the Pneumococcal Virulence Factor Strh and Molecular Insights Into N-Glycan Recognition and Hydrolysis.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
molecule keywords BETA-N-ACETYLHEXOSAMINIDASE
total genus 175
structure length 436
sequence length 436
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2011-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.90 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 AF1782-like 2yllA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2yllA01
4LYPA 1GONA 4PMQA 5E6ZA 1QHOA 1NWRA 3EDDA 2QMKA 4AIUA 3B9DA 3VUPA 5ABHA 2WZHA 5HXMA 2VL4A 3EDJA 1UR0A 1V6WA 4TX6A 2VOTA 4LQ1A 4H8UA 2ZXQA 8CGTA 3ARXA 1W1YA 4D6EA 5JIWA 2J79A 2NW0A 1UQYA 4FK9A 3CUIA 5I23A 2DSUA 5ABFB 3N1AA 1GQLA 2OLHA 1PX8A 3ZT6A 2DGAA 4OUEA 2CBVA 3A4AA 3EMCA 1E3ZA 5CJ5A 5I2UA 1JI2A 3OIHA 4PMOA 4JL1A 3WY1A 3CBWA 4TTUA 4PMYA 4ACZB 3VIOA 3W0KA 4DUWA 1D2KA 2CITA 5C70A 4FZPA 4FLOA 2D3NA 2NT0A 4UFMA 3CHEA 1QI2A 4D6GA 4CD7A 5FOOA 3PN8A 2YDRA 3SCWA 5FIPA 2OSXA 4X0VA 2JF7A 3T0DA 1ECEA 5A6BD 4D1JA 1E6RA 2VCCA 3KL0A 3MUZ1 3WNOA 4CN6A 2E8ZA 2VZUA 1CGWA 2VZVA 3VKKA 2QLYA 1SMDA 3HN3A 3O6AA 3WF4A 1XRVA 1LWHA 5CLWA 3ZO9A 4NRRA 5LA1A 3CHFA 3VPLA 2VUYA 1HJXA 2WMGA 3TOPA 2ESCA 2WHMA 5CPSA 4UQBA 1UH2A 5AC5A 2BV9A 3VX1A 5D8WA 4MJ4A 4W89A 4ZXLA 3CTTA 1LG1A 5ECUA 5FD0A 3W6LA 5FL0A 1AQ0A 1SFSA 3GDBA 1HNYA 5CG0A 1K9EA 2J7EA 2GVYA 4X9YA 1E40A 1KR0A 3NSNA 2E0PA 4FZOA 1QPKA 1KCKA 2JF6A 2XJ7A 1NP2A 3MMWA 1ISWA 1BTCA 3T09A 2WMJA 4W93A 3AXIA 1AQHA 4FLSA 4J3UA 2PWFA 5DO8A 3BAIA 4J3WA 2FGZA 3WMCA 3ZJKA 1AQMA 1UOKA 2YLAA 3UG5A 1JI1A 1M04A 2EO7A 3TONA 4GO8A 1D3CA 3VIFA 5A8NA 1B3ZA 1FA2A 2BS9A 3GZAA 2J74A 1LL7A 2V5DA 3RO8A 1ZL1A 1XSIA 2VRJA 1CPUA 1F4HA 5A6BA 1A47A 3AJ7A 3SCSA 1EDGA 4MNLA 4Z2GA 1B2YA 3WENA 3BSGA 3GTNA 5IXEA 3WFZA 4UZUA 2VCAA 1FH9A 2XHYA 3ARUA 3DC0A 3DYOA 3E1F1 2OYLA 3QOMA 3MV11 1EQPA 4JZ5A 2JEPA 2VURA 3A47A 4EKJA 2G3IA 4OJYA 1GW1A 1ZJAA 3RMEA 2V3EA 1CLVA 3K4AA 1XH1A 4GO9A 1JYNA 3WQ5A 4HTYA 3AHVA 3CUGA 1HN1A 1WAWA 3QHNA 5TD4A 2WSKA 2G3NA 2VX6A 2VTFA 3WH5A 1JXJA 5IHRA 4H41A 4H7VA 1NH6A 1R8LA 3AYRA 3D5HA 2J7CA 4JKLA 3U5UA 2WPGA 4D6IA 1PX4A 3ZT5A 3WDPP 1GNXA 3VIPA 3MO4A 3L4UA 4FLQA 2F2HA 1KB3A 4HU8A 1NP0A 3CIVA 2VQUA 3AIUA 4PYSA 3WQWA 2YKKA 3FAWA 4MADA 1U33A 2X8RA 1WZLA 2DSZA 1JYXA 1PAMA 2D22A 4AD5A 4U5IA 2VQTA 2AOSA 1NQ6A 4S3JA 3WDHA 3WNKA 3BC9A 3GXMA 1M01A 2WYSA 3AMKA 1QI0A 1E70M 4AZCA 2ZUUA 4P7LA 3VX0A 3UESA 2WBKA 4D72A 4PRWA 2D23A 4JFUA 2YJQA 4YPJA 1EA9C 3DYMA 3AYSA 1KWGA 3WBEA 4LYQA 4MPKA 1FHLA 3IAQA 3OGVA 2CKRA 3SUUA 4JFVA 4WJXA 4CCCA 4BCEA 3KEHA 1Q4NX 3MUAA 4AXNA 4RE3A 4MAZA 1MYRA 2J7DA 1YHTA 5DT5A 4B15A 3W6MA 1QNQA 2W61A 4CU8A 1OSEA 4AZIA 1CIUA 1MW2A 2PWGA 1TVPA 3K4DA 5ABEA 2XWDA 3IANA 3OZOA 4M29A 2ZICA 1MQQA 2BXZA 5D8ZA 3W82A 1F4AA 3U57A 2BY0A 3W37A 3MS8A 4CVUA 1HL9A 1E6PA 1C3FA 1TUXA 1J12A 3SCUA 3ARYA 1BG9A 2VZTA 3A4WA 1C7TA 3PZQA 4M8UA 2BHYA 2JE8A 3PTKA 1UUQA 1DP0A 1UHVA 1GOOA 1CYGA 1X6NA 1WP6A 2ZWZA 3A3HA 4AWEA 2PF0A 5CQ1A 1V0LA 3WEMA 5IFPA 2FHBA 5CPQA 2AAAA 5FCZA 1QBBA 3DHUA 4KWUA 4JFTA 4A3YA 1PZ2A 3CPUA 5I6SA 1KGXA 2D0FA 4AYSA 2VRKA 4PUDA 1R7OA 2X09A 4OZOA 2WSPA 5HPOA 1OINA 1R85A 1CGXA 4W7UA 1EO7A 1GVYA 3VGGA 2XVPA 3B9EA 4W8BA 3SCOA 2W62A 3F5KA 1CWYA 2WW5A 2WXDM 4W87A 9CGTA 4M56A 4GZIA 4TVCA 1PZ3A 2WWCA 3O9NA 2C0HA 1J18A 3K1DA 3KL3A 1E1FA 3L4TA 4B9YA 4B9ZA 3GXDA 1FP8A 5KEZA 4OIFA 4D6HA 2CHNA 3VD4A 1BHGA 3VGFA 3K8KA 1BF2A 1E4IA 4WK9A 2W66A 1E5JA 3WF3A 4MAVA 2VX7A 4V28A 3WNMA 2W67A 1W91A 1V0KA 3OLEA 1MQRA 3SCNA 3NSMA 2X0YA 1E0VA 5JBFA 1KGUA 1XV8A 1E43A 1C7SA 3CLWA 1HT6A 3VIIA 3VNYA 2J47A 1VB9A 1VEOA 1WE5A 1GORA 3VIKA 4PSPA 5D9OA 3PZUA 3VO0A 1GZJA 4RL3A 1KQZA 3POCA 2UY3A 2DDXA 1V3LA 4CCEA 4HMCA 4P8XA 4KGJA 1UD2A 1QW9A 2BVTA 1KXTA 4NRSA 1TA3A 3OBAA 1KR1A 2WLZA 1ZBWA 4WIWA 1VEPA 4NZCA 1K6AA 3B9AA 3PZ9A 1V3IA 2UY4A 3ZJ6A 1CENA 5E09A 4AY1A 2XWEA 1I1WA 1MFVA 1Q6FA 1VEMA 3ALFA 4YN5A 1CBGA 1QHPA 2Z1SA 1US2A 3WBAA 1E6XM 2GK1A 1QI4A 3QGVA 2YDSA 4JIEA 1NOWA 4PBGA 1ZJBA 1IZKA 5GNZA 4MB1A 2Y24A 3N9KA 2G8ZA 1B30A 3VTRA 1W9DM 2A3BA 1EHNA 4TTGA 2VO5A 1WZKA 4C7DA 1C91A 1OIMA 2BY1A 4R5EA 3BCFA 1TR1A 2A3HA 3NJ3A 1G9HA 4Z2JA 4GI8A 5I3DA 3AMDA 3GXFA 3IK2A 1GPFA 2CCRA 2WZEA 1W9VA 3AROA 3OGRA 1WDSA 3PZGA 4PMZA 1OWQA 1V02A 4M24A 1JYVA 2D24A 5DEZA 2OZNB 2VRQA 3CMGA 4FMVA 3KE0A 1W1TA 1JYWA 3MMUA 1NM9A 3FY1A 3WUGA 4A4AA 1EXPA 4GI6A 3UETA 4MDPA 1UZ4A 2ZXAA 2XIBA 4CKQA 5I0DA 1CXKA 4W8AA 4H2CA 5BXPA 2ZX8A 4DM1A 3FNDA 4GI9A 2EPMX 1CXLA 4W5UA 2PB1A 3AOFA 3AQUA 1DWHM 4AD2A 1VIWA 1KBBA 4D71A 3ARSA 1Q6DA 4XX6A 3GNOA 1B3YA 1OGBA 4AISA 1UKQA 4DUVA 4H8VA 2VVNA 4KH2A 4DM2A 5A8MA 1MFUA 2V3GA 4XZWA 5HDRA 3VNZA 3AFBA 5DMYA 1OBAA 4ACYA 3BGAA 4TUFA 2X05A 1V08A 2E40A 1E56A 4JFWA 3VGEA 4ML4A 4D6FA 3RPMA 3W26A 1TG7A 3EDFA 1E6QM 4IISA 1HJUA 3WD4A 2CNCA 4QDMA 1IV8A 1W1VA 3AS1A 4K68A 2O92A 1QVBA 4AEFA 5A8OA 2PBOA 1C8YA 1TVNA 1BSIA 1UKOA 2W5FA 5BXSA 1CGYA 4XV0A 4HPHA 5CLTA 1H3GA 2DSKA 4GQRA 1DWFM 1DWAM 3W53A 4URIA 3ARRA 4U3CA 4ATWA 3AS3A 2OO2A 1V6XA 1P6WA 4J27A 1L0PA 4CD8A 1NOUA 4J3VA 3BAWA 2WCAA 2PWDA 1OT1A 6TAAA 3VGBA 1QOXA 1UD5A 1UKTA 5A95A 2J78A 1W2PA 2A3AA 2CXGA 3APGA 4GPNA 4AZCB 2EJ1A 1FH8A 4J7RA 1W9BM 3SCTA 5I5RA 3OA5A 1M03A 5A6AA 1C8XA 3OZPA 2EEXA 1W3LA 5HOSA 2CESA 5JIPA 1NWSA 2GUYA 4OKDA 2RGMA 5AYIA 2FHCA 5CSUA 4WLCA 1W32A 3ZQ9A 1C8QA 3I3DA 4HZ8A 1H49A 3AXHA 1PEZA 1UD6A 4HOZA 3L4YA 3CZGA 2YL8A 1BGGA 4DWSD 5LA0A 1OM0A 2J7HA 1NOFA 2E8YA 2D0GA 5A69A 3OGSA 3OB8A 2XFFA 1JF5A 2WMKA 3WN6A 4D6CA 3VIHA 1FH7A 3WDQA 2DIJA 4P7NA 3MKKA 4GINA 3KL5A 1ZU8A 4LXFA 1GQJA 3POHA 2FHFA 4AD1A 1VFFA 2VT0A 1HKMA 3CGTA 5EMYA 1JZ4A 1CDGA 3UG3A 2OYMA 4GXPA 3W27A 2YL6A 1PIGA 1EQCA 4CVWA 2YOCA 1Z32X 1EDQA 1SYTA 1B3XA 2JALA 1SR0A 3BCDA 1NARA 3L2LA 5I77A 2O9TA 4DUXA 3S2CA 3AZSA 3MANA 3AS2A 1E72M 3JUGA 3ZR5A 4AIEA 5DT7A 2WM0A 3HU7A 4J28A 3IJ7A 3M7SA 1R7AA 4ZENA 4BQ5A 1GOKA 3NSXA 1CXEA 2XSAA 1XH2A 4UR9A 1DHKA 1C92A 4TVUA 2XFYA 1V0MA 1XYFA 3CUFA 2XSBA 3WFLA 3ARWA 2ZX5A 5BYWA 1ITCA 3NDYA 4JCMA 1B90A 1EH9A 4E8DA 2YLLA 3NYDA 2DSWA 5BXRA 4P7QA 2YL5A 4L4PA 3EMQA 1E0WA 3AZRA 3PZOA 2WCGA 1GQKA 1ISXA 4GIAA 3N17A 1E6ZA 4DWSA 1K9FA 5JBDA 2EBNA 3WUBA 2CYGA 1W3HA 3BAJA 3UG4A 2D20A 3G6MA 4YHGA 2IUZA 1MXGA 4MDOA 1JF6A 3FN9A 1JZ7A 2WVVB 2IXUA 2YA0A 3VD7A 1JL8A 1JG9A 3TA9A 1I75A 4C7FA 1RH9A 5A3HA 1E15A 3B8SA 1TA3B 1NWUA 2CIPA 2CEQA 3N13A 2J7BA 2YA2A 4UTFA 4D6JA 4AC1X 5A2CA 4V2XA 2ZX9A 4W88A 4MJ2A 4FF5A 1UD8A 3AIVA 3GBEA 4JKMA 1J0IA 1ZBVA 4HP5A 3RM8A 3EDKA 4F79A 2EPLX 1ITXA 4QCEA 3VIJA 1J11A 3FXYA 3IJ8A 1TE1A 1KXHA 2JFEX 2DSVA 3BSHA 3W81A 1XGZA 3TP4A 1V3HA 2DIEA 5BXTA 5IFTA 2BVDA 2XVGA 4CN1A 2VR4A 2OWXA 4W85A 5EFFA 1VENA 5AYBA 4BA0A 1B1YA 3AISA 4F9DA 2GJXA 1HKKA 2Y4SA 3TTQA 1V02E 1BAGA 3M6DA 2OSWA 4CN4A 4J3SA 4JHZA 3VINA 2WHJA 1GUVA 3WD1A 5CGMA 1S46A 1EGZA 4UQEA 3WELA 3W4RA 3WF1A 1VRXA 3RJXA 4ZE5A 3GNRA 2J7FA 2WKLA 4ATLA 2ZUTA 5BCAA 3ZJ8A 2J25A 3VD3A 1EIBA 3LPFA 2V3DA 2WCSA 2WANA 4ATDA 5D9MA 5A8QA 3S6TA 3GH7A 4TX8A 4RE2A 4PTWA 4UFIA 4HA3A 4N42A 1TCMA 1ISZA 3K46A 3CZEA 1JNDA 2G4FA 4EANA 4FLRA 3WKZA 3AXXA 4OBSA 1UD3A 5CGTA 4GZEA 1E4LA 4AZ5A 1G94A 3UERA 2FDMA 1BYBA 4M82A 5BRPA 2E9BA 4U2YA 4V27A 1GOMA 5A94A 1QNRA 2PBGA 2JEQA 1OGSA 1PX3A 1QBAA 2CKSA 4CD6A 4PSRA 5BWFA 2ZIDA 4BQ4A 3RM4A 1EDTA 4KRTA 2D0HA 5EBAA 3PZNA 3RIKA 4AZHA 3KZSA 3PZIA 2J62A 1HX0A 5CXPA 5A6JA 4QFUA 3WNNA 3IAPA 3FW6A 4UOJA 4NF7A 5GQBA 1YQ2A 4UFJA 1UWTA 4W84A 3DYPA 2CBJA 2DT0A 1D7FA 4HA4A 1PBGA 2G3MA 2DT3A 3CH9A 1I1XA 3CUJA 1WO2A 1EOMA 3WQ4A 1SMAA 1MQPA 1UWIA 1M7XA 4C7GA 2FH8A 4UZSA 4UCFA 2J7GA 1ISYA 5HNNA 1W2VA 2FGLA 2YBTA 3LPPA 1HJWA 1BGAA 4Z2IA 5FL1A 1H0IA 4CD4A 2A3EA 1E6NA 1MXDA 2NT1A 1XHGA 2IXVA 3I3EA 1ODUA 2BNJA 2GK1B 3ZM8A 4PMUA 1MWOA 1BYAA 3VILA 2ZOXA 2WAGA 3BAXA 3SCVA 2E3ZA 1CZ1A 2BHUA 3AIWA 1J0ZA 2PI6A 5BRQA 1MVYA 4AD3A 4WSJA 3UCQA 4WKHA 3CUHA 1IT0A 3WEOA 4IUGA 4JL2A 2D3LA 1OIFA 1GOWA 4BF7A 4PN2A 4MB4A 1BG4A 5CPTA 2ZUSA 3GBDA 4GQQA 1FHDA 1JD9A 5AY7A 3NUKA 3W29A 5DFAA 4Z2LA 4MNJA 1QI3A 4LX4A 3PZTA 1KBKA 2D1ZA 2F8QA 2YA1A 1XYZA 4CCDA 3WQ6A 1MW0A 1E55A 1Y7VA 1AMYA 4E2OA 1J9YA 1QNSA 3I3BA 2WC4A 1GJWA 3QHOA 1V3KA 3GXIA 2CBUA 5M17A 3WIJA 3PZMA 3LPOA 1JDCA 1H1NA 2A3CA 4E4PA 4XB3A 2XVNA 2VVSA 1VBUA 4A3HA 2G41A 1HKJA 2WVVA 2EPNA 3ARQA 2WLYA 4UQAA 2YDQA 3PHAA 1KFWA 3PTQA 3T2OA 3WUEA 1QNOA 1H0GA 5GNXA 3ARVA 4OBRA 4HOWA 1IZJA 5GPRA 5I24A 4WKAA 1B31A 5A2AA 2VZOA 2OSYA 4DWSB 4Z2HA 1CGTA 1WZAA 2JNKA 1CGUA 1W1PA 2VI0A 4AZGA 1TMQA 2O9RA 4AD0A 2VX5A 1HVQA 2VNCA 3O2LA 3WDJA 3BAYA 4PTVA 2GDUA 1WDRA 3KWXA 1RD6A 4P8UA 3VOCA 1E73M 4JAWA 4NI3A 1Q6GA 3BAKA 4MNKA 5I78A 3WMBA 3II1A 3TTSA 3AHZA 3PZVA 3UEQA 3WD3A 4PMDA 3VDCA 1E9LA 3A4XA 5C8BB 7A3HA 1HKIA 1KWKA 3L4ZA 2VMFA 2WHKA 4MTVA 5D9PA 1JD7A 2YIHA 3L2MA 3CZJA 2E9LA 4AZBA 3VIMA 1B9ZA 1GVIA 3AIEA 5DF0A 3MSDA 3IJ9A 3LPGA 1J0KA 4J3XA 4UFLA 4KMQA 2W63A 5A6MA 1QW8A 4B16A 1LF1A 4YHEA 3CHDA 1UG6A 3SCRA 1GQIA 1H09A 2W92A 4PMRA 1HVXA 4UQCA 1EHAA 2WZIA 4S3KA 4UOQA 1H2JA 4HA1A 1J0YA 3VMOA 3G6LA 3AICA 4KRUA 1FFRA 1ZBKA 2BY2A 1JFHA 1E71M 4LPCA 5HPCA 3SCPA 2Z1KA 3DHPA 3VDBA 4NSBA 1CXFA 3W24A 5A8PA 1BPLB 4OOZA 4AZ6A 3AHYA 4D1IA 4QLKA 3U7VA 3M07A 3ZJ7A 2Y5EA 4ZE4A 1TZ7A 3CMJA 1GHRA 1DEDA 2C8NA 3ZR6A 1XSJA 2CERA 2WVUA 5AC4A 4U3AA 1TFVA 1UH3A 1K9DA 4PEEA 3AHXA 4X0NA 1E3XA 3FAXA 1GCYA 1G5AA 3T0AA 2PC8A 1DWIM 2O9PA 2HISA 2Y2WA 3ZMRA 2WVSA 4QLLA 1JZ6A 2XM1A 1CEOA 3HJEA 1V0NA 4JHOA 2ZUVA 2UY5A 3PTMA 3ARPA 1VJSA 3FHQA 3SUWA 1UZ1A 3VM7A 2X1IA 1O7AA 4PUEA 2GDVA 3EYPA 4PTXA 1OCQA 4CU7A 4M81A 4P7OA 3AIRA 1R86A 1B3WA 2J75A 2PWEA 1JXKA 2VZSA 1HIZA 3AMLA 3SUSA 1BFNA 3THDA 2HVMA 5E70A 1HJSA 4ACZA 4PTMA 1UYQA 5ABGA 1LQ0A 3N12A 2QMJA 4MB3A 3NDZA 3L4WA 1U2YA 2QPUA 4UNIA 1BYCA 4UFHA 3A6OA 4IPLA 1JZ2A 1VFUA 1W3KA 1DWGM 1VFMA 3RILA 1V3JA 3F4VA 2X2YA 3GH4A 3BLPX 2Y8VA 3MUIA 3AHTA 4WF7A 3WF2A 1CLXA 3VGDA 3AMGA 4F9JA 1CTNA 2J8GA 3ARZA 2RGLA 1G0CA 5M03A 4P8VA 1LL6A 3DECA 3WSUA 1XD1A 1X1NA 1HXJA 3D3AA 2WHLA 1V6UA 5A6LA 5M5DA 1JZ8A 4XZBA 1CNVA 3LMYA 1JIBA 4P7RA 1HJQA 4W5ZA 2OWCA 4AZ7A 1E6SM 2V38A 4RE4A 3WMSA 1ZBCA 4B3LA 1GOIA 1KXVA 1JNEA 1WB0A 2EXOA 5ABFA 1AVAA 5E9AA 2NSXA 3WQ8A 2WVTA 1E4NA 1J01A 2BHZA 3F5LA 3GH5A 1XD0A 4DWSC 1MW3A 1EOKA 1H11A 1XSKA 1BVZA 3QOKA 4Z2KA 1HJVA 1VJZA 3THCA 3UR8A 2CPUA 2J8FA 4LYRA 2CHOA 4HOXA 1BVNP 1B0IA 4ZFMA 3EBVA 3VD9A 4Y7EA 2FH6A 4Q22A 1GOQA 2Y8KA 1QHZA 3AI0A 4GKLA 5JUVA 3SIMA 2GFTA 4BZYA 2BFGA 3GM8A 1CECA 1WCGA 2ZUWA 4BQ3A 2QPSA 1CXIA 1H41A 5A6SA 2WC3A 4OOUA 2WNWA 2ZX7A 5A6KA 4QAWA 1J0HA 1W3JA 3SUTA 2Q8XA 2YBUA 2EQDA 1NWTA 2J4GA 3L4VA 3WDRA 3TTYA 3ZOAA 1QNPA 1WKYA 2WC7A 2E9MA 3T0BA 1V3MA 3L4XA 2VX4A 2WMIA 3CO4A 5E6YA 1UR4A 2CETA 2W91A 3OLGA 1PJ9A 1WDPA 2YL9A 5EB8A 8A3HA 3WUFA 5F7UA 1MW1A 4AD4A 2DPEA 2ZE0A 2V5CA 2B31A 2ZXDA 3RCNA 1UWUA 4PCTA 2DQXA 1O6IA 3T08A 5GNYA 5JBEA 2DT1A 4AW7A 4WKFA 2D2OA 4AMCA 4U33A 5A2BA 1KQYA 1H4PA 2E4TA 4QCFA 1JFXA 2X0HA 3N04A 3FHAA 2OWWA 4LGXA 2WMHA 1DWJM 3WL0A 4P8WA 1OGGA 1DTUA 1H5VA 2XGIA 6CGTA 1K9TA 4WSKA 2XIIA 4IM4A 4AIOA 3WNPA 3BLKA 3VIGA 4R27A 4HMEA 1L8NA 4CU6A 3SUVA 4IPNB 4MB5A 5IHSA 2DH2A 3CHCA 1WPCA 3CZ8A 3HMCA 3NCOA 3WD0A 3ZSSA 5CZKA 1WZMA 1VAHA 2GJXB 4UQ9A 3RJYA 4L4OA 4EK7A 1X6LA 1E1EA 1JZ5A 4PMXA 1HP5A 1VFOA 1XCXA 2XTKA 4UFKA 1XH0A 1UWQA 1W9PA 3CZLA 2DEPA 1FOBA 3N18A 5D9NA 3N11A 3T2PA 3VGHA 1ODZA 4H04A 1XC6A 5A1AA 3U5YA 1G1YA 3WD2A 1BYDA 2ZWYA 1VBRA 2VC9A 1US3A 2XVLA 1LJYA 1CXHA 6A3HA 1HL8A 2VCBA 2F61A 1W9XA 2UWFA 2WB5A 1Q6EA 3WH6A 3GNPA 3N15A 2JIEA 1N82A 1GHSA 2WKGA 3AMCA 2VR5A 2XG9A 1W9UA 5HBFA 2BVYA 3AIQA 2XUCA 2XYLA 1VF8A 1QI5A 4D6DA 4HU0A 2PWHA 1JDAA 2ZUMA 3SCQA 1JAEA 4U2ZA 1EO5A 5I79A 4TOQA 5KZ6A 1BQCA 3OLIA 3WEZA 5E0CA 4H8HA 1E4MM 3ZT7A 1ZB5A 3RDKA 1A3HA 3F5JA 4HZ6A 1JAKA 1BLIA 2EPKX 3WH7A 1JDDA 1LLOA 3EDEA 3ZIZA 4B3KA 4PCSA 5FKYA 2WMFA 2XVKA 4F8XA 1KCLA 1UA3A 3MV01 1G01A 4W86A 1UWRA 3ZSTA 4M80A 1UQZA 2DT2A 4J3TA 4BS0A 1UKPA 1CGVA 3MSGA 3VD5A 2JIWA 2XM2A 1OB0A 2XGBA 2EPOA 3SEPA 3BXWA 2WMIB 3WNLA 1HP4A 4CD5A 3BMWA 3CZKA 2PMRA 4PMNA 4XUYA 3PBGA 1OT2A 1ESWA 3K8MA 1E5NA 3GYCA 7TAAA 3EMZA 4UOZA 3WF0A 3W38A 1U30A 3T2QA 4QLJA 3ARTA 1WNOA 4F66A 1UWSA 1ZS2A 4W8LA 4AEEA 2VJXA 1RP8A 2WBGA 1OD8A 2AMGA 4KGLA 4CGTA 4GZJA 1WDQA 2WK2A 1ISVA 1E0XA 1B3VA 1J0JA 7CGTA 1FP9A 1RP9A 3WQVA 3AZTA 1C90A 4PMVA 3WH9A 5EFDA 4QP0A 1V03A 1V6YA 2G3JA 3BMVA 4ZEPA 5M3WA 3QHMA 4E8CA 2ZX6A 3WH8A 4U31A 2XPKA 3U7BA 3VU2A 4JCLA 3VM5A 4M1RA 1FFQA 3M46A 2QHAA 2ZUNA 4JKKA 5C71A 3AIBA 3VDHA 1R87A 3NIYA 2W4XA 3WL1A 1HF6A 1JZ3A 1UD4A 3RM9A 1UA7A 1PIFA 2GJRA 2GSJA 2J77A 3MUY1 4N0RA 1GJUA 2ZXBA 2V3FA 1RPKA 3OLDA 2DH3A 1OD0A 1UR9A 5IDIA 4TVDA 3UR7A 3BH4A 1M53A 4HPGA 4W7WA 5CSYA 1V6VA 1XCWA 3J7HA 3SURA 3WDIA 1UKSA 4EE9A 4UQDA 5BROA 3TTOA 3K8LA 3ECQA 1LWJA 3W25A 2UY2A 3MU7A 1LG2A 2XFRA 4HMDA 2C7FA 2WWDA 4W7VA 4U5KA 2QV4A 1UH4A 2QF8A 5D4YA 2O9OA 4HZ7A 1PPIA 3VDAA 5E0FA 2OYKA 2TAAA 3VMNA 1UR8A 3OG2A 2MANA 2CBIA 3VVGA 1LL4A 5LYRA 4CUCA 2GJPA 4Q7NA 5LA2A 4ZXOA 2BY3A 4BQ2A 1UR2A 1C93A 3MMDA 2BXYA 1Q6CA 3VMPA 1KGWA 4TXEA 4JFSA 1J10A 1UR1A 3W28A 4EAMA 1JGIA 3AS0A 3ALGA 4MNMA 3QR3A 1KXQA
chains in the Genus database with same CATH superfamily
5KZEA 1QHOA 1W6TA 2G95A 5CPMA 1A5OC 1NWRA 2AQOA 2QR6A 3EWDA 2P3EA 3B9DA 5ABHA 1TQXA 1SO6A 5C7VA 4LVFA 1GJPA 1TWSA 4O12A 2WJEA 2VOTA 4H8UA 4M19A 3TLQA 1W1YA 3M64A 5LHEA 3CUIA 4G7EB 2JBMA 3UQNA 3EMCA 4PMOA 4IF2A 3MI3A 2PS2A 4DUWA 1M9HA 1KLZA 3KRZA 4K2SA 4HVXA 4N6EA 4FLOA 3ER9B 3CHEA 2F7RA 1X39A 1S2TA 4ZO9A 1Y0EA 4GYFA 1I2QA 2JF7A 3HO8A 3UWWA 4D1JA 4MZ1A 3V1PA 2VCCA 3KL0A 4OT7A 1XIBA 3QNJA 1YIXA 4BEUA 3BMXA 3WG6A 2QLYA 3EX4A 3GTHA 1JPMA 3HN3A 3WF4A 1XRVA 4UTTC 3ZO9A 2VUNA 1DPMA 3CXOA 3MHFA 3VPLA 2WMGA 3MVIA 4RJEA 3IIVA 5HQLA 4XAZA 4UQBA 3ZYZA 3VX1A 1WBJA 3W1PA 3HGSA 5C9XA 3CTTA 5FEZA 4JTGA 4NZ1A 5FD0A 1AQ0A 1POJA 4XBKA 3I04A 1PHQA 3GXTA 1HNYA 1H62A 2PDGA 4XSLA 3R0KA 2GVYA 2E0PA 1XIEA 2ACRA 1QW7A 1FWWA 2JF6A 2XJ7A 5RUBA 2HBXA 3EWCA 3P5YA 5ENLA 5BOOA 1KM3A 1RVGA 2FB3A 2NLIA 3T78A 3OQEA 3B0UX 2WMJA 1OA0A 2PCQA 3FKKA 4FLSA 4J3UA 3MSYA 4J3WA 2FGZA 3WMCA 2OO6A 4UB9A 2YLAA 1T5AA 3OG3A 3TONA 4Q8MA 1B3ZA 2ELBA 2UV8G 2J74A 1TTPA 1W1ZA 3UGRA 1XSIA 3E5PA 1CPUA 1I4LA 3ZWSA 3AJ7A 3U9IA 1EDGA 1KV5A 3S9YA 2CZEA 4UZUA 3NOEA 4XD6A 2GGJA 3DFSA 2XHYA 1FH9A 3ARUA 1VCFA 3EX6A 2PMQA 5F2LA 3VOIA 4HR1B 3UG8A 1V8EA 1YEYA 4OJYA 1GW1A 3RMEA 2V3EA 3K4AA 1XRSA 2NQ5A 3FVDA 3C8FA 4GO9A 3M0YA 3AHVA 3KTSA 2ZZ3A 1WAWA 4MIMA 4UTUA 2BB0A 3W73A 3M1ZA 2QUNA 4H7VA 1NH6A 2NSOA 3AYRA 3V1HA 4YTRA 1M7OA 1TTQA 1GNXA 4NJGA 1IXQA 3VIPA 2F2HA 3PF3A 2GOUA 3CIVA 2FFIA 3CQHA 2VQUA 2ZZ6A 1DJXA 2ZQ0A 1HFBA 2INFA 4EWJA 1KM6A 4YTSA 4HIBA 5HQEA 1U33A 1XG4A 3QRHA 3U4AA 1DIDA 1R34A 2D22A 4UDXX 2OZTA 3C2RA 4OE7A 2AOSA 1NQ6A 1Y2OA 3BC9A 3MP5A 3PLTA 1M01A 2WYSA 3AMKA 1FDZA 4WSHA 4P7LA 3UESA 1KWGA 3TN6A 1UPPA 4LYQA 5ABTA 4MPKA 3TSBA 1GPWA 3TOYA 3H2AA 2AGTA 4Z08A 3MUAA 4O0ZA 2GGGA 3SY8A 1QNQA 1UJPA 5ECVA 1OSEA 1UB3A 2PWGA 4KFPA 3GG1A 1TVPA 3AO0A 4HJFA 3IANA 1XP3A 4K8HA 4NQ1A 2BXZA 3DC8A 2PDIA 4Q4KA 4DBWA 3MS8A 3I68A 1HL9A 1VBJA 1ML1A 1C3FA 4IT1A 1TUXA 2QIIA 1BG9A 3MA8A 4XQ6A 2QAPA 4S1FA 5H8MA 2BHYA 3FA4A 2QUTA 1I8JA 3A3HA 1GOOA 1CYGA 3RX3A 3ONCA 5LXEA 3IGHX 1V0LA 2AGKA 3PPHA 3GRIA 2AAAA 3DX1A 1QBBA 3DHUA 2ISFA 3LSBA 4WX2A 3STEA 4KFNA 4DN1A 1P0NA 4KWUA 2Q02A 4YTUA 2IKIA 4A3YA 4C90A 3CPUA 2D0FA 4AYSA 1VCVA 4FF7A 4PUDA 1O60A 1TPFA 2IPWA 3NQDA 1OINA 4W7UA 4MWAD 1EO7A 2ZA3A 4NI8A 3G1HA 4GJIA 3H70A 3SCOA 2W62A 1SM9A 2RDXA 1F2JA 1W5PA 4R7WA 2WW5A 3F4NA 3CQ0A 3SFKA 1R38A 4GZIA 4TVCA 1PZ0A 4XVEA 1SFTA 5G4EA 1PZ3A 2WWCA 3EKLA 3FJNA 2DP3A 3K1DA 3FK4A 2WQDA 3M43A 1RK6A 4B9YA 5LNSA 3QV8A 3WCZA 1UIOA 3GXDA 1FP8A 1KFEA 5KEZA 4FZSA 3EB3A 4O57A 4OIFA 4MY8A 3C2EA 3M0XA 1BF2A 4JBRA 4WK9A 2W66A 4GVFA 1E5JA 1E9YB 5HANA 4PMJA 3WF3A 4MAVA 3S1UA 4HBKA 1W91A 3APYA 3BSMA 5JBFA 3U2OA 3CIXA 5LGZA 3CLWA 3VIIA 4UMCA 4JTCA 1VEOA 1WE5A 2ZCGA 3VIKA 3NAVA 5D9OA 2I5GA 5F1VA 1N8WA 4GYPC 1A4LA 3THQA 4RL3A 4IWOA 4Q8UA 3CWHA 4IL0A 4O4VA 4KGJA 4H00A 4DVOA 1UD2A 5FJIA 4NG3A 1E9VA 3H7UA 4NRSA 3SGUA 4JNZA 2NUXA 4LSBA 1K6AA 3B9AA 2Q09A 3MW7A 1WA3A 1WKDA 2GVGA 4M7TA 1I45A 4L64A 2F6UA 1IF2A 2ZA1A 2J9ZA 3ELFA 3CS2A 2C3ZA 3TR9A 4YYFA 1CBGA 1QHPA 3TLLA 1RBAA 2GK1A 2X7VA 3W1UA 2YDSA 1TV7A 1IYXA 2HNEA 4JTEA 5CZSA 1QOQA 4QTGA 4JIEA 3AXKA 1NOWA 4JOMA 1IZKA 2F6KA 4MB1A 2Y24A 4H9UA 3HV8A 4TTGA 1YRRA 1Z89A 3W1RA 2NX1A 2VO5A 2J66A 4C7DA 1XLKA 3HFTA 2X1TA 1C91A 1OIMA 2YZRA 2A3HA 3KS5A 2OZ3A 3VNDA 1F61A 3QXBA 3IK2A 3W86A 3AROA 3DOPA 1DTNA 3QN3A 3KZPA 5G1MA 2OZNB 4FMVA 1OJXA 3FY1A 4GY1A 4A4AA 1TWIA 4O16A 4GK8A 4QNWA 9XIAA 1P0DA 4YTQA 1BXNA 2XGZA 2XIBA 1KV8A 1HO1A 4NAEB 4Z1DA 1CXLA 3OK8A 3GU1A 1TQUA 1MNSA 1VIWA 1KBBA 3W7CA 5HUOA 1BRLB 4D71A 3PY2A 3ARSA 1XLJA 3WQPA 4AVMA 2V2HA 2X0SA 5HDRA 4CNTA 1OBAA 3BGAA 2X05A 2E40A 3I10A 3B4UA 3P7YA 4FIQA 3GAYA 4UTWA 1GG0A 3C2YA 4JQ3A 3W76A 1S2CA 1LUCA 3R58A 1E6QM 1AJZA 3HQNA 1Y5WA 3VABA 1IV8A 4GG9A 1F3XA 3SAZA 4UTKA 2W5FA 1CGYA 3QMTA 1DWAM 4URIA 5TNVA 2WNQA 3HAJA 1L0PA 5C9WA 4JWEA 3ES8A 1T8QA 5T91A 4CNNA 3N19B 3C8NA 1QOXA 4ZO7A 1VHNA 3TJIA 3UYCA 3P74A 2YIVX 4GPNA 1W9BM 4PFHA 1AW1A 5I5RA 3OA5A 2VHLA 4JN6A 1WXZA 3TFXA 2EEXA 3W71A 1W3LA 5JIPA 4OKDA 3DHDA 3OVPA 3UNDA 2RGMA 3NL2A 3UJRA 5IOBA 3S1GA 2FHCA 1UC4A 5CSUA 5K7JA 4LWWA 1OFRA 2FMOA 1W5QA 1C8QA 3C2OA 3G0SA 5DCDA 3BVWA 1EZWA 1UD6A 1WKEA 4HOZA 3CZGA 2YL8A 3JVAA 1OM0A 2H3BA 3NFUA 4EXBA 3TN3A 4H6EA 1YX1A 1TJRA 4XTIA 2C6QA 4D6CA 4ZOCA 1W56A 1TJ1A 1I60A 4N02A 1XXXA 3WLTA 1ZU8A 4KIRA 2EWFA 3HFYA 2ZA2A 4PCFA 1WOBA 1K70A 5EMYA 1CDGA 1J4EA 1JZ4A 2OYMA 2Y5SA 2YL6A 4UUIA 2YOCA 1AW2A 1YKWA 1Z32X 4Y8FA 3TSDA 1ADSA 1B3XA 1SR0A 3BCDA 4Q4RA 1NARA 2W6RA 1FWDC 4BFAA 3AZSA 2FICA 3AS2A 4HN8A 1Q8AA 3KHDA 3JUGA 2OW6A 1ZTVA 2VFIA 3ZR5A 4AIEA 4I90A 4LS0A 4J28A 3M7SA 4MM1A 4Z1CA 2OU4A 4BQ5A 3QE6A 1GOKA 2XSAA 3IRDA 3QYSA 1XH2A 1DHKA 4JNMA 1PV8A 4TVUA 4C6KA 1V0MA 5BNKA 1BTMA 5BYWA 1LWIA 4G9PA 1I2RA 1RJQA 1CI1A 1EJSC 4R3UA 2YI8A 4HK7A 3DN5A 4O1EA 3DERA 3AU2A 1R3WA 3IEBA 4A29A 1LRTA 4L4PA 1E0WA 3PZOA 4MUPA 4GIAA 2VC5A 1FXPA 1O4UA 3KLKA 3EAUA 1REQA 2CC0A 4S3GA 2D20A 3TKFA 1NTHA 1DJWA 1QWUA 4AVOA 5KSWA 4IL2A 1UWAA 2QCCA 3GY1A 4WXYA 3KOWA 3IVSA 2YA0A 1VZWA 3C4UA 1JG9A 3HPFA 3ZFHA 1E15A 1XLBA 3KRBA 4D6JA 4QE1A 3T05A 3D52A 3ME3A 3TN4A 4AC1X 5A2CA 1V51A 2ZX9A 5CZJA 4F40A 2VENA 3BVVA 3GG7A 2WM1A 1ZUAX 3TWAA 5AB3A 1Q13A 1W5MA 2DUAA 3LD5A 3CVRA 3FYOA 4LUTA 1XGZA 3L5AA 1V3HA 1R9XA 2BVDA 1HGYA 1BEUA 3CHVA 1K6WA 5G4WA 5AYBA 4BA0A 3N25A 5B7YA 1B1YA 3AISA 3EJPA 3M5ZA 1J79A 3ZLGA 2PDNA 2Y4SA 3T48A 1V02E 2C14A 3TR2A 4CN4A 1SUFA 3FGCB 3RGTA 5D37A 5AHMA 1AW5A 1XDJA 2EPHA 3W4RA 3QLDA 1T40A 1D3GA 3GNRA 1S2AA 3EB4A 1EPXA 1XBVA 2E68A 3LPFA 4H9YA 1SUXA 2WCSA 3GC2A 5D9MA 4UDYX 3A5VA 4H2HA 4C60A 4RE2A 4PTWA 1ME7A 4MWAE 5FSEC 2XZ7A 2JGQA 2F38A 3STFA 4I7UA 4XZHA 5TBOA 4EANA 3PAOA 3WKZA 2ICSA 3AXXA 4EZPA 4X60A 2D2JA 5LNRA 4M82A 1BYBA 2PCEA 1XINA 5BRPA 3RG6A 1Y65A 4U2YA 1XLCA 4V27A 1GOMA 1QNRA 1KD0A 4KBXA 3BUVA 2P8CA 3UZJA 2YW4A 1L6YA 3N2CA 3M0HA 1MZHA 4L5ZA 4OUIA 3N6JA 1B57A 3WBXA 2Z0IA 3RM4A 2D0HA 3KZSA 2J62A 3HV9A 4ZA0A 5A6JA 4JIRA 1XL9A 2OEMA 2PRLA 1J96A 2G50A 3UJEA 3TJLA 2CBJA 1OVDA 3CH9A 4HCDA 3CC1A 3WQ4A 1A4MA 1XLHA 4C7GA 2PDFA 3QMSA 3EJUA 1SZRA 3V0UA 2QUVA 1ISYA 2DJLA 4PR4A 5LZLA 2FGLA 2YBTA 3LPPA 4UC5A 3L7RA 4NHVA 1VKFA 2NT1A 2IXVA 4EF8A 2YBVA 4DAIA 3C5QA 1QRQA 1O7DC 5LIKX 3BG5A 3LGDA 5JQ9A 3SCVA 3XISA 1CZ1A 4JY9A 3AIWA 5BRQA 4AD3A 3E12A 3V5FA 1FWJC 3WBYA 4IUGA 4JL2A 2D3LA 1TV4A 3PUGA 3CYVA 1FCBA 5U7SA 1MJGA 4MB4A 1BG4A 4QR6A 4JY8A 1JD9A 1TX2A 4Z1YA 1NF7A 5AY7A 3NUKA 2Y61A 1QO2A 1QI3A 4LX4A 4NYUA 1NSJA 2X7WA 3TQVA 3LCWA 1MW0A 3M0LA 3W7OA 1E55A 5IBXA 3I3BA 1GJWA 2Q8ZA 3ITYA 1OCNA 3VNIA 5I00A 4XD4A 1V5XA 4JN8A 3H21A 3G1AA 3L5MA 4JQAA 3LPOA 4KCUA 1J6OA 2CLLA 1H1NA 4E4PA 2VVSA 1A5AA 3TUUA 4XAGA 1VBUA 1UPXA 3QM3A 4KEZA 4J1OA 5J04A 3LNMA 1HKJA 2JKEA 4C1LA 1YTDA 4JWIA 3O06A 3FJ4A 1SJCA 3G0UA 4R9XA 3PHAA 1QNOA 2A4AA 5GNXA 4XVDA 4JTKA 1JPDX 4LVAA 3GKAA 4MFDA 4HOWA 1IZJA 5GPRA 3DPQA 1AMKA 1U1JA 1DKXA 4ZL1A 4DWSB 1WZAA 3URQA 1TPWA 2JNKA 4EZZA 1ZHAA 4LUTB 2NVAA 3M5XA 1TMQA 3V18A 2VX5A 2PTWA 2VNCA 3JW7A 4I9MA 3O2LA 3R2GA 3BAYA 2GDUA 1KKOA 4DBSA 4H8SA 3R8HA 5C55A 2EKCA 4O14A 4S39A 4MNKA 5DANA 3WMBA 3AXMA 3SSJA 3TTSA 3C0SA 3QLLA 4XAYA 1GVQA 4NJJA 3VDCA 2GSEA 5C8BB 3S2LA 8XIAA 4MTVA 5FJTA 2YIHA 4CCZA 3RF9A 1QU4A 2HMCA 4AZBA 1GVIA 7XIMA 2X42A 5DF0A 3FV9A 3B97A 4FXFA 5AKQA 4UFLA 3NYZA 3BLLA 4Q8QA 4XWUA 1EGMA 3TQ0A 1WBHA 5A6MA 3Q58A 3CHDA 1JQXA 3UFYA 1UASA 3W7RA 1PTGA 3ANYA 1WV2A 1H09A 3GWQA 4MG4A 5LXXA 4UQCA 4S3KA 2OKTA 4RNFA 5B7ZA 1H2JA 1IXNA 3GG0A 1RQHA 3PSVA 1ENUA 1A5MC 2ON3A 1QK2A 1E71M 3VK5A 4HNUA 4L6HA 4OQVA 3CV7A 2FTYA 4IMFA 4RNJA 4BJHA 1B3OA 1TJ0A 1CXFA 4A8RA 2P0IA 3N2BA 3OHIA 4YLWA 4QLKA 3GHSA 2OELA 2PDKA 4O1FA 4DNHA 3QVQA 1K77A 4FEZA 1A5KC 5H2ZA 3NPVA 1A3WA 2C8NA 1Z41A 4FXJA 4GMEA 1EF2A 1K7FA 1XSJA 4L65A 2WVUA 1IHIA 5EY5A 4U3AA 2FMNA 2VWSA 1TFVA 1UH3A 3NQCA 3AHXA 3GDKA 4PO2A 1PUDA 2QVNA 3S1XA 1RSCA 2CWNA 2PC8A 2O9PA 3TDFA 2GGHA 2Y2WA 4EXAA 4QLLA 4UTLA 3HG5A 3LU2A 2XM1A 3HJEA 4O8AA 1XIIA 4IIFA 1FY6A 2ZZ1A 1N8FA 3ARPA 1VPXA 3WK3A 2X1IA 2R91A 2WJFA 1VIZA 5DXYA 4P7OA 1OX4A 3RR4A 5DELA 2DJXA 1PKNA 2R8WA 4XZ9A 2XIJA 3KBNA 3PJWA 2O55A 4QSFA 3AYTA 1LQ0A 4RDYA 4AH7A 1FWCC 4NX0A 3CWNA 2ABBA 4FOUA 1KCZA 1ME9A 1EIXA 1MUMA 4OTKA 4UFHA 4P5UA 3A6OA 1JZ2A 1W3KA 3GTXA 4R85A 4NJKA 1V3JA 3LBCA 3UJ2A 1KM0A 4QS6A 1YXDA 3ITCA 2Q01A 3MUIA 4WF7A 3VGDA 3AMGA 2VEKA 4F9JA 2INEA 1C9WA 1JPKA 3ITVA 4MYAA 3EXTA 1PXGA 3DG6A 3DECA 1LRNA 4IFRA 4A8NA 3UY8A 1V6UA 2FZDA 3NQAA 4XZBA 1CNVA 1JIBA 3MHUA 7PTDA 1HJQA 2YIBA 3LRLA 3ZEDA 4F48A 1PL9A 3AALA 4AZ7A 1LTDA 1E6SM 2FTPA 3V0TA 4O53A 4M5PA 3WMSA 1GNLA 3GW0A 2ZC1A 4HPNA 2GVJA 1FCUA 3WQFA 2WVTA 1MEIA 5E1QA 3F5LA 5HNUA 4DJFC 3TYUA 4DZAA 5REQA 2HEJA 3P67A 1XSKA 3OHMB 3NDOA 1VJZA 3THCA 1GTEA 3UR8A 4ZB2A 4IMAA 2CHOA 1M1BA 2QJJA 2J9YA 3DI1A 1IXOA 4EZYA 4Q22A 1QHZA 2DVUA 4GKLA 3M0VA 4FNUA 4BZYA 4JEJA 2ND0A 3GM8A 4ZB5A 1L6SA 3EB2A 3M41A 4PFMA 2OZ0A 4LF1A 2B0MA 3SADA 2CWXA 5A6SA 2WC3A 2PRMA 2WNWA 1BXCA 3K5XA 4AY7A 1W3JA 4QE5A 3H2CA 4PBFA 1NWTA 2RUSA 4E5TA 2AQVA 1QNPA 1QWKA 4AAJA 3GYEA 1DJIA 2E9MA 5TAOA 3T1GA 2VX4A 1UR4A 1S1RA 3E49A 2HK0A 4QJ5B 3FGCA 5HINA 2GJNA 1WDPA 4D8ZA 2J6VA 2WZTA 4B5UA 2DPEA 2ZE0A 2V5CA 4ADSA 2B31A 3SDOA 3KDRA 1F73A 4QE4A 2DT1A 4FNRA 4GNJA 2VM8A 2Y89A 4Q7IA 4QCFA 1YMYA 4OV9A 3FHAA 4RZ5A 1GN9A 2YDAA 1V7YA 4GRSA 3B8DA 5DRIA 4Q8TA 3BV4A 1DTUA 5DN1A 4WSKA 4PGLA 4BF5A 3WNPA 4IP7A 5BWAA 3CAWA 5T8GA 1BWLA 2O4MA 3VIGA 4DQWA 3FKRA 4MB5A 4INFA 1VJIA 4L6OA 2DVTA 4UQ9A 4FNSA 5T9BG 1JZ5A 1QMLA 2D2HA 2Y0FA 4UFKA 3UZYA 1Z7AA 2DEPA 5C2XA 2XISA 3STGA 3N11A 1EL3A 1ODZA 5XIAA 3SRHA 3P0XA 5A1AA 1OY0A 1AH0A 4QGCA 3QEZA 3W2JA 2VC9A 1J5TA 1Q6RA 1CXHA 4TMCA 2J6XA 2HV5A 4DX3A 2J8TA 3R94A 3N15A 7ENLA 3F2BA 1N82A 1WOAA 1LQAA 3LHVA 4EVZA 2VEPA 4IHCA 3G1RA 4HNOA 1M5WA 1W9UA 1K7EA 5HBFA 2BVYA 5K2ZA 5IRPA 4C6EA 1F3EA 2V0TA 2Q3RA 3D51A 3IWPA 4D6DA 4RNHA 4GA8A 3UA3A 4AXKA 3UVAA 3JRKA 2PWHA 4MMWA 2PTDA 2ZUMA 4MOZA 1K02A 2KHOA 4HPXA 1CX9A 1XRTA 1YLVA 3OLIA 3T6CA 1RV8A 3LHTA 5AFDA 4H9VA 3C52A 1GEHA 4K3ZA 4LBUA 5H8PA 3F5JA 3OODA 3USZA 3W70A 2EPKX 3WH7A 1JDDA 2EAWA 3EDEA 1R3VA 2C91A 3ZIZA 1H1YA 4B4HA 5H6HA 1QK0A 5JXQA 4F8XA 3P8IA 4XO7A 4MWAA 3B05A 3UXIA 3OW1A 1UQZA 2DT2A 4J3TA 3FLUA 4BS0A 1UKPA 3EWBX 3JS3A 5T26A 4E38A 2PP1A 3EZ4A 2G3FA 3VD5A 5BU9A 1XIMA 2XGBA 4IIDA 3SEPA 4QEEA 2WMIB 3WNLA 5DCEA 3M5VA 3TXVA 1XIGA 3C0LA 1WDZA 4XUYA 4YWSA 3LENA 4ASTA 4E4UA 3GYCA 4LH8A 4YJ5A 3EMZA 1DJYA 1U30A 4YCPA 4F66A 1RY0A 1UWSA 3TZFA 2VJXA 4ZVJA 4F0LA 2AMGA 4CGTA 3C2FA 4S23A 1ISVA 2W0UA 3WQVA 3AZTA 1C90A 3LG3A 3UCCA 3KOYA 3WH9A 3QKEA 1XYCA 1QR7A 2VOMA 3T07A 3BMVA 1DE5A 3CEPA 3I6TA 1LRQA 3RXZA 1IWBA 1OAOA 2F7FA 3O3MB 1ZQ5A 2Y6ZA 1ZAJA 1W1B1 3WH8A 4U31A 2PP0A 3DBPA 3VU2A 2BODX 4NKCA 3VM5A 3WJXA 1ZPTA 3OYZA 1IEIA 2ZRXA 4JKKA 3N14A 1R87A 4Y9MA 1XFBA 1HF6A 5T9CE 5GJMA 3IK4A 3MUY1 4N0RA 4Z0JA 4GQBA 2WNNA 3TAOA 4H8NA 1YTEA 5AECA 1Q2RA 1OD0A 4JIHA 2QUUA 4BK9A 4I9TA 3NZ1A 5CSYA 3LXBA 1FDYA 4LRSA 3OO2A 3M0MA 3WDIA 2I7GA 4EE9A 3B53X 5BU6A 2C1GA 3RLUA 3L12A 1R0MA 4I8DA 3E9AA 4FHAA 2C0AA 3VOJA 3VKHA 1LG2A 1SZNA 2XFRA 2C7FA 1TPDA 2GDQA 4W7VA 4R33A 4U5KA 4KQNA 4HZ7A 4NAEA 3VFLA 1R3QA 4DRSA 1VPQA 2ZFAA 3QFWA 4IJBA 3H4GA 1MRQA 3SR7A 2BY3A 2X1SA 4ZQPA 3V36A 4CEXC 4CNUA 3TK7A 1V6TA 1KGWA 3NL6A 4TXEA 3ERCC 4R5KA 4G7EA 2ANUA 2FVLA 3A9BA 5CAHA 4LYPA 3UGVA 4PMQA 2X1RA 4L7ZA 3QYQA 3R4IA 2SFPA 5DMNA 2QMKA 1UC5A 3VUPA 2WZHA 4DYEA 3WQOA 3P8JA 3W7EA 2C13A 1UR0A 3O63A 3FIGA 4JQ4A 3E0LA 1HTIA 3WLPA 1KLYA 3INPA 4DEFA 4G8TA 2CW6A 3CLMA 4L61A 1TR9A 2OG9A 3UVIA 2J79A 3HB9A 2DSUA 3UXAA 1ME8A 3VKAA 4F01A 5CJ5A 4IFOA 5I2UA 1QPOA 3LM3A 1JI2A 3OIHA 5GVJA 4TTUA 4ACZB 3VIOA 3T55A 1S2WA 1HWWA 1Z44A 4D6GA 3T4AG 1F76A 2F2KA 3L23A 3SCWA 5EGRA 5FIPA 3MTWA 4X0VA 3HG2A 2OBLA 1SW3A 2E25A 3MUZ1 3BWWA 5B80A 3MBFA 2HXUA 4FA3A 2E8ZA 3S4TA 2VZUA 2VZVA 2AKMA 1UP2A 1HJXA 4FIRA 5CPSA 1L6WA 5D8WA 1GQNA 4JHMA 2GA9D 3G1DA 1XUZA 2PFHA 3FD9A 4DJFD 5MHBA 4C6FA 4HNCA 2W9MA 3W6LA 1SFSA 3GDBA 5CG7A 2REQB 2J7EA 3H8AA 4X9YA 1E40A 4FZOA 4E3CA 1A0CA 1F74A 1BF6A 4RUBA 1OFQA 3LLFA 3UA4A 1XLMA 1M7PA 4RPQA 4YVPA 1ISWA 3T09A 3VEAA 4QBXA 4W93A 4NNCA 1AQHA 3MCOA 1LBMA 2VEMA 3IV3A 5FA5A 4IG2B 3R25A 2WSRA 1H63A 1BWKA 2A1YA 1D3CA 1SVDA 4JYEA 4L1GA 3L0NA 1A5CA 4ECLA 2MI7A 1F4HA 4JTLA 1A47A 4QDWA 2XDFA 3SCSA 3UY7A 2HBVA 4Z2GA 3WENA 3BSGA 3GTNA 4KERA 2RT6A 1TWZA 4US6A 4O52A 2OYLA 4Q8PA 4F0MA 3MV11 1EQPA 2VURA 3A47A 2IPJA 3S0CA 1TJPA 4C6IA 4ES4A 3MDUA 1ZJAA 3OVGA 1XH1A 4TMBA 5A6TC 4HTYA 2Y8UA 1S38A 1EX1A 1AH4A 3NWRA 2WSKA 2G3NA 4PRTA 1Q6LA 5PTDA 2XINA 2VX6A 1K3UA 5IHRA 1JXJA 1GKPA 4PUWA 2P0OA 1R8LA 3VKJA 3TH6A 2J7CA 3KBMA 2WPGA 2P3ZA 3WDPP 2OCZA 3T0CA 2V5KA 3NZPA 3GDTA 1DOSA 2AQWA 5D05A 3MO4A 4KESA 4X63A 1QAPA 3DFPA 2HS6A 3APTA 4PYSA 3WQWA 4MFEA 3ZLHA 2X8RA 1WZLA 2XSXA 2DSZA 1JYXA 4AD5A 5K4ZA 3SN0A 2NQHA 4U5IA 3W7HA 3GXMA 3Q0KA 2Q13A 1QI0A 4K39A 3VX0A 1NFGA 2D23A 2YJQA 3O1NA 2E1WA 1CT5A 1EA9C 3DYMA 3LCFA 4WRHA 2Y7DA 3EKZA 3OGVA 4K6AA 2CKRA 3SUUA 4CCCA 4WJXA 4DJDA 1XWYA 5LIXX 1US0A 2FQIA 3JZUA 4CU8A 1FCQA 3A23A 4AZIA 1IXPA 1CIUA 1MW2A 4H9MA 1B54A 2XWDA 3OZOA 2ZICA 1MQQA 5D8ZA 3W82A 3TC7A 2NVCA 2BY0A 3W37A 4CVUA 1E6PA 2NQZA 2MUCA 3QW3A 3SCUA 3ARYA 1MZRA 3SQSA 3PZQA 4ORMA 2JE8A 1UUQA 4AWEA 1WP6A 2ZWZA 5IFPA 2FHBA 3L0GA 3HOJA 2GLKA 3TVAA 4LAKA 4JFTA 4TO8A 3HMJG 2OFJA 3B40A 3PUOA 4M6VA 2VRKA 1R7OA 4LRTA 1R85A 1UUOA 1JDEA 2EGZA 4KRZA 3W9ZA 3F5KA 4UCGA 5H1WA 4EF9A 9CGTA 3OEXA 3MJYA 3KTXA 3M7WA 1X1ZA 1JJKA 1EP3A 2I16A 1K8ZA 3W7IA 4YCOA 2PD5A 1J18A 5LNVA 2GQ9A 4RPPA 3S9IA 1EEPA 3DAQA 3H2NA 4LANA 1AFSA 2X16A 5FF2A 1P0EA 1BHGA 3VGFA 4HB7A 2Y62A 3GNXA 4CNOA 5GJPA 3W02A 4JTDA 1P5BA 4HPJA 2O7QA 2VX7A 2OEKA 3G2GA 4K1WA 3OLEA 4D2JA 3G18A 3V5CA 1LUCB 3NSMA 2X0YA 2PTZA 2F1BA 1E0VA 1KGUA 3QTPA 1E43A 1H5YA 1C7SA 3NQ8A 3VNYA 3LMZA 1R6WA 2J47A 1VB9A 1PKYA 3CQKA 4TV5A 4PRRA 5TIMA 1B5TA 2PZNA 1KQZA 3F4DA 3A22A 1TIWA 4YMZA 2UY3A 1FUYA 4MWAC 1P1MA 3NZQA 3WQDA 4HMCA 4FX8A 5E0KA 4J3ZA 4D9PA 4RZ6A 4U28A 2QXLA 3OBAA 1KR1A 4I7VA 1O66A 4WIWA 1IZCA 4JWCA 1TTJA 5FEPA 4NZ3A 4NZCA 5I06A 1BXBA 3ZJ6A 3NQEA 2Z4GA 5E09A 1S5NA 2E7FA 1MFVA 1EC8A 4WGXA 3MWAA 3ALFA 3VOFA 4YN5A 3G3MA 2Z1XA 3H6OA 1VH7A 3H24A 5LNWA 3KBSA 2PDWA 4IM3A 2OKOA 1I9CB 4OECA 2XFWA 5HMFA 5D03A 4AF0A 1D7KA 1FWSA 2QVHA 3I4EA 3BCFA 4IG2A 5C7HA 3W87A 4KT2A 3GIPA 3EWXA 1AZ1A 4HZMA 2QPXA 3GXFA 4FALA 1GPFA 3L5LA 3OGRA 1WDSA 3TC3A 1G4PA 1OWQA 5FJRA 1JYVA 3N6QA 1LBLA 3GDMA 3MMUA 4REQA 3S9ZA 1OG6A 1GYMA 2QCEA 1NDYA 3KRSA 4CNSA 1K1DA 4HYBA 3Q94A 4BI5A 2ZX8A 6PTDA 4DM1A 3G5EA 1A53A 2EPMX 4W5UA 3QZEA 2Z8YA 3GW3A 4GJJA 2I56A 3B8TA 3V7PA 4A3QA 3AOFA 1GT8A 2FPTA 1EB3A 2CLOA 5J5RA 3DFTA 3GNOA 3LCLA 5EPDA 3DFHA 1OGBA 1VS1A 4DUVA 4KH2A 4C1NB 4O11A 3W2NA 1UIPA 3FCPA 1MFUA 3UZZA 1YNYA 3AFBA 3UZ5A 3G1FA 4ACYA 3BZGA 4TUFA 2QT3A 1Q6QA 3PM6A 3NZRA 4KPLA 1E56A 3CMFA 3P5ZA 3RPMA 4E3VA 5CCZA 1I2NA 4H6RA 3HF3A 3GU2A 3W1LA 4Y9OA 3DX0A 3L66A 4KIKB 4FX7A 4Q6XA 4QDMA 1W1VA 4L9ZA 3RLVA 4K68A 2O92A 1QVBA 2I1OA 2VEIA 3ABHA 4C6CA 1C8YA 3TAKA 4QJ3B 1BSIA 1UKOA 5BXSA 4XV0A 3MJMA 5CLTA 1H3GA 2NQJA 1GGOA 4U3CA 4C6QA 1X6UA 3BZJA 2OO2A 2DW7A 4J27A 4H6HA 4I9JA 1RQEA 4J3VA 1KFBA 2WCAA 2PWDA 3SRDA 4RNIA 5HJYA 1OT1A 2ND1A 4MVAA 3U48A 2J78A 5CJMA 1W2PA 3APGA 4OU1A 1MNZA 2PLJA 1FH8A 4RXFA 4DZ5A 5CSSA 3SCTA 4AHQA 3E96A 3BGGA 2WV8A 3T4WA 3NPXA 1EXBA 3EA1A 3S5OA 4XTDA 2OJPA 1FWEC 3RU8X 3PBUA 4K37A 3O8AA 1T0OA 3DGRA 3GR4A 4WLCA 3TIMA 3I3DA 4HZ8A 4WOZA 3AXHA 1JQVA 3B03A 2PRHA 2A6LA 4IMEA 1LOLA 5XINA 5DMLA 1QDSA 2JNSA 1LYXA 3OGSA 1LT8A 1TV5A 2XFFA 2WMKA 2Q6ZA 4F0RA 3QV6A 3WDQA 2DIJA 2QGHA 1QUMA 4P7NA 2DV0A 1XKJA 4LXFA 3BUBA 4AD1A 3B51X 4IXHA 1HKMA 1YXCA 4HYWA 3G9GA 3QH2A 4WPCA 3UJSA 4CVWA 1RVKA 1EDQA 1GZ1A 2ZTJA 1SYTA 2JALA 5D2WA 2AKZA 3I2WA 3L2LA 3ENLA 4MKNA 4MF4A 2GGEA 4NP7A 5I3FA 2O9TA 4DUXA 4FOKA 3MANA 1E72M 5DT7A 2EF9A 4EIVA 2IKHA 4H3DA 2OZ8A 3KBWA 1PCWA 3QY6A 4XKYA 4B90A 4XISA 2XSBA 3WFLA 1ZCCA 4GLEA 3LBMA 3ARWA 2ZX5A 2ZRZA 4UMBA 3CPGA 4F3HA 1RD5A 2HK1A 4E8DA 2BG5A 1PS3A 4UTWC 2HZGA 3PBVA 2DSWA 4NNBA 5BXRA 2R1LA 2W27A 3NURA 4ERIA 2PA6A 1GYLA 2WCGA 3BVXA 1OFAA 2CHRA 4LT9A 3IJQA 5JBDA 4O13A 1PYMA 2EBNA 1W3HA 3BAJA 3G6MA 2IUZA 1YXYA 1MXGA 2GPTA 4MDOA 2P5NA 3FN9A 2WVVB 4KIEA 3TA9A 1F9CA 5A3HA 4X61A 1NWUA 1GVEA 1FKWA 4JQ1A 2QW5A 4LAMA 2EFKA 1P4CA 3N34A 1EJRC 1FWAC 3MP4A 4W88A 2TPSA 3AIVA 4O50A 4AWUA 4HK5A 4HP5A 2REQA 1OCBA 1ONRA 3VIJA 1F3TA 5I02A 4XZNX 3FXYA 4A05A 3IJ8A 1TE1A 1CB2A 1QASA 2A0NA 3TP4A 2DIEA 1U5VA 5BXTA 4CN1A 3S47A 4M6UA 4ZSUA 2ZDSA 4EZSA 2I17A 2R94A 2Q71A 4RZBA 6XIMA 1HKKA 3KVMA 3S6OA 2QCLA 3TTQA 3LN3A 1WAUA 3M6DA 2OSWA 4J3SA 3VINA 4YWIA 3QC0A 2WHJA 2A7NA 1VHCA 3M9YA 3GO2A 5CGMA 5CBJA 4Z0SA 5D2TA 3WF1A 2FZNA 1UROA 3S46A 1VRXA 2WKLA 2QDHA 1CB7B 3B9OA 1HKWA 2ZUTA 5BCAA 3ZJ8A 1ITQA 1XS2A 3H12A 2V3DA 2YXGA 3LEPA 3SY5A 4ATDA 1IEWA 3EWWA 3SZ8A 2A85A 1TCMA 1ISZA 3BUQA 3CZEA 1JNDA 1H7WA 1KCXA 2E77A 1PVNA 5G1YA 1YWMA 1NU5A 1R46A 4NL1A 4Z1AA 1P0KA 5G2WA 3BURA 4AZ5A 3EPMA 3UERA 2PE4A 4O54A 1EX5A 4PUUA 4GUFA 3A98A 2E9BA 1TELA 2PBGA 4MJMA 2VYOA 1SW0A 3CZSA 1OGSA 2V9DA 1P6BA 2CZDA 1TPUA 4CD6A 3C61A 4PSRA 5BWFA 3N9SA 1ZNNA 2F7QA 4LC8A 4C65A 1A80A 4AZHA 1HGWA 3IAPA 3FW6A 4GIEA 1I49A 4XAPA 4IXXA 4EZRA 3DYPA 1D7FA 1PBGA 1ZAIA 3H23A 3IIXA 4H83A 4ZQRA 2GGIA 2G3MA 3LTPA 1WO2A 1EOMA 2NV2A 5E84A 3OBKA 1Q65A 2H8ZA 1MQPA 1M7XA 4LS1A 3VC6A 2FH8A 4FR1A 3CM4A 3N9RA 4UCFA 3HIJA 3L67A 2ALWA 1HJWA 2ACSA 3DPPA 3IJDA 1H0IA 2A3EA 4TV6A 1S5MA 3C0JA 2GUUA 4QDPA 4DF2A 1DQWA 4Q4PA 3NXLA 4PMUA 3ABXA 3H4WA 2FVMA 4LAZA 2WAGA 3BARA 2E3ZA 5HWNA 3LI1A 4G6QA 2X3XA 2DQWA 1MVYA 4FR6A 1JQKA 3HJZA 4WKHA 1RCQA 2VFHA 3CUHA 1IT0A 3E0FA 2QDDA 4NX5A 3TWBA 1GOWA 1Z3NA 5CPTA 1QPRA 1EF3A 4GQQA 3H7VA 4QROA 5DFAA 4QS5A 4Z2LA 4MNJA 1HXKA 1JR1A 5LIWX 3W23A 1KBKA 2D1ZA 2VDGA 4CCDA 1RQBA 4QG6A 3OWGA 4AEOA 2QUMA 3PVFA 3QHOA 1V3KA 3CK5A 3UITA 2VC6A 3PB2A 1H7OA 3NQMA 3TW6A 3WLIA 3W7DA 2QV5A 4GNKB 1GKRA 4AU0A 3LK6A 3A12A 2P76A 1H7RA 1W8GA 1EEXA 1F8MA 1TV8A 4N9EA 2RJGA 1FBAA 1VYPX 5AVNA 1E2UA 4A3RA 1NEYA 2PC4A 3WUEA 3PTQA 1KW1A 1DL3A 2ONEA 1H0GA 4NILA 3T0TA 3ARVA 4Z17A 3V35A 1VFSA 1F5ZA 3G0XA 3NL3A 3M3WA 1W1PA 2VI0A 4NSWA 3G8EA 2O9RA 2XIOA 4AD0A 3ONBA 1BVWA 5EA9A 1OFDA 3NG3A 4CLMA 5BZAA 1RD6A 4DO4A 4UR7A 3CASA 2YB4A 1SZGA 2QCMA 4UTIA 5I78A 1RBLA 3AHZA 2Y85A 1W31A 3GR7A 5CC7A 4PMDA 1E9LA 4PZVA 4Y8EA 2VMFA 4XKMA 1MEWA 3BW2A 2PUZA 3L2MA 3CZJA 2E9LA 5DY2A 3MKVA 4G7FA 2D73A 3VIMA 2Y70A 2A7PA 5G1TA 4GISA 1JPHA 3LPGA 4UXDA 4J3XA 2EFLA 4UNKA 3M5YA 2W63A 4H7ZA 2XZ9A 1GNTA 4Z1BA 4B16A 3AWNA 2OX4A 4L4MA 3SCRA 1GQIA 1NVMA 2W92A 4PMRA 2WZIA 5A8GA 2G37A 3H53A 1J0YA 2YPIA 3DEQA 2CZFA 4KRUA 4KETA 3EOEA 5D2VA 2BY2A 1QPQA 2ZZ7A 2I5QA 1JFHA 2J88A 3RU6A 3G77A 2GAFD 2Z1KA 3DHPA 3RITA 1P43A 1PHWA 4ZSTA 5AC7A 1G7VA 1J2WA 6XIAA 2OOGA 2OXNA 3UZXA 4AZ6A 1XLEA 3AHYA 4D1IA 3GHRA 2E6AA 3M07A 3P93A 4YVXA 4S3DA 4AX7A 1LLZA 3RR1A 1RA0A 2OT1A 4LNYA 4ZE4A 4GY0A 1TZ7A 2F84A 1GHRA 1DEDA 1QX1A 3KAVA 3ZR6A 2Y63A 2CERA 5AC4A 3QWEA 2Z26A 3HBLA 4KWWA 4IX2A 1H7XA 3CV2A 1GCYA 1G5AA 1MRAA 2OX1A 2NZLA 3FA3A 4HN4A 1ICQA 2HISA 3ZMRA 1DHPA 5I07A 2NQLA 4RW3A 2UY5A 3PTMA 3FHQA 4GH1A 1UZ1A 2Z6JA 3VM7A 4PUEA 2ZBTA 4CU7A 4M81A 1VFTA 3AIRA 1B3WA 2R24A 5AYZA 2PWEA 1JXKA 3S2JA 2YIAA 2VZSA 2WJDA 3SUSA 3L0KA 3SQMA 3N12A 2QMJA 1X1OA 5AHIA 4M3PA 5DRCA 5DX7A 3NDZA 2Z25A 2QPUA 2HE5A 4IPLA 3G1XA 5KETA 4ZTYA 1XIJA 3LTYA 3RILA 4A35A 4GUHA 3GH4A 4GCAA 4CQAA 3AHTA 1EUAA 1DJNA 4DELA 4I1QA 4DYKA 3VXGA 1ELSA 3DDMA 1YTKA 3WLLA 4P8VA 1VFHA 1LL6A 3UYIA 1XD1A 4GYJA 1TPH1 3D3AA 1A5UA 5G2IA 4R5LA 3W2MA 3LMYA 4RLIA 3IJIA 4W5ZA 4JN7A 1ONXA 4J2MA 5EL1A 2ABAA 5D2XA 4RE4A 1ZBCA 4HTBA 1KXVA 1JNEA 3ABZA 3BICA 1WB0A 1AVAA 2QCNA 2BHZA 1J01A 1E1CB 4ZR8A 3QV7A 1HQTA 1K03A 3RLGA 3VZZA 4NZFA 4DWSC 3BVTA 4B92A 4LUYA 1BVZA 3QOKA 1Q45A 4ZFCA 2J8FA 1BVNP 4ZFMA 4JL9A 1RAKA 4Q4QA 2IPGA 4JTTA 4TU1A 3SQLA 3DBNA 3CB8A 4L6DA 1X97A 1WCGA 3E2RA 3LQGA 2QPSA 1TQVA 3CH0A 1TV2A 4S3AA 3WLKX 1U5JA 5A6KA 3DU0A 3STPA 4G2DA 4ICNA 3DDGA 2YBUA 3L4VA 4ZMGA 1J93A 3O0FA 3TTYA 4D8JA 2DUXA 1XG3A 3F2DA 3L4XA 2J9XA 1U1HA 3CO4A 3GAKA 3WK1A 2Z7KA 1AH3A 2FFCA 3WJZA 2VGIA 1PJ9A 2YL9A 5EB8A 1V79A 1K8YA 8A3HA 3WUFA 2DZXA 3W7LA 1MW1A 4W9TA 1UZHA 3THAA 1OFEA 4LUIA 1G4TA 4PCTA 1O6IA 5MKGA 5K9XA 4JYDA 3LRMA 1SJBA 5A2BA 5CH9A 4R9OA 4CQCA 1P48A 3H2EA 4JIQA 2WMHA 1DWJM 3DFQA 2VD8A 3WL0A 1R2SA 3FFSA 5LIYX 1ECQA 4L9XA 1ZENA 6CGTA 1I0DA 1K9TA 2XIIA 3BVJA 4IM4A 4JTJA 2D4CA 2QXWA 3B9NA 1M68A 3LB0A 4X22A 4HMEA 3V75A 5IDZA 3KCLA 3L3PA 5IHSA 3ZSSA 3NCOA 5CZKA 3BV7A 1ZZMA 3TU9A 1X6LA 4JGDA 4PMXA 4Y9NA 3SRKA 1XCXA 1EBGA 2XTKA 5FESA 3ZR4A 4FO4A 5H8UA 1EJWC 1IWAA 1JCXA 1VBGA 5E5CA 4H04A 2HE8A 4DJDC 4KKXA 3EJRA 4MZYA 3EOLA 3WD2A 1G1YA 2ZZ4A 2V63A 3MYPA 2ZWYA 4GJ1A 4LJ3A 4Y9AA 1US3A 3QGAC 1HL8A 2F61A 2QULA 1W9XA 2UWFA 2HCVA 3CL6A 3NZGA 3GNPA 3JR2A 3PWIA 2V2CA 1NQKA 2JIEA 3U4FA 4LY8A 3AMCA 1VCGA 3FEQA 3LTSA 4JIPA 1JVNA 5DBTA 1F3WA 3N73A 3E74A 3AIQA 3AC0A 1VF8A 1XLDA 1H1ZA 3TZNA 4HU0A 1GWJA 3P0WA 4GYKA 2PU1A 5I79A 4TOQA 1IEVA 3UPBA 4F0HA 3WEZA 1X04A 1LLWA 4IIHA 1RK5A 1A3HA 3ABSA 1OYAA 1SFLA 3HAHA 4HZ6A 4RDWA 1JAKA 1A5SA 4I3GA 3KFTA 3WQGA 1J5SA 2Z00A 2JKAA 4PCSA 2XVKA 1KCLA 3I65A 1UA3A 3MV01 4W86A 1UWRA 2FZ8A 4M80A 1R5EA 2R1NA 4PODA 2ZZ5A 4B5WA 5I7GA 5DLCA 1AD1A 3MSGA 2XM2A 1OB0A 2EPOA 4N7QA 1HP4A 4F4RA 4CD5A 3CZKA 3NTYA 2PMRA 3PTDA 4PMNA 3PBGA 1OT2A 1I4DA 3K8MA 1RHCA 2C19A 2A5HA 1E5NA 1NFBA 5G4HC 3W1QA 4UOZA 4NPHA 3BJSA 3WF0A 4XBSA 3ARTA 4E8GA 3OVQA 1TWDA 1ZS2A 4W8LA 1RP8A 1OD8A 1VLIA 2PDMA 3VZYA 4KGLA 4GZJA 1E0XA 1BD0A 7CGTA 2ASHA 1RP9A 4IGHA 4PMVA 3V5OA 3RX4A 3QTGA 2PLMA 1V6YA 4DWDA 4HD5A 1W17A 4KCWA 2V69A 2V8ZA 5M3WA 1AJ0A 3QHMA 4L1WA 4H6QA 4YIWA 2V0OA 4QSHA 1DBTA 5FJJA 1PZ1A 4E8CA 4DZIA 4LB4A 5MKGB 4EZVA 3GC4A 4M1RA 2QJGA 2R14A 5C71A 3AIBA 3RPTA 3VDHA 1E9ZB 1IWPA 1QCWA 3IUIA 2OMAA 4DLFA 1PIFA 3WLRA 2VELA 2GSJA 3DG3A 3GFXA 1J6PA 4WVXA 1OFBA 2V3FA 1RPKA 1TUFA 3OLDA 2R6OA 2FDSA 4O28A 1ZGDA 3S2MA 5FAGA 5AHLA 2NWSA 3BH4A 1M53A 2QKFA 1KBIA 4GIRA 3RO6A 1XJBA 4UQDA 1PS9A 1OC5A 1RPXA 5BROA 3U2CA 3TTOA 4V1YA 2D1LA 1LWJA 3TEVA 1I2PA 5F1UA 1OQFA 4LAUA 3LGEA 4GNVA 3PBYA 3IUHA 5E0FA 4H19A 1LL4A 4F2BA 3QBUA 2GJPA 1OHLA 4Q7NA 4ZXOA 4I5XA 4BQ2A 1W8SA 1UR2A 1C93A 2PDXA 3GVWA 4LEFA 3A4JA 2BXYA 1B9BA 5CBIA 3SGGA 2YR1A 2G5WA 3OPSA 2Z2BA 3S5YA 3W28A 4EAMA 3ALGA 4MNMA 3N6HA 1GONA 4XZIA 3MP3A 5EMJA 3M0JA 4BWLA 3QKZA 5F4WA 5E6ZA 9RUBA 5EMUA 3RCYA 4GVHA 3EDDA 4YS1A 1R3RA 5HXMA 2VL4A 3Q37A 3E2QA 1RALA 4QX4A 1V6WA 4TX6A 4LQ1A 2ZXQA 5U4NA 8CGTA 3ARXA 4RXGA 2XH0A 3R10A 2NW0A 1UQYA 3F2CA 4EPEC 5I23A 3CIWA 3N1AA 1TJ2A 2OLHA 1PX8A 3P81A 3BLDA 3ZT6A 2DGAA 1EJTC 4OUEA 3OTRA 3D0CA 1V93A 4PMYA 2V81A 5C6MA 1SO3A 4ZOEA 5C70A 4FZPA 2D3NA 1MUCA 1QI2A 1O68A 3D47A 4CD7A 5FOOA 4AY8A 3PN8A 3O15A 2OSXA 5F4XA 1WKFA 3T0DA 3GFYA 4PUMA 2Z7GA 2QDEA 3WNOA 1DIOA 2RH9A 3BE7A 5AHFA 3EOUA 1SMDA 3O6AA 1XRFA 1LWHA 5CLWA 4GQGA 4NRRA 1K7XA 3IGUA 1BRLA 4LCSA 3CHFA 2VUYA 2POZA 4JICA 2ESCA 2WHMA 2ZYFA 4W89A 1WDDA 1TRDA 4GACA 5CKSA 2BSLA 3QSTA 3ZZ1A 1LG1A 3BLOA 5ECUA 1FWRA 3PWAA 3TTEA 4O4WA 2PDHA 5FL0A 2WPBA 1GKQA 1K9EA 5I03A 3NSNA 4TQTA 3GVQA 1QPKA 3UCDA 3NM3A 3IVUA 1EJUC 2PURA 1UJQA 2JQXA 3LX9A 2BWGA 4NUWA 2C1IA 1BTCA 4MZ8A 1A50A 1U00A 2PTYA 3AXIA 2Z27A 4CQ8A 3R79A 2PWFA 3H54A 3BAIA 3ZJKA 1RCOB 1OYBA 3AUJA 1UOKA 3A9IA 2OO0A 3UG5A 1M04A 1YDOA 2EO7A 3S5SA 4GO8A 3D2FA 3VIFA 5A8NA 2BS9A 3GZAA 1Q6OA 1A0EA 4IP4A 3QW4B 4WOQA 2ALDA 3SN1A 2CLEA 1ZL1A 2VRJA 1AL7A 1MMFA 4OFCA 1EWEA 1B2YA 3TQPA 5IXEA 3M47A 5K3VA 1UZDA 2QJNA 3DC0A 3DYOA 2E5BA 5JH1A 2TRSA 5M1TA 5TQLA 2CLPA 2FLIA 3P3BA 1B4EA 3CO8A 2BP1A 4QIUA 3I7QA 2FYVA 4QXIA 2G3IA 4A8LA 4MWAB 3O3NB 3L2IA 1CLVA 2EG7A 1KBJA 1G6CA 1MO0A 3UXLA 3BJTA 3W7KA 2VR2A 1OK4A 4DXXA 2I9UA 3CUGA 1HN1A 1XDMA 2VGGA 4QNEA 3QHNA 1D8WA 1RY8A 4R5GA 2ACQA 3L68A 3CEUA 4H41A 3GB6A 3LCIA 4ZZ9A 1BKHA 4PL1A 5HULA 3D5HA 3W1XA 3U5UA 1PX4A 4HSOA 2C1HA 1DIKA 3KRUA 4LBSA 1D3HA 4JTFA 3TYAA 4PB5A 1F6YA 5CC6A 2KZHA 3AIUA 1OG0A 3QPYA 1GYNA 3FAWA 5TKYA 4M6QA 3KW3A 3VC5A 1Q7MA 3FDKA 3SYVA 5EMMA 1IR2A 2DZUA 4WY0A 4NQIA 3ERPA 3WDHA 1U1UA 3W7MA 1TPC1 4AZCA 2WBKA 3TYBA 3P60A 1AD4A 3C7NA 2JK2A 3GR8A 4JFUA 4DNMA 3CUXA 3WBEA 4Y96A 3N3MA 4C5YA 3IJLA 3LM7A 3IAQA 1Q8JA 4XZMX 1S3HA 4BCEA 3KEHA 4WDXA 3D50A 4AXNA 4C6NA 1AUSL 5DT5A 1MYRA 2J7DA 3W6MA 2W61A 2G96A 4PCPA 3HPZA 1O1HA 4GUJA 5ABEA 4IFKB 1FXQA 4N9DA 3RUBL 1F4AA 4ZODA 1YYAA 3U57A 1TX0A 2QAFA 2RHGA 4JLCA 3D4ZA 3C3NA 4FS9A 4EPDC 2QJIA 1F7BA 2NQ9A 1J12A 1RR2A 1MSSA 4A2RA 3A4WA 4RR4A 4M8UA 3PTKA 3PPGA 1UHVA 1EZ2A 1XLAA 3WEMA 4IM2A 5CPQA 4AFYA 1R5YA 3GTFA 4WDTA 5C2CA 1LQ7A 4IJRA 1UBSA 1SZFA 5FF3A 4QG8A 3NEHA 5EYWA 1PZ2A 5I6SA 1KGXA 1RLDA 2YCIX 2X09A 1DJGA 4JNFA 4OVXA 2J13A 1CGXA 2Y1HA 3M0IA 1GVYA 2XVPA 3B9EA 3RNDA 3CB3A 4HGXA 2XN1A 5EMKA 3DPOA 1CWYA 3RFAA 4DHGA 4F0SA 4A8IA 2WXDM 2E5DA 2VDHA 3RCMA 2B7PA 3T4CA 1S1PA 4LY4A 5CC5A 1DQUA 3URAA 3NO3A 1E1FA 2PDPA 4K36A 4B9ZA 2E1DA 2Z29A 3VD4A 3OQ8A 1KRAC 3EPOA 3K8KA 4ZTXA 4K8EA 3IV8A 3BTNA 1THFD 4W4QA 3NR0A 4V28A 1Q66A 3LZ3A 4JTHA 1MQRA 2BDQA 1TMLA 1RUSA 2ODOA 5FEWA 1IT8A 1W37A 1GORA 2OGJA 4AWSA 4PSPA 3PBMA 3GZ3A 4JTIA 3PZUA 3BLIA 1FCVA 3GX9A 3JU2A 3POCA 3LI0A 3BUDA 1V3LA 1YADA 4CCEA 4B5NA 4P8XA 3UU0A 1QW9A 4JNEA 1TA3A 4OBTA 2X30A 1X38A 2WLZA 3VCCA 5HMDA 4QJ4B 2YXOA 4MGGA 2BTMA 3E38A 3DXIA 3O3RA 1TE6A 2XN0A 4LOCA 2UY4A 2PDJA 4ATMA 4I8YA 4MKSA 4AY1A 1JPIA 2XWEA 2QZRA 2Y88A 2HQAA 1Q6FA 4LFYA 4EZQA 1XCFA 4GOAA 3PUEA 4GGHA 4HHHA 2Z1SA 3WBAA 2HS8A 3B8IA 2QF7A 1O94A 3W7NA 4C6PA 5C2GA 4UMAA 4PUNA 2ZC8A 4US5A 4PBGA 1ZJBA 5GNZA 1SU5A 4XIAA 2G8ZA 1B30A 3VTRA 1FTXA 3P80A 1W9DM 2A3BA 1EHNA 1GEQA 1WZKA 3R6IA 3GG8A 5BMWA 2EX3B 3NJ3A 2V6AA 4N9CA 2QEZA 3LCXA 2QGYA 1G9HA 3W2UA 1Q63A 1UCWA 2C79A 3TMQA 3P14A 3AMDA 4OV4A 2IQTA 3S42A 1VR6A 3PZGA 1N8IA 4PMZA 4M24A 2X5CA 4YTTA 4ICCX 3CMGA 3P61A 3KE0A 1X98A 5HNTA 5DMMA 1J8VA 3WUGA 4ZQCA 1EXPA 4GI6A 1JCNA 3UETA 1OYCA 1MI3A 5I0DA 4AKVA 3R7MA 3BUIA 3BOFA 5BXPA 4JS3A 5HA7A 3FNDA 2ISWA 3ZLFA 1XDLA 3CV6A 2OTDA 2PB1A 2LM0A 3KVJA 3EJTA 3S1WA 4AD2A 1TVLA 2R1PA 4IJCA 1Q6DA 1XX1A 4PB3A 4XX6A 1B3YA 4AISA 1UKQA 2YFOA 4H8VA 3C2VA 2VVNA 4DM2A 4N2YA 5KMYA 2V3GA 3VNZA 5DMYA 4HU3A 4GABA 4HNVA 1GVSA 1H61A 4MSSA 3N4AA 4JFWA 3VGEA 4XK2A 4US5D 2VEFA 5FJUA 4OWGA 3W26A 5C5BA 1ZRQA 4IISA 1HJUA 1W9MA 4E3TA 2CNCA 1GVRA 3ISIX 1M7JA 3AS1A 3VE7A 4GXWA 5FF7A 1Q7ZA 1DKZA 2YI9A 5A8OA 2PBOA 3V3WA 1AG1O 4JN4A 1TVNA 2DY3A 3W53A 1DWFM 4GQRA 3E0WA 4RZ4A 3W84A 1P6WA 3ITTA 1LORA 1NOUA 1S39A 3BAWA 2B4GA 6TAAA 2OR2A 3VGBA 4F00A 4ZBCA 5A95A 1IE7C 4JXCA 2CXGA 4J9JA 5CJNA 4AZCB 1IIHA 5E93A 2JKPA 4R7OA 4B5VA 4DI9A 3LLDA 1M03A 1ONWA 5A6AA 1PTDA 3CL7A 1C8XA 1QT1A 4FNTA 5HOSA 2CESA 1NWSA 4EP8C 4AMAA 3DG7A 4LYKA 5HMSA 3IVTA 3TCSA 4Q8NA 4H9TA 2IKJA 3W88A 3AUOA 1W32A 3ZQ9A 3REQB 3QZ6A 1ZFJA 5CSRA 5LA0A 1BGGA 3PJXA 4QEHA 2J7HA 2VP8A 1NOFA 1OZMA 2D0GA 4NY2A 3T8LA 5A69A 1LDCA 1XBZA 3DDFA 6ENLA 1JF5A 2OQHA 3G8RA 1JEZA 3OHXM 4GINA 4LNCA 5LKYA 1EGVA 4Q6JA 1PE1A 3POHA 3BG3A 3PFRA 3RRAA 1T7LA 3AJXA 2VT0A 3CGTA 4HCLA 3BVUA 1H51A 3UG3A 3BLBA 4GXPA 3W27A 1PIGA 1OZQA 3TA6A 3I6RA 8RUCA 4BI7A 1BKSA 3UR2A 4ERAA 4DBDA 5AYXA 3WLSA 4WY0B 2BOEX 1NF0A 2CZ5A 4NASA 3VOHA 3NO1A 3IJ7A 3UWEA 1AZ2A 3NSXA 1CXEA 3I7RA 1KTBA 1FHVA 2QDGA 3T47A 1V4YA 3Q45A 1N55A 4BNEA 2GYIA 3TN5A 2BGQA 4FM3A 2XIQA 4WY0F 4JCMA 3SIZA 1B90A 2I57A 1OEPA 3H4XA 4C1NA 4S3FA 1NDWA 4P7QA 2YL5A 2X3VA 5CGQA 3CT2A 2AL1A 3UR5A 1ISXA 2H6RA 3N17A 1K9FA 3E0IA 3LV6A 4ROQA 3UG4A 3HGOA 2KAUC 1JF6A 3EWYA