2YLLA

Inhibition of the pneumococcal virulence factor strh and molecular insights into n-glycan recognition and hydrolysis
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
436
structure length
436
Chain Sequence
AMNEKLAKKKIVSIDAGRKYFSPEQLKEIIDKAKHYGYTDLHLLVGNDGLRFMLDDMSITANGKTYASDDVKRAIEKGTNDYYNDPNGNHLTESQMTDLINYAKDKGIGLIPTVNSPGHMDAILNAMKELGIQNPNFSYFGKKSARTVDLDNEQAVAFTKALIDKYAAYFAKKTEIFNIGLDEYANDATDAKGWSVLQADKYYPNEGYPVKGYEKFIAYANDLARIVKSHGLKPMAFNDGIYYNSDTSFGSFDKDIIVSMWTGGWGGYDVASSKLLAEKGHQILNTNDAWYYVLGRNADGQGWYNLDQGLNGIKNTPITSVPKTEGADIPIIGGMVAAWADTPSARYSPSRLFKLMRHFANANAEYFAADYESAEQALNEVPKDLNRYTAESVTAVKEAEKAIRSLDSNLSRAQQDTIDQAIAKLQETVNNLTLTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibition of the Pneumococcal Virulence Factor Strh and Molecular Insights Into N-Glycan Recognition and Hydrolysis.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
molecule keywords BETA-N-ACETYLHEXOSAMINIDASE
total genus 175
structure length 436
sequence length 436
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2011-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.90 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 AF1782-like 2yllA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2yllA01
4HMEA 1S46A 4TVDA 5JBDA 2XWDA 2VQTA 3AIBA 2J8GA 2V3GA 3S2CA 1H0GA 2G3MA 4HMDA 4WJXA 1NP2A 1GQJA 3AS1A 2ZE0A 2IXUA 4QP0A 2OWXA 2ZUMA 3KE0A 3AZTA 3F5LA 1ISYA 2WK2A 4YHGA 3BMVA 3E1F1 2JEQA 1FP8A 4AD4A 3F5KA 5CSYA 3KL3A 1WDSA 2W4XA 4CVUA 1XC6A 1RD6A 4AZGA 3BAJA 2J78A 1GNXA 3APGA 3QR3A 1GONA 3EDKA 1NWUA 4PMDA 4UZUA 1OCQA 3LPPA 1MVYA 2CHOA 2Q8XA 4ACYA 2PC8A 4U5KA 2J7BA 1C93A 1K9DA 4NF7A 5I23A 4ZXLA 3ARXA 1F4AA 3QGVA 1E9LA 1J0HA 4WF7A 4P7QA 3IAPA 1ISVA 4UOZA 2QLYA 1C8YA 2VC9A 5FCZA 1JNEA 2BXZA 3WQ6A 4QLKA 1QNSA 5E70A 1TR1A 3TTOA 2X0YA 2VCAA 3CO4A 4ML4A 1G01A 1UHVA 2MANA 2XYLA 1HIZA 2CBJA 4F79A 1WCGA 3PZIA 1UWQA 3ZSTA 4J27A 4OBSA 3AZSA 3WL0A 2PMRA 3UG3A 1BYBA 4E4PA 1BVNP 4FLRA 4MB3A 5CSUA 4FLOA 4HP5A 4WKHA 2HISA 1CGTA 1UOKA 4UCFA 3PZTA 3N11A 4QLLA 1VFMA 3RCNA 2TAAA 3WSUA 1UQYA 3SCNA 5HOSA 2ZX7A 5C71A 2WKGA 2W61A 5A1AA 4W8AA 1EHNA 5BWFA 4ATWA 5CPTA 5A2AA 1VJZA 3WELA 3WQ5A 2WANA 1C92A 3LPOA 3DHPA 1FFRA 4PTWA 1CECA 2WAGA 4GZEA 2PWEA 2Y24A 4H8UA 4XZWA 5C8BB 4JFUA 1RP9A 7CGTA 4XUYA 3IJ9A 3ALFA 1ODUA 4U3AA 1E72M 2DIEA 2UWFA 4TTUA 4W84A 2CBVA 1JZ3A 2GJPA 4Z2IA 4B3KA 1UKPA 3K1DA 2OYMA 4PYSA 2BY1A 1JL8A 2VL4A 1I1WA 1UUQA 2CERA 1XYZA 2QMKA 3M46A 1JDDA 3GNOA 1GORA 4UQBA 4X0NA 4RL3A 4PTMA 1KGUA 1CIUA 3WNMA 1V08A 1BGGA 1V02A 4AZCB 1UA3A 1W9XA 2UY5A 1C8QA 1XGZA 4Q7NA 3WH7A 4LQ1A 3L4ZA 3KL5A 4FMVA 1JGIA 3G6MA 1VBRA 3T09A 4Y7EA 1BF2A 3L4YA 5IHRA 4WK9A 3UR7A 3IANA 4M24A 4PMYA 1O7AA 5EFFA 5DT7A 2XGIA 3MV01 3CHEA 3IJ7A 4D6DA 3GYCA 3BXWA 1OD8A 4UQCA 3NSMA 4RE3A 1EOMA 3CMJA 5CQ1A 1DWAM 4V27A 3SCTA 2VX4A 1GVIA 3A4WA 3RIKA 1TMQA 5CJ5A 1NWRA 2VMFA 1OT2A 2BY0A 1VFFA 3CZJA 4DWSD 5A6MA 2J25A 1OIFA 4PTVA 1KR1A 5E09A 4GPNA 3SCUA 5I78A 3OBAA 2Y4SA 1EIBA 3VINA 3CGTA 3AROA 2DQXA 4B16A 2Y5EA 4ATDA 1JF6A 4D6FA 1GOOA 3WEMA 3BMWA 1OIMA 2XFRA 2IXVA 1WP6A 4NRRA 1WAWA 5IXEA 3AI0A 1NOUA 3WFZA 3SCQA 3ZM8A 2G3IA 4OBRA 4IPLA 1E6QM 3FW6A 3MO4A 2XG9A 2YKKA 3ZT6A 2CIPA 2V3FA 3CHDA 5I2UA 2BV9A 3CUIA 3VIOA 1C90A 1BG4A 4MTVA 3T2OA 4U33A 2O9PA 3AHXA 3VGEA 3VX1A 1J10A 4Z2JA 4H8VA 3WF4A 1BYDA 2E8YA 3GXDA 3LPFA 5GNYA 1EO7A 4CCCA 1GW1A 3M6DA 1TE1A 3OLDA 1PIFA 4AD1A 3PN8A 3ZT5A 4MAVA 3EMZA 1HNYA 1B1YA 4CN6A 5A8PA 4A3HA 2VVNA 3W24A 3M7SA 4KWUA 1ISXA 1CGWA 1BPLB 1QBAA 1HJUA 1JYXA 1JZ5A 3MMWA 1E55A 1OB0A 2VZUA 1DHKA 4CU6A 3SURA 1PX3A 2VX7A 2J62A 1W1YA 4UFJA 1VIWA 4HOZA 2D0FA 3SCWA 1D7FA 2ZXQA 3GNRA 2VCCA 5BCAA 1E5JA 1BFNA 3OLEA 2ZX9A 3WF0A 3ZJ6A 4CUCA 1ZU8A 3AIQA 3HU7A 3VGHA 1E6ZA 1UKSA 3CHFA 1TA3A 2V5DA 3GXFA 2RGLA 1QW9A 4OUEA 1JG9A 2GVYA 1CYGA 3DYOA 1XH0A 1RPKA 2WBKA 4HOWA 2ZWYA 1EH9A 4Z2HA 5CPSA 4HMCA 4MADA 4ZXOA 3CZGA 1DWFM 4TVCA 2J8FA 3UEQA 3PTKA 2VNCA 3AMKA 1G0CA 4M8UA 3WMCA 3U5YA 2FH6A 5DT5A 4M81A 2J47A 2VR5A 3MUZ1 4F8XA 1XCWA 1J11A 1XSIA 1PJ9A 3UCQA 4MJ2A 4JL2A 1QHPA 3VIGA 6A3HA 1QNPA 2BFGA 3K4DA 2XGBA 1DWHM 3THCA 3CZLA 3SIMA 4AD2A 1R8LA 4C7DA 2E8ZA 3OB8A 4IM4A 5E6ZA 1K9FA 4TTGA 4XX6A 4UNIA 1PPIA 1OGSA 2VZVA 3AMDA 3UG4A 1V3KA 5E6YA 1E71M 3NDZA 2XUCA 1L0PA 2BHZA 3VO0A 4AXNA 4MB4A 1KXQA 4PMNA 4WSKA 4ACZA 4H2CA 2OWWA 4OOZA 4ZFMA 2YBUA 3EDDA 3SCRA 5AC4A 4OJYA 1QW8A 3AXXA 2VT0A 3N1AA 3SUTA 4U2YA 3VGDA 3CZEA 3AIUA 2WB5A 1HP4A 2DSZA 1V6YA 3EMCA 2VRJA 3ARUA 5BYWA 4GIAA 5FL0A 4IPNB 4X9YA 3BAWA 1FHLA 2A3HA 5I24A 4QLJA 2VUYA 1K9EA 3WNKA 3D3AA 3OG2A 1LF1A 2EPLX 4AZBA 4ATLA 2D24A 3WNOA 1TVPA 4UQ9A 2J7GA 4CU7A 1BVZA 3QOKA 3VIHA 1W9DM 5A94A 3VD5A 1H49A 2BS9A 2ZWZA 2WXDM 4CN4A 3OIHA 4HZ8A 2CITA 2DH2A 4TX8A 4J3XA 1ODZA 5AYIA 1HJWA 1NM9A 4JIEA 3A4XA 1C8XA 2ZXBA 2YL8A 3ARPA 3PZMA 2X0HA 1E1EA 2YBTA 4JCMA 2VX6A 3W37A 5A6AA 3MUY1 1JYVA 4WLCA 4BQ3A 4C7FA 1K6AA 3F4VA 1KQZA 2A3CA 4JHOA 1CGXA 3U57A 4R5EA 1P6WA 4UFMA 2CPUA 2PB1A 4HOXA 4JKMA 3MKKA 2OWCA 2X2YA 3WH5A 1JDAA 3CPUA 1R7AA 1W2VA 1V0NA 5I0DA 4UFHA 3L4WA 4ZENA 4NSBA 1W9PA 3NJ3A 5IFTA 1E1FA 3SUUA 2GDVA 1GZJA 1CZ1A 2EBNA 1VRXA 1UWSA 4AZHA 1ZBVA 2XIBA 2VURA 1AQHA 4AISA 4JCLA 2FGZA 1UYQA 3OGRA 1B0IA 2E3ZA 4K68A 4UFKA 1G5AA 5JUVA 2ZXAA 3WF1A 3PZVA 3ZR6A 4X0VA 5BROA 8CGTA 3W38A 3WD0A 1US3A 4HA1A 3WD4A 4M29A 3A6OA 2C8NA 1VFOA 4UR9A 1B3YA 4PMXA 3N15A 4RE4A 3VIMA 4GI8A 3TTQA 5GNXA 2X1IA 5D9MA 1LL6A 1TVNA 1E0XA 2WW5A 2ZX8A 1E70M 1XSJA 4LYPA 2V3EA 3KZSA 3AXHA 5FL1A 1CDGA 3BCDA 3AHZA 2X8RA 4ZEPA 1HN1A 1QI4A 4JHZA 1HX0A 5A8QA 4D6IA 2WMIA 3RM9A 4AZ6A 2FH8A 5FIPA 2OSYA 1H3GA 4JKLA 1AVAA 3AYSA 4DUWA 3BAXA 5JIPA 4MNKA 1W9BM 2V5CA 2EQDA 1ZJBA 3W6MA 4MJ4A 3VNZA 5EB8A 2XTKA 1GJWA 1VF8A 3AHVA 2WLZA 1DWGM 1JI2A 1MWOA 1X1NA 6CGTA 4BQ4A 1MW1A 2WMHA 3HMCA 2JE8A 3WQVA 1GQLA 2CETA 3CUHA 2VI0A 4D1IA 1R86A 2WVUA 3SUSA 4ZE5A 1E40A 3WDIA 1K9TA 3BAYA 2YJQA 4PUEA 1PZ2A 2EPMX 1SR0A 1W91A 3VD7A 2J7HA 2J7CA 2CBUA 1PIGA 2EXOA 3SUVA 1W3LA 1PZ3A 3T0BA 2BY3A 3MMUA 1LWHA 4FF5A 2JNKA 1HVXA 2WMGA 2OLHA 1UR8A 1E56A 3ZO9A 4UOQA 4MB5A 1UR1A 4P8UA 4P7NA 1KGWA 1B90A 4D72A 3W53A 2PWFA 1BYAA 5C70A 1H0IA 4KMQA 3VM5A 2QHAA 3W6LA 3L4XA 4LPCA 5HPOA 2QV4A 2WVVB 1E0VA 2D0GA 1OWQA 2NW0A 3EBVA 3CZKA 1MFVA 1OT1A 2CHNA 4H04A 2QPUA 1UD3A 2F2HA 1OGBA 3A4AA 2CBIA 3F5JA 1SMAA 1MQPA 4Z2GA 2XSAA 4KRUA 5CG0A 1J01A 4HZ6A 4P7RA 4B9YA 1ESWA 3VGGA 1OSEA 3WUGA 2C0HA 4EAMA 1XH1A 1VEMA 1DWIM 2NT0A 4OOUA 4J3WA 4HPGA 3VGFA 1UWRA 5I77A 1UD6A 4L4PA 2G3JA 3VIKA 5IHSA 3W4RA 4W8BA 4CKQA 1E4IA 2BVDA 4NI3A 4D1JA 1J9YA 3CBWA 4PCSA 1WDRA 4MDOA 4CD5A 5HXMA 5JBFA 2ZOXA 4DUVA 3ALGA 3AJ7A 4HTYA 1VBUA 2WCAA 3WIJA 3MSDA 2PI6A 4AYSA 4J3SA 4GI9A 1E73M 5ABFA 1HL8A 3T0AA 3I3EA 5A2CA 2WVTA 3ARVA 4B15A 4W86A 1A3HA 4CU8A 1BSIA 4HZ7A 4S3JA 5DMYA 4F66A 1ZS2A 2YL9A 4CD7A 4AY1A 2GJXA 4FZOA 3U7BA 4GXPA 4BCEA 1V6WA 2F61A 3PHAA 1UQZA 1ZL1A 1ZB5A 1JZ6A 3IJ8A 1V3JA 4GINA 4AMCA 2OSXA 3GTNA 4E8DA 3VMOA 1XD0A 1MQRA 3II1A 1J0IA 4AWEA 1QBBA 1UR9A 2YLLA 4W7UA 3CHCA 4D6CA 3WH6A 2E0PA 4DWSA 1NWSA 3NYDA 3OA5A 1WE5A 1U2YA 2VVSA 1JZ2A 2GK1B 3GH7A 4F9JA 1LJYA 3VIFA 3W81A 3ZJ7A 3NCOA 1QHZA 3FHQA 1JI1A 3I3DA 1QI5A 2VRKA 3ZT7A 4KH2A 3VD3A 1WDQA 1MFUA 4HA4A 3VOCA 2C7FA 4QAWA 2FHCA 4CD6A 3GNPA 1KGXA 4H7VA 1OGGA 1U33A 5I5RA 1Q6DA 1E6PA 2G3NA 3NIYA 2WWCA 1E4NA 3ARRA 1QOXA 4AIOA 4U3CA 3RO8A 1NQ6A 2XM1A 2WCSA 3RPMA 4UQAA 4CCDA 4TUFA 3WBAA 3T2QA 1UH3A 3PZUA 4FLQA 3AOFA 3FAXA 2BVYA 2J7FA 3THDA 2XVLA 4P8WA 2GJRA 2JIEA 3VM7A 4WKAA 1HJVA 5I79A 3OLGA 4HA3A 2V3DA 1JYNA 4PCTA 4UQEA 3L4TA 2VJXA 2D3NA 3MU7A 2JFEX 3ZQ9A 4TX6A 3BLKA 4J3TA 1EXPA 3L2LA 2E40A 4W85A 1VEOA 3LMYA 4U31A 2WPGA 3OLIA 5A6JA 2G8ZA 1JF5A 2O9TA 2CKSA 3GZAA 1CNVA 4AIUA 1IT0A 5I3DA 1UG6A 3WDJA 3O2LA 2DSUA 5E0FA 3VVGA 1KBBA 1QI0A 3GH5A 4BS0A 4DWSC 2NT1A 4WKFA 1CGVA 2PWHA 1E3XA 4HU8A 2B31A 1EQCA 1Q6GA 2WMFA 4D71A 2VZSA 5GQBA 3NDYA 3RJYA 2WKLA 4PSPA 2ZUNA 3WNPA 4XZBA 1G9HA 1FH8A 3RJXA 1M01A 7A3HA 2WHKA 4CD4A 1XHGA 2J7EA 1CGYA 1J0YA 2WZEA 1QNRA 3WENA 1H1NA 1B3XA 2PF0A 4U5IA 3SEPA 1CLVA 3AFBA 1IV8A 1GVYA 3ARZA 3T0DA 3WDPP 3TA9A 5AY7A 1Y7VA 3CUJA 4D6EA 4W8LA 2DH3A 3ZMRA 1ZBCA 1Q6FA 3DYPA 4PEEA 5CGTA 2VZTA 2NSXA 2W91A 2D1ZA 2YA0A 3KWXA 2A3AA 4AZ7A 1US2A 3WF2A 1X6NA 1QPKA 2E9MA 3WD1A 3MSGA 3WF3A 3POCA 1X6LA 2D20A 2DT2A 1XYFA 1V6VA 4MB1A 4H41A 5E0CA 2E4TA 4M82A 2VTFA 1UWTA 1D2KA 4W7WA 1ECEA 1JD7A 1DEDA 5FKYA 1JD9A 2XWEA 5D8WA 4PMUA 1EQPA 3VTRA 4PUDA 2WHLA 3AIVA 3L4VA 3FNDA 3TONA 1R87A 1JIBA 3AISA 1KQYA 3ARQA 1V6XA 5KZ6A 5A3HA 2UY2A 4U2ZA 3DC0A 1HJQA 2DPEA 2DSKA 2DIJA 2EPOA 2DT3A 2CCRA 3VMNA 2A3EA 1JAKA 4PBGA 1BHGA 1E0WA 4DM1A 2BY2A 2F8QA 4TXEA 5A95A 3BAIA 2UY3A 1Q6EA 1WNOA 1WZAA 4DM2A 3VD9A 1AMYA 5EBAA 1C7SA 3B9AA 1KXTA 1W1VA 4MAZA 2VRQA 1LL4A 3TTYA 1DWJM 2JEPA 3K46A 1J0KA 4GI6A 2XFYA 2FHFA 4AZ5A 1OINA 2BHUA 2YL5A 4PTXA 2GUYA 4HU0A 1FHDA 2QF8A 4S3KA 3VIPA 4BQ5A 2JF6A 5GNZA 3A3HA 3K4AA 1V3HA 1GOKA 2OZNB 3VDHA 1V3IA 2CNCA 1KWGA 2D22A 1TUXA 4TVUA 3MS8A 2D3LA 1R85A 4UFLA 3T08A 3PZQA 3VIIA 5EFDA 4XB3A 3DHUA 3SUWA 3MANA 1G94A 2XVKA 2J77A 1E6RA 3ARTA 1N82A 2W92A 3AS2A 1CPUA 5A6BD 2OO2A 1OD0A 1JZ4A 2AMGA 4CN1A 5TD4A 2D2OA 3FAWA 2XFFA 1UKQA 4YHEA 2WHMA 1O6IA 1RH9A 3CTTA 3GBDA 4R27A 1V6UA 1MXGA 4A3YA 3CH9A 3TOPA 1ISZA 1UKOA 3MV11 1E43A 2WHJA 3N9KA 2WC4A 1CENA 4KGJA 3AXIA 5M17A 1WO2A 2W67A 1E4MM 1PX8A 2X05A 1JAEA 3EMQA 4AZCA 1BTCA 1BYCA 1DP0A 3GM8A 4BF7A 3O9NA 3QHNA 3W0KA 4CGTA 2V38A 1ITCA 3N18A 3AMCA 2PBOA 2ESCA 3NUKA 3T2PA 2VOTA 1B3ZA 3WD3A 1VJSA 4OZOA 1KXHA 4W93A 3WUEA 3IK2A 4AZIA 1GOWA 1KFWA 3ECQA 2JIWA 5F7UA 3RDKA 3WD2A 4PSRA 2CYGA 1FH9A 2Z1KA 1CXEA 2GFTA 1UH2A 1WZKA 5A6LA 2YA1A 4PMQA 2GK1A 1M7XA 4URIA 1M03A 4UFIA 3FHAA 1D3CA 2WM0A 4YPJA 3QHOA 3GXIA 2Y8VA 2XM2A 3WQ8A 1C7TA 2BXYA 4MNJA 5DO8A 4YN5A 1LL7A 4N0RA 5IDIA 1I1XA 4J3VA 3BH4A 3WQWA 2XVPA 2VO5A 2FHBA 1YQ2A 4TOQA 3ZOAA 3K8LA 1ITXA 1UZ1A 5A6KA 4LX4A 2E9LA 2GJXB 4AD0A 3EDFA 5CPQA 3W28A 4MNMA 3W26A 1HP5A 4DUXA 4E2OA 3RILA 3UERA 1QNOA 4W7VA 3NSNA 3PZ9A 5LA2A 1G1YA 1UD4A 2CESA 5KEZA 5ABFB 1MYRA 2WCGA 2GSJA 2E9BA 1XV8A 3PZNA 2W5FA 5AYBA 1W9VA 2UY4A 1U30A 5A6BA 1VB9A 4B9ZA 2XVGA 4WIWA 5DEZA 1MW0A 3GDBA 3VDCA 1CXFA 1KBKA 3ZSSA 4UTFA 3CUFA 3CZ8A 2DDXA 4PMVA 4A4AA 3WDQA 5BXPA 5A8OA 1QHOA 1JDCA 2J7DA 4CVWA 3WH8A 1B31A 2Y8KA 3MUAA 5A6SA 4JFVA 2X09A 2PWGA 4IISA 2O9RA 4D6HA 4JZ5A 3B9DA 1FH7A 1JZ7A 1M04A 1NH6A 1XSKA 1QI2A 1DTUA 2YLAA 2BVTA 5DF0A 3FN9A 3VNYA 2EPKX 1MW3A 1H41A 2O9OA 1GOQA 2DT0A 2ZIDA 3FY1A 3WL1A 1BGAA 2ZUUA 3BC9A 4BQ2A 3QOMA 3GH4A 3L2MA 1J12A 1JNDA 1A47A 1GOMA 3EDEA 3HN3A 4AEEA 2RGMA 2DGAA 4DWSB 4ACZB 5LA0A 1Q6CA 1VFUA 2EJ1A 1FOBA 2EO7A 1BLIA 2J75A 3ZJKA 4FZPA 1NARA 4LYQA 1UH4A 5BXTA 1V0KA 4AW7A 5ECUA 2XJ7A 1HL9A 4EK7A 4LXFA 2D23A 2ZUWA 4LGXA 3WMSA 1M53A 3BAKA 1F4HA 1HF6A 2WC3A 3K8MA 1ZJAA 4XV0A 4JKKA 1GHSA 3WDHA 1IZJA 3AYRA 5M5DA 3BGAA 8A3HA 5HNNA 3A47A 1H4PA 1QI3A 1V3MA 1WZLA 3AHTA 3VDBA 5LA1A 4JL1A 2WSPA 4GO8A 5JBEA 1KCLA 2YIHA 4F9DA 2DSWA 2WMKA 3WNNA 1KXVA 1PAMA 4CD8A 3UETA 4PRWA 5HBFA 4W89A 2BNJA 3SCOA 1MQQA 1XCXA 4QDMA 1W3HA 4Z2KA 1WZMA 4Z2LA 3LPGA 4W5ZA 1CWYA 4BA0A 1XRVA 1EA9C 3VKKA 2FGLA 1GHRA 3K8KA 1BG9A 1CBGA 4GO9A 1WDPA 2D0HA 5CXPA 1HVQA 3OGSA 2QPSA 4D6JA 1JZ8A 1JFXA 1H5VA 2G41A 2ZUVA 5LYRA 1W1TA 4GZJA 1WKYA 1UR0A 1EO5A 4FK9A 1CXKA 3OZOA 4P7OA 3AMLA 4CCEA 1XD1A 2DSVA 3W25A 1HJSA 3EDJA 5BRPA 5A8NA 2IUZA 4PMOA 2XVNA 4J3UA 3PTMA 3U5UA 4E8CA 1HKIA 1TCMA 1H2JA 2OYLA 1RP8A 1OM0A 1VAHA 1Q4NX 5FD0A 3VU2A 3WQ4A 3O6AA 3CLWA 2WNWA 1GOIA 3MMDA 5ABGA 2ZX5A 4P7LA 1H09A 1OBAA 3ZJ8A 1HT6A 3WUBA 3WN6A 2J4GA 1V3LA 3CUGA 3G6LA 1KCKA 3N17A 2WZHA 4KGLA 3BLPX 4MDPA 4JAWA 2W66A 2FDMA 3DECA 3FXYA 2ZUTA 4M1RA 1PEZA 2GDUA 5D9NA 4JFTA 3POHA 3SCVA 1UKTA 3VMPA 3B9EA 4W87A 5JIWA 2ZXDA 4V2XA 5M3WA 3N12A 4OKDA 1ZBKA 5CZKA 3GBEA 4P8VA 1E6SM 4AEFA 2WMIB 2EEXA 1E4LA 2XHYA 4JFWA 1V0MA 1JXKA 2DEPA 4OIFA 4JFSA 5A69A 2J74A 4B3LA 1J0JA 1JYWA 4QCEA 5A8MA 4EKJA 1EGZA 5CLTA 1QNQA 1C91A 1W32A 4QFUA 3VPLA 1EOKA 3L4UA 1SYTA 3W82A 3DYMA 3ARSA 4NRSA 1TG7A 4L4OA 2Y2WA 3N13A 2WWDA 2XSBA 3N04A 4J28A 4GQRA 2EPNA 3WEZA 1E15A 5GPRA 1LQ0A 3WBEA 4AIEA 3WKZA 3WY1A 4PMZA 3ARWA 5AC5A 4H8HA 5D4YA 1CXHA 3PZOA 4NZCA 1E3ZA 3MUIA 9CGTA 1W3KA 1B3WA 1HJXA 4GQQA 4J7RA 2PBGA 2VZOA 1CEOA 1UD2A 1WPCA 5ABHA 2WVSA 3VDAA 4PMRA 5E9AA 1BQCA 3AIWA 2WC7A 1GQIA 1UD5A 2YDQA 4V28A 1VENA 1UWIA 3WDRA 3RMEA 1HXJA 2CXGA 3I3BA 1AQ0A 1FA2A 3QHMA 1CGUA 1EDQA 2CEQA 3D5HA 3B8SA 3AZRA 1V02E 1EDGA 1MW2A 4EANA 1CXLA 3IAQA 5DFAA 5A2BA 1B30A 2W62A 3VGBA 2WLYA 3UG5A 2XIIA 1KR0A 1UR2A 3J7HA 2VQUA 5CLWA 1LWJA 1NWTA 5IFPA 1NP0A 2HVMA 2CKRA 1HKJA 1E5NA 3RM8A 1L8NA 1QVBA 3W27A 3CIVA 1W2PA 2ZX6A 4IUGA 3WH9A 2Z1SA 3AIRA 4FLSA 4RE2A 4BZYA 3WNLA 2OSWA 2XPKA 3KL0A 1TA3B 2OYKA 3AIEA 3RM4A 1E6NA 1HKMA 1PX4A 1B2YA 1GQKA 4D6GA 4MNLA 5BRQA 1H11A 5D8ZA 3ZIZA 1NOWA 1MXDA 3BSGA 1EDTA 4UOJA 3EYPA 1C3FA 1J0ZA 2WZIA 5ABEA 3VILA 2YDSA 5HPCA 2WSKA 1V0LA 1YHTA 2VR4A 1E6XM 3KEHA 1B9ZA 1JXJA 2YA2A 4QCFA 4GKLA 4HPHA 3HJEA 2JALA 2AAAA 3S6TA 4AC1X 4M80A 1SFSA 2A3BA 1CLXA 1W1PA 2AOSA 3WFLA 3W29A 5HDRA 5EMYA 3WUFA 4GZIA 1ISWA 1UWUA 3SCPA 3CMGA 3TTSA 5M03A 1I75A 1UR4A 4UZSA 2QMJA 4AD5A 2BHYA 4M56A 1HKKA 3WEOA 1ZBWA 3M07A 3TP4A 1IZKA 2PWDA 1CXIA 3ARYA 2YDRA 7TAAA 3AS3A 4Q22A 1VEPA 5I6SA 1GUVA 3AQUA 3AS0A 3VD4A 2J79A 2WVVA 1KWKA 2ZICA 1KB3A 4W88A 5D9OA 1FFQA 4AD3A 1Z32X 3AMGA 2DT1A 2WMJA 3JUGA 4KRTA 1NOFA 1XH2A 1V03A 3AICA 1WB0A 2VX5A 5D9PA 1PBGA 1J18A 3BSHA 3NSXA 1AQMA 6TAAA 1GJUA 3OZPA 2W63A 2JF7A 1JFHA 1GPFA 4N42A 5BXRA 1TFVA 3PZGA 3AHYA 1EHAA 3SCSA 2YL6A 3VUPA 1R7OA 4ZE4A 2WBGA 3VX0A 1TZ7A 1B3VA 4WSJA 2YOCA 3OGVA 3WMBA 1UZ4A 3ZR5A 1LLOA 5FOOA 2VCBA 4PN2A 3UESA 1LG2A 3VIJA 1GCYA 4LYRA 4MPKA 3BCFA 3UR8A 2G4FA 5BXSA 1UD8A 4P8XA 2O92A 3U7VA 3PTQA 4C7GA 4EE9A 2WYSA 1SMDA 1W3JA 1UA7A 2ZUSA 4W5UA 3PBGA 3GXMA 1LG1A 4UQDA 1BAGA 1CTNA 1FP9A 5CGMA 1W9UA
chains in the Genus database with same CATH superfamily
2FJKA 2GVEA 3SGUA 4K2SA 1EWDA 2OPJA 4Q8QA 6ALDA 4TVDA 4I9JA 2VQTA 3PG8A 3AIBA 5AYYA 3S2CA 2G3MA 5K7JA 4HMDA 1NP2A 4QP0A 2OWXA 3CXOA 3DKJA 3G0XA 3F5LA 3BMVA 3GTXA 2JEQA 1TCDA 4IGNA 3U6WA 4HNLA 5CSYA 4REQB 1Q63A 2ZRUA 4ZMGA 4CVUA 1RVKA 3LEPA 4N6EA 1URUA 3APGA 3RX2A 4H9UA 4WDUA 1K7XA 2CHOA 4XTIA 4ACYA 2PC8A 4LCQA 1VLIA 4U5KA 3VK5A 1WUFA 2J7BA 4EPEC 3OU8A 1OCNA 3ARXA 4KT2A 2CZVA 3T55A 1EGMA 3T4CA 1PCWA 3O16A 1JNEA 2V5KA 2YW4A 3O06A 3L0NA 1QNSA 1OG0A 4QLKA 3H4WA 5E70A 2OTDA 1TR1A 3TTOA 2X1TA 5G1YA 4HT3A 1TX2A 4NILA 4NJIA 1G01A 2MANA 3ERCC 2CBJA 1QTWA 4HK6A 4PUKA 4WOZA 1LBMA 4OUIA 3LMFA 3KBWA 4OBSA 3AZSA 1YNQA 4INFA 3TQVA 4FNTA 2DVUA 3GFYA 2IPFA 4KWOA 3G22A 1OC5A 2DZUA 4WKHA 2HISA 2DUAA 4QLLA 1QWGA 3RCNA 3AUJA 1KM3A 5CPNA 1VJZA 2XN1A 3WELA 4K37A 3LENA 3WQ5A 1PUDA 1SFLA 3AWOA 4PTWA 3OHXM 1CECA 4O15A 3CS2A 4WHBA 2Y24A 4FNQA 3C0SA 5C8BB 4JFUA 1UP3A 3UD6A 4K8EA 4IIFA 4XUYA 1EPVA 4RDVA 3ALFA 4XK2A 3VKCA 3HPSA 1E72M 4TTUA 4W84A 1JZ3A 2FZBA 4O16A 5L9FA 3UZJA 2PUZA 3G77A 1J96A 2OYMA 3R7MA 2BY1A 2QCGA 2VL4A 4MKSA 3BUVA 1XYZA 3M46A 1XG4A 2Z1BA 3OVQA 4DRSA 1PKYA 2DZPA 4X0NA 3THQA 4PTMA 4S3CA 5LKYA 4UTUA 1BGGA 1V02A 5B7YA 1UA3A 3GRIA 1C8QA 1XGZA 4Q7NA 3BO9A 3QA8A 3AO0A 4LQ1A 1IT8A 4IIHA 1JGIA 4AUBA 1VBRA 1GNLA 3JU2A 1OFQA 1BF2A 1AW5A 2A21A 3UR7A 1QXLA 5LNSA 3VOGA 3IANA 1UJQA 4KWWA 3FYYA 1EB3A 3MV01 1XYAA 1P0BA 1QRQA 3NO3A 1K4GA 1EOMA 4RE3A 3T0TA 3BANA 3CMJA 2ALDA 2X16A 3ELFA 4GABA 4J3ZA 4V27A 4LANA 2VX4A 1R34A 1HW6A 1VFFA 3LLDA 4DBEA 4DJFC 3GDMA 4PTVA 3O3MB 3LLFA 2HWGA 3GIYA 4R5IA 2OBMA 4GPNA 1ZAJA 3W00A 4KW2A 4C6IA 1B3OA 1EIBA 4J4KA 3UYIA 3WCZA 3CGTA 4L4MA 2IW0A 4BWLA 5I3FA 1VYRA 3OYZA 3E6EA 2AQWA 5KBPA 4NRRA 1JCXA 1G4SA 4EOUA 4ZOCA 1NOUA 3SCQA 2I14A 2X30A 3RX4A 3ZM8A 2Z7KA 5DCBA 4F0SA 2XG9A 2PGRA 4LCSA 3CHDA 5I2UA 4ZQMA 3G1HA 1C90A 4C6BA 3QMRA 3T2OA 3M5VA 4MWAE 2E67A 3C6CA 3TSMA 4GH1A 1J10A 2INEA 3BVWA 1QU4A 1UP0A 4US5A 4K1WA 3BUDA 4MVAA 1SZEA 5DRIA 3T0CA 1TE1A 4EZSA 4C90A 3BOLA 4Q8WA 3UWWA 4AD1A 4MAVA 3GXPA 3HQNA 4CN6A 3REQB 4A3HA 5AHIA 2NLYA 4L1GA 5J8LA 2NXHA 4B5WA 1ZZMA 1JYXA 1WDWA 2DZAA 2VZUA 3QR1A 1ICQA 1DHKA 2TRSA 4AY7A 3QW3A 4HOZA 1RBAA 4YTTA 4XBJA 2YX0A 3SCWA 3HF3A 2PDQA 4YNGA 1P6BA 3OLEA 5C9UA 1ZY9A 3P14A 5LIYX 4CUCA 1ZU8A 4GK8A 4POCA 3CHFA 4O54A 3SW6A 3SB0A 3P82A 2RGLA 2Y62A 3NO1A 1QW9A 4XKYB 4OUEA 3V0SA 4JTRA 1RPKA 2WBKA 1EH9A 5AHEA 4Z2HA 4MADA 4ZXOA 3LVTA 3W2UA 4DY1A 2VC7A 1GNTA 4TVCA 1GJPA 1VHCA 4M8UA 3VE9A 2FH6A 4LSBA 3FYPA 4M81A 2J47A 2VR5A 3FJ6A 3AYTA 4F8XA 4OT7A 2UBPC 3ATYA 2CLOA 4H6IA 4XWUA 4YMZA 3DAQA 1GVSA 4O1AA 3HPXA 1FWCC 2ACSA 3EX4A 4A8RA 4AEOA 3THCA 3CZLA 1O5XA 2E8ZA 3OB8A 1X03A 1K9FA 1KBIA 4XX6A 1E1CA 1NELA 2XIOA 4ADUA 3L3OM 4AHQA 1OCBA 5E6YA 1E71M 2QKFA 2FZ8A 4UTWA 2ISFA 1M3UA 1I2RA 5HJXA 4JNMA 4FEZA 1XQLA 4MB4A 3S46A 4XZLX 1SR9A 1ELSA 4EZUA 2YBUA 1YTEA 3EDDA 3SCRA 5AC4A 4OJYA 1FRBA 1JRCA 3AXXA 3M0XA 2PC4A 3SUTA 1X6UA 2QCCA 1EBHA 1EC9A 3THUA 1EP1A 4PUJA 1DE5A 5DXYA 3URAA 3QGAC 5DCDA 2VRJA 3ARUA 3CL8A 2YI9A 2ZRZA 4IPNB 3UR5A 2X1UA 3U4FA 1TKKA 4QLJA 2Z2UA 4M0XA 1WBJA 3M7WA 3CQKA 2VUYA 2WJZA 2J9XA 3RRXA 4K7VA 4GGBA 3OG2A 1LF1A 5CZJA 2D24A 4GC3A 3KLLA 4UQ9A 2J7GA 5IBXC 4CU7A 4Y9OA 4FIRA 3VIHA 3EX1A 3VD5A 4UTKA 2WXDM 2IKJA 5C9ZA 2CITA 4YIWA 4NZ1A 1NDVA 4HN8A 4J1OA 1ODZA 1H7PA 3XISA 4O4VA 1NFPA 1RQBA 1QK0A 1WXZA 3A4XA 4QRNA 2ZXBA 3U9IA 3PZMA 4KQNA 4QS5A 4XAGA 5A6AA 4N6FA 1JYVA 1XDLA 4I9MA 1K6AA 2XH7A 2XIQA 2F6XA 2VFIA 4UFMA 2CPUA 4JKMA 3SOGA 3DPPA 1JDAA 3CPUA 4B92A 4Z1DA 1B57A 2PGFA 2HE5A 4NSBA 5BW6A 3BK0A 3PC0A 4C1KA 3NJ3A 2PP1A 1E1FA 4IG2B 3N2MA 4IX2A 3SUUA 5HUOA 5FJIA 3XINA 4AZHA 1Q13A 1ZBVA 2XIBA 5JMUA 3GC2A 3ZVHB 4AISA 5FAGA 3B8IA 1AL8A 3VABA 3R8HA 1HO4A 4ORMA 1B0IA 4K68A 3NG3A 3Q84A 2VDGA 1YRRA 1G5AA 4HJFA 1PIIA 2VXNA 3SJNA 4X0VA 8CGTA 3W38A 3ABHA 1OQFA 1US3A 5JU6A 4JWEA 3EJQA 2P8CA 3A6OA 1K1DA 1X97A 1MDRA 1VFOA 4HPJA 4PMXA 3N15A 1KM5A 4RE4A 3TWBA 3TTQA 5GNXA 2X1IA 3G0UA 1TVNA 2EF9A 4GNVA 1IYXA 2ZX8A 3WYZA 1QDSA 2PDIA 1H1ZA 1DIDA 3OO2A 4ZEPA 1QI4A 1S2UA 3BTNA 4NASA 1PDYA 1S2WA 4QE5A 4MF4A 2ISSA 2OSYA 3MP3A 4KIRA 4PCFA 5FIPA 1F8MA 3TUUA 6REQB 3W7NA 4JWIA 2R1NA 4US5D 5LIXX 4XAZA 4DUWA 3LHVA 2PFHA 1K7EA 4MNKA 4QSFA 2V5CA 4NAEB 2EQDA 2FJUB 2ZA1A 4NQ1A 3FDKA 2XTKA 3N6QA 2PP0A 3MO7A 4R5GA 1GTEA 2DQWA 2F84A 3CHVA 3C2RA 4BQ4A 1FX6A 4ZTXA 1UB3A 2VI0A 1XJBA 3E5BA 1R86A 4AVNA 3FDGA 4LU0A 4PE8A 1N8WA 3BVXA 3GB6A 3BAYA 2YJQA 4BFAA 4PUEA 3GTFA 1PZ2A 1W5QA 1SR0A 4YYCA 1W91A 3R25A 4F2BA 4EP8C 3CAVA 4JX6A 4LRTA 3GG1A 1PDZA 2ALRA 2BY3A 2QUTA 4HN4A 5E1QA 4FPSA 4LBRA 2JNKA 4QJ4B 1UR8A 3NPWA 4UMCA 1LRTA 3MI6A 3S5YA 4HHLA 1EEXA 1Y0EA 5CPMA 1VIZA 3W53A 2ISVA 1HG3A 3NL5A 2ODOA 1O5KA 4TO8A 4LPCA 3EX6A 3EWUA 4XTDA 5HR7A 1QO5A 5D03A 3EBVA 3V0TA 1MFVA 2P0OA 1OT1A 4L80A 4FOKA 4H04A 3W01A 4B5UA 2F2HA 1OGBA 1QOPA 2JKEA 3GDTA 2D73A 4GX9A 1IXOA 1MRQA 3TW9A 1NDWA 4QDWA 1ESWA 3P84A 1ZFJA 1QMLA 4OOUA 3USZA 1FDZA 5I77A 1TUFA 1MI3A 3UY7A 3ENLA 1TRIA 2Z25A 3UCDA 4Y96A 2QIIA 3E2VA 4QJ1A 2WYIA 1DVJA 4C1NB 4CD5A 2ZTJA 5HXMA 4EZXA 1TV4A 1ZUAX 4AMAA 2ZOXA 3NXLA 3AJ7A 4HHMA 2WCAA 3WIJA 2GJNA 1R2TA 1DPMA 3W1XA 4G8TA 4J3SA 3MC5A 3TXVA 2PTYA 1Q7MA 1BQGA 4B5NA 3I6TA 1TV3A 4W86A 4CU8A 4FO4A 4MGGA 1OF6A 2WOQA 4CD7A 2X5CA 2GJXA 3NL3A 3QC0A 3BGJA 4GXPA 4BCEA 4DJDD 2OLAA 1M65A 1ZL1A 2C18A 4Y9AA 4KFOA 3PJTA 4UMAA 1ZB5A 1R2SA 4XO6A 1VRDA 1PV8A 4QX4A 1SU5A 4JTDA 3B52X 3RHGA 1V3JA 4GINA 4AMCA 4BEUA 3GTNA 4E8DA 1ICPA 4I8YA 1XLJA 1QBBA 1UR9A 2VWSA 4BWLC 2A6NA 2HXTA 3GYEA 4D6CA 1BF6A 2PE4A 2E0PA 1OZQA 4Z1CA 1L2UA 1L6GA 5DBUA 2OX1A 3Q45A 2PP3A 3SY8A 2GK1B 2PTDA 5DRCA 3TN6A 1LJYA 1XLBA 1NSJA 3M6YA 2CLFA 1JI1A 4JQ4A 3I3DA 2ZC1A 4ZO8A 4HKPA 2O55A 3NPXA 4XD5A 3VD3A 3O6DA 3NNTA 3H12A 5FJTA 1WDQA 4JXCA 4HA4A 1XIDA 2CLHA 1DJQA 2C7FA 2XSXA 2VD9A 3GNPA 1RV8A 3D46A 4YU1A 3B9OA 1Q6DA 4ZO6A 2WWCA 3UW6A 1E4NA 3QKEA 4LVAA 2W9MA 1QOXA 4D8JA 4AIOA 1ZJHA 3VKHA 2XM1A 4UQAA 1UPPA 3WBAA 3T2QA 4RV3A 2C1GA 1L8PA 3AOFA 4M6UA 4O14A 3IVTA 2J7FA 3RV0A 2XVLA 4J9JA 2B7OA 1K3UA 3F2DA 4K8GA 4ZOBA 4LYKA 4MPQA 4JN7A 3A9BA 3D51A 3QPZA 1ZTVA 3ZQ9A 2LLEA 4TX6A 4US6A 3HAIA 4C6LA 3VFLA 1EXPA 5KZDA 2E40A 1MNSA 1XLEA 4A2SA 4H6RA 4ZFCA 1IT0A 3C0LA 4GVGA 4QQ3A 1W3TA 1QI0A 1YDOA 3FCPA 1EP2A 3GH5A 2B7QA 4WJ8A 1CGVA 4FX6M 1LBLA 1M9HA 3N73A 2B31A 3ORWA 1Q6GA 1KM4A 2QJGA 4LF2A 4D71A 1MZHA 2VZSA 5CSRA 3RJYA 4PSPA 2ZUNA 3R8GA 1OFBA 1F5ZA 4GYFA 1G9HA 3UXKA 1M01A 4NNAA 3S0CA 2QULA 1XHGA 4WY0F 2J7EA 1QNRA 2PF0A 3H8AA 3CIXA 4KCVA 1GVEA 3WDPP 3C56A 3TA9A 3P81A 3ZMRA 2DJXA 2NSXA 3QWEA 4ZZ9A 2D1ZA 3KWXA 1Z8AA 3RCYA 3WF2A 1X6NA 3WD1A 4NI8A 3POCA 3IARA 2E5BA 1KM0A 1XYFA 4MB1A 1JCMP 3TYBA 5E0CA 4FALA 3NQ2A 4H9VA 2CLMA 5EMMA 1JD9A 4O8RA 2Y7DA 5D8WA 3W02A 1EQPA 2PDGA 2WHLA 3TONA 3B8UA 3P74A 1CX9A 3GDKA 3I01A 2VP8A 3H54A 2DSKA 3P3BA 4NAEA 2BB0A 2EPOA 3C2VA 2DT3A 1RA5A 2ZZ3A 3QVQA 1MO0A 1BVWA 1DQXA 5GVJA 1E0WA 1X39A 5EMUA 2F8QA 3CQIA 4NNCA 2J24A 4DM2A 1PSCA 2HROA 1VP5A 2OEJA 2VRQA 1BRLA 3K46A 1LWIA 4DI8A 1J0KA 2FHFA 1OINA 1YPXA 2J6XA 5LIWX 2YL5A 1YE6A 2VWTA 3UXDA 2OZ0A 4XSMA 3S8HA 1ADOA 4LV4A 2QF8A 2ZZ4A 2Q6ZA 2PAJA 3NOYA 1V3HA 2OZNB 1FWAC 1KWGA 3PK7A 1X1ZA 4GFIA 2D22A 1MEHA 1TUXA 1R85A 1R30A 3PZQA 1AG1O 1OY0A 5FJUA 4XIMA 2BZNA 2H3DA 2Y8UA 2AL2A 2DU2A 2XVKA 4H8SA 3CEUA 3H22A 3ARTA 3QMTA 2W92A 4KCWA 1G6CA 2FZDA 3BSMA 3TN5A 1OD0A 2PZNA 1TTPA 5DBTA 2D2OA 1SM9A 4MWAB 4QG9A 1UKQA 4LUYA 4O28A 1EJUC 5H91A 1MXGA 4W4QA 1F6KA 5D2YA 3WJZA 1A3XA 3MV11 3LBMA 3GW0A 3N9KA 1M7PA 2V2DA 4KGJA 1P4CA 3Q67A 1E4MM 1PX8A 2X05A 4GBDA 4PUNA 4AZCA 1WUEA 5AYXA 1G4TA 5FF3A 1VCGA 8XIAA 3MJMA 3AMCA 3GAYA 2PBOA 4XVDA 3NUKA 3T2PA 1B3ZA 9XIAA 2PCQA 1UIOA 4RXGA 3I65A 1PWLA 1GOWA 4NL1A 3GVVA 1B9BA 3N25A 4GACA 4NX5A 1W3IA 2PDHA 5F7UA 3WD2A 3KOZA 1RK6A 4IP7A 1UH2A 4JTJA 1WZKA 2YA1A 2EHHA 2VFEA 3MUCA 1FCUA 1XIJA 1M03A 3QLLA 1DYSA 1JUEA 5LIUX 3SRKA 1QUMA 5FESA 3F2BA 2FVLA 3WMLA 4N0RA 1I1XA 2NVAA 2V5JA 2XVPA 3P80A 1YQ2A 3ZOAA 2NWRA 3K8LA 1EIXA 3BW4A 3SAZA 1B54A 3MBDA 2GJXB 5DMLA 3VKJA 4ZB2A 4MNMA 1ZCOA 3W26A 4QITA 1P0DA 4DUXA 4Z17A 2G97A 2GVLA 3RILA 4RKAA 3W1AA 1OFPA 1V7YA 5ABFB 3UJ2A 1MYRA 4JX5A 2WCGA 2GSJA 3OVRA 3PZNA 4LOCA 5A6BA 4B9ZA 3TOYA 3DZ1A 1MW0A 5KZEA 4UTFA 4EPDC 2NQZA 2PODA 2DDXA 3R10A 4IJCA 3WDQA 3I7QA 1YEYA 5A8OA 5FEWA 4DIAA 3O3NB 1QHOA 4TQTA 1W9MA 3TMLA 1Q2RA 4IPIA 1GKPA 1B31A 5A6SA 1EEPA 1M41A 4JFVA 3QKZA 4Q4MA 2PWGA 1LP6A 4IISA 1NH6A 3DG6A 2BVTA 1E1DA 2TYSA 3DDMA 2EPKX 3LX9A 2HPIA 4CQCA 2O9OA 1GOQA 2ABBA 5F2GA 2ZIDA 3WL1A 1BGAA 2Y63A 5IM51 3VNLA 4BQ2A 2AQOA 3VNJA 1DTNA 3SGGA 1GOMA 3SQSA 3EDEA 3WQOA 2MUCA 4DWSB 3E12A 4ACZB 5LA0A 1VFUA 2ZVIA 3R43A 3TR2A 4BI7A 2EJ1A 1TTIA 1NARA 3CZNA 4LYQA 2J66A 2DW7A 1VD6A 3PUOA 3ME3A 2PD5A 4EX4A 3KBVA 2E5DA 2XJ7A 1EUNA 1Q3NA 2D23A 4HD5A 2Q13A 3WMSA 1F4HA 2RUSA 4FI4A 2OVLA 3TJLA 3W6YA 4O12A 3S5NA 3UXIA 3HQPA 2YCJA 1XBZA 4K7YA 3GI7A 3WDHA 8A3HA 5CC7A 3N3TA 2IS7A 3A47A 1V3MA 4HQVA 3VDBA 5LA1A 4GO8A 3LZ3A 4F9DA 3B06A 1KXVA 3HGRA 1H61A 2WZTA 1MQQA 1XDJA 1XCXA 3BCJA 3WLSA 3QQ0A 1EYWA 1W3HA 4DXVA 1EA9C 1R3TA 2BDQA 2D0HA 1HVQA 2V82A 2QPSA 4D6JA 1JZ8A 1NFGA 1ME8A 1AODA 1W1TA 4PC8A 2P3EA 1V5XA 1DKZA 3W2KA 4J40A 2VEIA 1ADSA 4K39A 3C4UA 3P2VA 2DSVA 4Y8EA 5CCZA 2R9RA 5BRPA 5HUPA 2IUZA 4HU3A 2XVNA 4L4LA 1Y8BA 1HKIA 1TCMA 1H2JA 2FKPA 4HGXA 1PE1A 3UJSA 1S3TC 4MJMA 5G4HC 3OVGA 1FVPA 2ONEA 3VU2A 2FVMA 3LUTA 1RXOB 4DO5A 3WO8A 3STGA 3CLWA 1GOIA 4AIBA 1I6NA 4ZA0A 3UPMA 3HA1A 1WBHA 4I5RA 4ROQA 1H09A 2PD9A 1K02A 2EWFA 1D9EA 4PBEA 1ME9A 1KV8A 2J4GA 4HR1A 4YTRA 4WX2A 2DZXA 1W1A1 2YCIX 4MDPA 4UCGA 3DECA 2I56A 4TMBA 1PEZA 5J5RA 4JTEA 2YDAA 3P67A 3I7SA 2GDQA 4V2XA 1AZ1A 2ZZ6A 3BDKA 2A7RA 3IGHX 4HK7A 2ICSA 1TRDA 3S4TA 3T07A 4IFOA 3CTLA 2PLKA 2A3LA 4JFWA 2A79A 3K1GA 2V63A 5A69A 1QATA 3KOYA 3TYCA 5FEZA 3R13A 1NFBA 3RV1A 1JYWA 4QCEA 4ERGA 1EGZA 5CLTA 2G5WA 1W32A 3G18A 3L4UA 3CV2A 3GHRA 3MVTA 1VKFA 4ORIA 1TG7A 4L4OA 4HNTA 3N13A 2XSBA 3Q2DA 2GVGA 3LSBA 3WEZA 3W7HA 4DJDC 3WY1A 3HB9A 4NZJA 3ARWA 5AC5A 4H8HA 5D4YA 1CXHA 2OW7A 1Q5MA 1WXJA 2YGYA 2XDFA 1SSDA 5H8PA 1FKXA 9CGTA 1VCFA 2LM0A 2X0SA 4GQQA 4KWSA 2PDMA 3TFCA 3QNIA 3RNDA 4H4IA 1R3WA 2YBVA 3H53A 3GG7A 4H8NA 4FR1A 3T78A 1BQCA 1DJIA 3TX9A 2QZRA 4G7FA 4UXDA 2VYOA 4V28A 2Q8LA 3SQLA 3WDRA 3VAVA 2CXGA 4JWCA 1AQ0A 3LXCA 3A13A 3QHMA 3DBNA 4LBUA 3TC3A 2OT0A 3GXTA 2C13A 2Z6IA 3SM0A 5DFAA 1D8WA 4IQDA 2YYTA 3REQA 2XIIA 3J7HA 4MZ1A 5HNRA 2VQUA 4M7TA 1LWJA 1K4HA 3NQCA 3MA8A 1E5NA 4PRRA 2YIAA 3DFHA 3CIVA 1XQKA 2ZX6A 3WH9A 2VFGA 3T42A 4A8NA 1TPFA 4FLSA 4JIHA 3WNLA 3S83A 2QUVA 3UWQA 1MJGA 4LEQA 3C7NA 2OYKA 4C6PA 1Q6LA 5F1UA 1JPKA 3H23A 1A5UA 4S1FA 4D6GA 5BRQA 3RO6A 5D8ZA 1MXDA 1T7LA 1EDTA 1XLLA 1RBLA 3ICJA 5LNWA 1C3FA 3EPMA 4Y8FA 1F8IA 1J0ZA 5T9CE 3LHZA 2YDSA 2QQ6A 5HPCA 4JTUA 4TX9A 5K9CA 1E6XM 3D52A 1B9ZA 1JXJA 4B3ZA 4MWAC 1POKA 5H8MA 3TR9A 5G2IA 3WUFA 2OR2A 5EMYA 5F2MA 2QCDB 3UCCA 1QK2A 3T46A 4MZ8A 1NVMA 3M44A 5M03A 4G7EB 2QMJA 2ASHA 3B04A 4M56A 2QXWA 1IZKA 4R5JA 1ALDA 2PWDA 4YL2A 4JEQA 3I4KA 4Y9NA 1SU6A 5CBJA 4Q22A 4IMGA 2V68A 1I4LA 3UF9A 3V1HA 1GUVA 3AQUA 3AS0A 3Q58A 1VQTA 4HPNA 2J79A 4LS0A 3WLQA 2ZC8A 3C8FA 1KB3A 1DV7A 1Z89A 3UR2A 3OQEA 3MTWA 1XYBA 3NPVA 4A21A 4DI9A 1KFLA 1R9XA 1XH2A 2WNNA 3AICA 1XYCA 5HJLA 1PBGA 1J18A 3GC5A 3NSXA 1GJUA 3OZPA 3H4XA 3ISIX 5BXRA 3AHYA 4XKMA 4ZE4A 3IUDA 3LV5A 3VX0A 3QQ1A 2X3XA 3VZZA 3OGVA 3UESA 2ACQA 4LYRA 4LAKA 3UR8A 2G4FA 5C7VA 4P8XA 3PTQA 2INZA 2G95A 1SMDA 4ES4A 1W3JA 3FJNA 1JCJA 1LG1A 1BAGA 3OA3A 2X3VA 5CGMA 1FUYA 4Q8MA 3VNIA 5F4SA 5JBDA 3F4DA 1PTAA 3G1SA 2V3GA 2ZA2A 3EJRA 1H0GA 4Q4KA 3WLJA 1DQUA 2R24A 1UP2A 3WLPA 2RJGA 2ZUMA 3KE0A 1J79A 2R1MA 1ISYA 4NYUA 4YVXA 4AD4A 1KKRA 1CLKA 1DIOA 1JPMA 3PS7A 2ZA3A 5DLCA 1TWZA 3KL3A 4KIKA 2W4XA 4UIOA 1G4PA 1XC6A 2J78A 1GNXA 4Y6GA 3QR3A 3EWCA 4KFPA 3M0VA 4UZUA 1OCQA 3CZSA 4B90A 3BARA 1X7FA 3CK5A 3ITYA 4NF7A 5I23A 1SZGA 3E02A 4UR8A 1KFEA 3QGVA 3QMSA 1QT1A 1ISVA 2Y7EA 4ZO9A 4GNJA 2QLYA 1C8YA 2BP1A 4E4UA 2YFOA 1XYMA 1W5OA 1YLVA 1NQKA 2DV0A 2QCDA 3GW3A 4HHHA 3JW7A 2F18A 1OX6A 1WCGA 4H00A 5FI8A 3UGVA 3PZIA 2C0AA 3STFA 3U2OA 2YKTA 3I7RA 3ZSTA 1H7OA 2PMRA 3M0LA 4E4PA 1BVNP 1TPC1 3URBA 1EP3A 4FLOA 3LTPA 3EJUA 1W3NA 3WQDA 3PZTA 3N11A 1XIMA 2TAAA 5HOSA 2G0WA 1AA1B 5C71A 5BWFA 3LI1A 3C2FA 1T6MA 2OQLA 3KAWA 3EAUA 5FF0A 1C92A 1TWIA 3LPOA 1X8CA 1RJQA 1PCKA 2PWEA 1RHCA 2BVWA 3PSWA 4MY8A 1L6WA 2AGKA 4O1FA 3A98A 3C8NA 1YBQB 1ECQA 2V81A 2AKZA 3R58A 3TC6A 3HAJA 1T40A 4JIPA 1SZRA 4PYSA 1WKDA 3WLMA 4O50A 2CERA 4MKNA 3EB3A 4JD4A 3H24A 3IIVA 4RL3A 1G69A 1R5EA 1KGUA 3WNMA 1RA0A 1V08A 5HR6A 1O5RA 4AZCB 2WJEA 2UY5A 1A3WA 3KL5A 1A0CA 4FMVA 5C9RA 3LTSA 4GKTA 3T09A 1REQB 4Y7EA 1X98A 3RF9A 4M24A 2YW3A 3FSUA 4XO7A 1O7AA 5FEPA 3IIZA 2Z0NA 3Q65A 1YXDA 1P7TB 4QQUA 4ROPA 1XXXA 4KEVA 4H7CA 3G1AA 4PUWA 2OLSA 1TV8A 4JIIX 1OD8A 4UQCA 3BJTA 4E2VA 1EA0A 3GAKA 4GHRA 1DWAM 3SCTA 3OEXA 3UPWA 2IQTA 1DKWA 3CKDA 2ZVRA 2NWSA 3VKAA 1OT2A 4DWSD 5A6MA 3R89A 4JR5A 3TCEA 1M6JA 1JVNA 4BR1A 3VCCA 1F07A 5E09A 4JDBA 3U2CA 3SCUA 3T8QA 3TLLA 3VEBA 1X1OA 3MJYA 2Y4SA 2GVJA 4JTHA 3AROA 3WQPA 3DX3A 2P76A 1KLZA 3CNYA 3UVIA 3UZWA 1JF6A 4D6FA 4AX7A 3TVAA 3BMXA 5CC3A 3BG3A 1OX5A 4IL0A 4LCRA 5D37A 3C86A 4GCAA 3V5CA 4IPLA 3W1PA 3LLXA 3EEGA 3IACA 1IEWA 3MO4A 4PRTA 3ZXWA 1GG1A 4ZOAA 3S42A 2WZMA 3CUIA 5AHMA 1BG4A 3KWSA 4HCDA 4QE1A 1VPXA 2O9PA 5E84A 1EJSC 4MMWA 4Z2JA 3NQDA 1BYDA 3GXDA 3LPFA 4KCTA 5GNYA 3V5FA 4C65A 4FZSA 1U1HA 1SO4A 2GGHA 1LZOA 4FB7A 3C2YA 4UTTA 1HNYA 1TWWA 5A8PA 2WJDA 3CH0A 2NQHA 3UZYA 3W24A 4KWUA 1ISXA 3KRZA 2DZSA 1OC7A 4O19A 3QY8A 1HJUA 1FXPA 3A5VA 3W2MA 1OB0A 1FWGC 2CZFA 7ODCA 3HIJA 4MG4A 5AN7A 3GR7A 2J62A 3GSMA 3NAVA 1W1YA 4DZAA 3GHSA 3NTYA 2VEGA 4FXFA 3GNRA 1JPHA 4KF1A 3GVGA 1E5JA 4WXZA 1BFNA 2D4CA 3O05A 3GKAA 3K13A 5CG7A 3WF0A 3PBMA 5EGRA 3AIQA 3DG3A 3HU7A 1DQWA 4X22A 1C8VA 1RCQA 4M5PA 2V5DA 3GXFA 3H70A 4HY9A 4GJIA 1JG9A 2Q02A 1SO3A 1CYGA 3HGSA 3CB8A 3A3XA 5T9BG 4HOWA 4YCOA 2HTMA 1AK5A 1XRSA 3BLFA 4IMFA 3IGUA 2J8FA 3PTKA 4ZQOA 3AMKA 5EMJA 1O5QA 3GIPA 5DT5A 5LZLA 4RNJA 1F74A 3MUZ1 2HBXA 1H50A 2W79A 1XCWA 1XSIA 3UCQA 4JL2A 2P50A 1GG0A 3VIGA 3TK7A 3SSZA 3BVVA 3PG9A 1DWHM 4AD2A 4C7DA 5BNKA 3WZ0E 4DF0A 3GU1A 4IM4A 4JQ2A 4HMNA 1TPUA 1GN9A 1OGSA 2VZVA 3AMDA 4RCXA 3UJRA 1H1YA 3QEZA 3VYLA 1V3KA 5I3GA 1I4DA 4PH6A 3GDLA 3G8RA 3CYVA 3HV8A 3W74A 4H9MA 4QEHA 2QV5A 1TV7A 1DXEA 4XQ6A 4UTWC 4GA8A 3TYDA 5ABTA 2NXIA 4WSKA 3NVTA 1FCBA 4H2CA 3H2EA 1RQEA 3PWIA 2VT0A 3N1AA 4H1ZA 3O3OB 3M5ZA 3VGDA 1O4UA 3AIUA 3M0MA 2QIWA 3DFYA 2DSZA 3EMCA 3CVRA 1XFBA 1S5WA 2XN0A 4GJ1A 1ITUA 4X9YA 1FHLA 2A3HA 5I24A 3U4AA 3VDGA 3D3AA 1CCWB 2DY3A 2EPLX 4ATLA 3GFZA 5BOFA 1TVPA 1F3WA 1W9DM 1H49A 3QLDA 4XKYA 5K9DA 2Z7GA 1A50A 2BS9A 3HPZA 2GQ9A 3NZ1A 3LHWA 1QCWA 2R1KA 2DH2A 2AMXA 2NQ9A 5D38A 2RAJA 4J3XA 1OYCA 1TJ0A 5AYIA 3H2CA 3D6NA 1OG6A 5B7ZA 4PA8A 1R46A 2X0HA 2P10A 2NUYA 5G2WA 1XR2A 3MUY1 3SBFA 1K7FA 4A2RA 3U57A 1P6WA 2PB1A 2X2YA 1R7AA 1W2VA 5FA5A 4CQAA 2NX1A 3TCSA 1GKRA 1W9PA 3IJ6A 1W5NA 1CZ1A 4BNEA 3KVJA 2JQXA 1HUVA 4EXAA 4DVOA 3DU0A 3MDWA 4Q8UA 3SY1A 3TSBA 1QPRA 4JCLA 1UYQA 1YXYA 3Q94A 3QGKC 2ZZ1A 3MZNA 2E3ZA 2JGQA 4AFYA 4X61A 1RQHA 1X8FA 2C6QA 4UFKA 2HK0A 3WF1A 3ZR6A 3ZVIA 1RBOB 4Q8VA 2OU4A 5CZTA 3E0FA 4CNSA 2PGWA 1Q6RA 4M3PA 3G3MA 4M29A 4C6CA 4U28A 4UTMA 4LB3A 1JQKA 3O1NA 3FYOA 2IPWA 1LL6A 1FWEC 1E0XA 3V4BA 3RAOA 1E70M 4LYPA 2V3EA 3W70A 5FL1A 5ENLA 2HCVA 3TJIA 4E3CA 2ANUA 1PHWA 4UTTC 4EZTA 4DLFA 1WXYA 2FB2A 2EG7A 4XD3A 4JHZA 5LXEA 2WKJA 3EWBX 3Q4DA 6XIAA 2WMIA 1DJZA 3LCXA 2FH8A 3FVMA 1H3GA 1XLAA 3ANVA 3L66A 4JKLA 3W07A 3VI2A 4ONVA 3QZEA 3S5SA 3VE7A 4BF9A 3OHIA 1ZJBA 3W6MA 4AAJA 5BRBA 5DCEA 4Q3MA 2V69A 4Q7BA 5IRPA 2G96A 1SUFA 4I3GA 2VEKA 1MW1A 3HMCA 3NEVA 4O11A 3SUSA 4ZE5A 1UIPA 1H7WA 3W7PA 3UZ5A 5CAKA 4Y90A 1V4YA 2YXXA 3TA6A 4GYKA 3GXNA 2XZ7A 3VD7A 3L7RA 2CBUA 3F2CA 2EXOA 3JZEA 1AMKA 1LM1A 3PPFA 3MMUA 3QN3A 2CLEA 1EYEA 4YS1A 2WMGA 1JQVA 1FWBC 3SN0A 3ZO9A 3KDNA 4LS2A 2GQ8A 4P8UA 1KGWA 2Y7GA 4ZO7A 5BWAA 1BYAA 1QASA 5C70A 4KMQA 1R33A 3W1TA 2IKGA 2OOFA 4FNSA 2D0GA 3T81A 3BUIA 2CW6A 4WXYA 2QPUA 3SECA 1PVNA 1YADA 5CG0A 4P7RA 4B9YA 4R7WA 1G7UA 1JCYA 1Q6QA 1TREA 2C0HA 3WBWA 1VEMA 1DWIM 5CKSA 5I09A 3M9YA 4J3WA 4HPGA 2QVNA 1UD6A 3VIKA 3NL6A 4CKQA 3SY5A 4NI3A 3W9ZA 1QPQA 4PCSA 1WDRA 1ZP3A 2EGZA 2QF7A 3D0CA 3MSDA 2GOUA 3BLIA 2PI6A 1AZ2A 4GI9A 5ABFA 1GGOA 3I3EA 3T05A 4HYRA 2ZBTA 4DNMA 1POJA 4B15A 1A3HA 4ZODA 1BSIA 2VGGA 4HZ7A 4S3JA 5DMYA 1G7VA 2DZTA 2X3WA 5T8GA 3ITOA 3U7BA 5BZAA 2E6AA 3QQWA 5BMWA 3VMOA 3JS3A 3L9CA 4IOTA 3R2GA 2J13A 2X1RA 2YB4A 3UWUA 3WH6A 1KBLA 2POTA 4DXXA 3ER9B 2QAFA 1WE5A 3M0KA 2EX3B 1EF3A 2BTMA 2I9UA 1HGYA 3NCOA 2GAFD 1QHZA 2WSRA 1EPXA 2XISA 1FWFC 1JPIA 5JQ9A 3SN4A 5KETA 2TSYA 2E6DA 2ISDA 3K2GA 3PBUA 3FKKA 3MKVA 1MFUA 3VOCA 1Z41A 1EC7A 3TN4A 1NF7A 4CD6A 1ZAIA 4H7VA 3MSYA 3JRKA 3HV9A 2G3NA 4CEUC 1GYNA 2D2GA 5HMSA 3W7QA 3N3MA 3RO8A 1UOZA 3ITLA 3S1UA 2BX7A 1UC4A 4X60A 3PZUA 4JQAA 2BVYA 3GWQA 4F0KA 3A5FA 1IQ8A 3WLLA 3THDA 4IXXA 4P8WA 4GVHA 3LA4A 4PULA 4DO7A 1WAUA 3UZZA 5A8GA 3HQ1A 1JYNA 3L4TA 3N4AA 2D3NA 3ANYA 4GG9A 3SFKA 2PDWA 1HO1A 3BLKA 4J3TA 1MSSA 5C2CA 3L5LA 3BOFA 3CV5A 2QUNA 4U31A 2WPGA 1XX1A 1V77A 2PRHA 4H83A 5A6JA 2G8ZA 1JF5A 1E0TA 3URNA 1G4EA 1OHLA 1CNVA 1DBTA 5H8UA 3WDJA 4RPQA 3O2LA 4O1DA 3AWNA 2QEZA 3VVGA 4XAFA 5XIAA 3N4FA 4WKFA 2WYHA 1LRNA 3SRHA 2QNEA 3N2OA 2Y89A 3MSRA 1Q8JA 2NQ5A 3NDYA 2PY6A 1YDNA 4B5SA 4DELA 3CT7A 3WNPA 4XZBA 4LNCA 2F7QA 1NDYA 3OWGA 1U1UA 1FH8A 3C5QA 7A3HA 3B97A 4R9OA 3B51X 4C6EA 4I90A 4R9XA 4G56A 5HNTA 4NT0A 5DELA 4HNUA 5FACA 2DUXA 1YE4A 5RUBA 3R5EA 4FA3A 1H1NA 4J35A 3RRAA 4CQBA 4U5IA 3SEPA 3AFBA 2PWUA 3RMJA 3T0DA 3KS5A 3H21A 2BSLA 1XG3A 3LG3A 1Y7VA 4WDWA 5CH9A 3D50A 2DH3A 1OVDA 4RDYA 3DYPA 3E2SA 3BE7A 3PJXA 4RZBA 1TQJA 5U7SA 4RPPA 1QPKA 3ZFHA 3GE7A 2NSOA 2D20A 1OFOA 1V6VA 1XLHA 2WV8A 3MHGA 5AKQA 1A5NC 3W1MA 4QJ5B 3EKZA 3C0QA 1UWTA 3PFMA 3VZYA 3T47A 2JNSA 1JD7A 1K03A 4WRHA 3SJ3A 3VTRA 4PUDA 3AIVA 3L4VA 1R87A 1GVQA 1JIBA 3T6CA 3AISA 1FDJA 1KQYA 3ARQA 2V8ZA 5A3HA 4U2ZA 3VEAA 4ERAA 4B5VA 1HJQA 3SRFA 3QR0A 2FZ9A 3MMTA 2QDGA 1CW2A 2HJPA 2CCRA 4FAMA 2ZDSA 2BY2A 2RAKA 5CBBA 1KM6A 1WZAA 3VD9A 5I00A 1JEZA 5EBAA 1C7SA 3PB2A 4LY4A 1W1VA 1WA3A 2DFAA 1GZGA 3TTYA 5IBXA 1SUXA 2JEPA 4IM3A 1R3SA 4LUSA 3TKFA 3A4JA 3EWZA 2G50A 2GUYA 4IP5A 4NAFB 4UR7A 1ONWA 3VIPA 4S3KA 2Z2AA 3DFOA 3N2BA 2JF6A 3EA2A 5GNZA 1LT7A 1GOKA 4UBPC 4GUGA 4IL2A 4BY3A 3LI0A 1LRQA 4G6QA 5MF5A 4KCUA 4UFLA 4YWIA 3VIIA 4RE0A 2B0MA 4A29A 4EZVA 3CUXA 5D2VA 2FPVA 3MANA 4WVXA 1WKFA 4H6KA 1H62A 2J77A 4A3QA 3G3DA 5A6BD 2OO2A 2YB1A 2XFFA 1MRAA 4YHEA 2WHMA 1O6IA 4JN4A 1V6UA 5MKGB 2O56A 3NZQA 2I7GA 1DJWA 1W8GA 3PTDA 5DQPA 2HPMA 1E43A 2OBLA 2WHJA 2OZTA 4M6PA 1CENA 1W31A 1WO2A 3CO8A 1JAEA 3EMQA 2Y1HA 1QAPA 4FSAA 3IJIA 2NUXA 4LBSA 5U4NA 3RU8X 7ENLA 5LSMA 1YKWA 3GM8A 3VC6A 3QHNA 3U3HA 3W0KA 4CGTA 1Q45A 1ITCA 1V51A 2GQ3A 2VGFA 4YTSA 3D47A 2TMDA 2J6VA 2C79A 3WD3A 1KXHA 3NPUA 4JY8A 4AZIA 1Z9AA 3RDKA 4XZMX 2CYGA 1RJRA 2Z1KA 2GFTA 2C3ZA 8XIMA 1RJPA 4PMQA 2GK1A 1EBGA 1M7XA 4URIA 4UFIA 4YVPA 3FHAA 4I6VA 5EKYA 2WM0A 3QHOA 4DNHA 3WQ8A 1C7TA 4DYLA 3EWXA 4MNJA 5DO8A 5FJRA 1LL7A 2Z24A 4GJJA 3DFSA 3BH4A 3KFTA 1KFJA 2VO5A 3N2TA 4N9DA 4TOQA 1MUMA 1EXBA 2VC6A 3MQTA 4KS0A 4EZQA 3WLHA 1E9YB 2CZEA 2E9LA 4AD0A 3EDFA 2Z29A 1OABA 3W28A 1W37A 1Q7QA 5LNUA 4B91A 3GQYA 2DVXA 3UERA 1FWSA 3S9ZA 4W7VA 3PZ9A 5LA2A 1UD4A 2ND1A 3B03A 2QJJA 4BI5A 2E9BA 1XV8A 2FLIA 2R1LA 1PTGA 1VB9A 4GY0A 5DEZA 1A5SA 1LTDA 3GDBA 3LRKA 4R5LA 5I3JA 4A4AA 1UMYA 1AQFA 1J2WA 4CVWA 2R1PA 3E0VA 3GD6A 3S47A 3IGXA 1K8XA 2O9RA 4JZ5A 2C71A 1R3YA 3NYZA 5D33A 1XLKA 4A6GA 4Q33A 2FPTA 1DXIA 1JRBA 1XSKA 5DY3A 3OYXA 4GUHA 3M3WA 4DPQA 1JCNA 3KDRA 4PR4A 1J12A 1A47A 5J5DA 1XLCA 3DHDA 5HQLA 1VFLA 5TNVA 2EO7A 3BGGA 1BLIA 4AHPA 4LC8A 4FZPA 3R79A 5BXTA 3H2OA 2QR6A 4WQ6A 3KBMA 1J6PA 1P43A 3FXGA 4EK7A 4LXFA 1KM1A 3BAKA 4MOZA 3GHUA 3IJLA 5DN1A 1A5LC 4IMAA 1TQVA 2C16A 3M0HA 3KAVA 1BWKA 7TIMA 3L65A 4Q6JA 3IV3A 1GYMA 3B0PA 4JKKA 1L6YA 3AYRA 5M5DA 3ID7A 3VA8A 1QI3A 3AHTA 3FFSA 2YIHA 3CQHA 4KETA 2WMKA 3MT1A 3WNNA 4Y9MA 4W89A 4H9ZA 3UITA 4QDMA 3DX2A 5I3KA 1WZMA 4ECLA 2A4AA 1OFRA 4BA0A 5IDZA 2H8XA 4YXGA 3VKKA 2FGLA 3S5ZA 1E0UA 1Y65A 1ONXA 3I6EA 1WDPA 3T48A 2QGHA 3OGSA 4E3TA 1CB7B 1LLZA 1H5VA 2QYGA 2ZUVA 5LYRA 3P93A 1F76A 3W83A 1JCLA 1WKYA 3JR2A 2PF8A 1UBSA 1EO5A 1UR0A 3OZOA 3JVAA 3PUEA 4CCEA 2QUMA 1XD1A 1JULA 1LUCA 1XKYA 5DY2A 5A8NA 4PMOA 4HU4A 1Q65A 3PULA 5HMEA 3B0XA 3LDVA 3LM3A 3PUGA 1D3GA 3PFRA 4IMCA 1BXCA 3GU9A 3UXAA 4WPCA 1H7XA 1VAHA 1Q4NX 3G1YA 5FD0A 3WQ4A 2VR2A 4BJHA 4RZ6A 3MKCA 4GYPC 1KW1A 4JYFA 2OGYA 4P7LA 1TVLA 3OZYA 4Z1BA 4EZWA 2F7PA 1KBJA 3RXZA 3WN6A 1US0A 2GGIA 3CUGA 3G6LA 2OT1A 4WGHA 2W66A 2Y88A 2FDMA 4QAIA 3FXYA 3GG0A 1UJPA 3WLRA 4WCJA 5HANA 3FVDA 3TH6A 3VMPA 3B9EA 4NNBA 4WSHA 4TMCA 3KVLA 2ZXDA 3FEQA 3P0XA 3N12A 3TWAA 2FTWA 5TKYA 6PTDA 5I03A 4JHMA 1QWUA 1A4LA 1CB2A 4P8VA 5F4WA 1E6SM 1T0OA 3FOKA 3RFAA 1IXQA 4E81A 2XHYA 4O13A 4AVOA 3E0WA 1U5VA 3DFTA 4IM0A 1V0MA 1JXKA 3LV6A 3BQ5A 3N9SA 2Y7FA 1J0JA 3GNXA 5CAHA 1VHNA 1C91A 2ZTKA 2IPGA 4QFUA 3V18A 5FEXA 3DYMA 3ARSA 4CNPA 1J6OA 4PB5A 4GE8A 3NQ6A 1PS9A 4GQRA 1XUZA 1O66A 5HWNA 3MWCA 1E15A 1RY0A 4MKVA 3P61A 3OP2A 1A0DA 3MUXA 3PZOA 1RK5A 2ATSA 1QX1A 4ALDA 1FWRA 1B3WA 2CWNA 1HJXA 3S6DA 3BLDA 3STCA 3FSTA 1FP9A 4HHPA 4J7RA 2R94A 2CXEA 3CU2A 4NJJA 3EWDA 3L23A 2VHLA 2WVSA 4ML9A 1ZNNA 5E9AA 3AIWA 2Z00A 1IE7C 4FNUA 4LUTB 1VENA 1K77A 3PANA 3I3BA 3D4ZA 3R8RA 2CEQA 4QG8A 3D5HA 1EDGA 4JN6A 3PP7A 3B4YA 1CXLA 1UCWA 3IAQA 5A2BA 1F6YA 3DDGA 1B30A 2W62A 2RT6A 3DKLA 3SADA 4H7ZA 1KR0A 4GMEA 2DIKA 4WUIA 4ZVJA 1NY1A 5CPOA 3RM8A 3OHMB 3W27A 4KIEA 1W2PA 1TSIA 3OZMA 2XPKA 1VBHA 1NF0A 1TA3B 4O57A 1J4EA 4KWVA 5C6MA 1A5KC 1E6NA 4G1KA 1B2YA 1JJKA 4MNLA 1IEQA 2F7OA 1Q8AA 3B53X 4JLCA 2GLKA 3ONBA 3S2NA 4QSHA 4RW3A 3IV8A 1TQSA 1U00A 2FQIA 4OV4A 4BI6A 1IEIA 2WSKA 2VR4A 4H2HA 4PGLA 4HPHA 2AAAA 4JNFA 2AOSA 2QUUA 3W75A 3W29A 5HDRA 4L6OA 1TPDA 4UTIA 2VENA 2ZQ0A 3CMGA 4WGXA 3TTSA 1I75A 5I06A 2HNHA 1GZ1A 4AD5A 1L2QA 2BHYA 1HKKA 2FVKA 3QSRA 4ZQNA 3TP4A 1K8ZA 2C15A 3ARYA 4AF0B 4HB7A 7TAAA 2I57A 2FTYA 3BJFA 2ZRWA 3AS3A 4CNNA 3TV8A 5C0QA 1VEPA 4IMDA 3NEHA 4B2DD 3DX4A 4ZQPA 4HA0A 4BHYA 2FTPA 4J5NA 2E28A 1KWKA 2ZICA 4W88A 3RLGA 1EKOA 4X9SA 4EF9A 1Z32X 1GKQA 1XLDA 2WMJA 4KRTA 2NLIA 3AYVA 3BSHA 2I5IA 3LGGA 4DWDA 1X7IA 3NM1A 4XG1A 2PLCA 2JF7A 1GPFA 4OFCA 2PDKA 3HTWA 1TFVA 3PZGA 1F73A 3SCSA 4IQEA 3VUPA 4HNVA 1X04A 1RALA 2YOCA 2Z6JA 2H8ZA 1M7JA 4F48A 1UZ4A 4FF7A 5FOOA 3NQEA 2VCBA 3EKLA 4PN2A 5G4EA 1B4EA 9RUBA 4MPKA 4PCNA 3BCFA 4Z0JA 5AVHA 2BXVA 3H26A 1KM2A 2VFDA 2B4GA 3T8LA 2VEMA 1K8CA 4W5UA 4REQA 4TV5A 4B5TA 2Z1XA 1L9WA 3BPWA 1W9UA 5REQA 4O0KA 5JH2A 2YI8A 2OODA 4HMEA 1S46A 1TR9A 3T7VA 1PL9A 4WJXA 1O7DC 3AS1A 4Q8TA 2ZE0A 3CB3A 2IXUA 1I4TA 5EA9A 3NQAA 5HATA 2N3KA 2CHRA 3E1F1 4MWAD 1RLDA 5CGQA 3CM4A 4FR6A 4C91A 3F5KA 5I3HA 1TX0A 1GWJA 1AH4A 1O1HA 1MXSA 2P5NA 1RD6A 3BAJA 2F6UA 4JQ3A 1I0BA 3H7UA 3GNDA 3LZ5A 3LPPA 1MVYA 2FMNA 1WDDA 1C93A 5D05A 4RR4A 1KTCA 2F6KA 2QJNA 3ITTA 1MUCA 3HOJA 1J0HA 4IHCA 4RZ5A 4P7QA 4IIDA 4G5DA 4UOZA 5FCZA 2QCHA 1IWBA 5K4ZA 1UZDA 4HJWA 4UTJA 4RJEA 3HG3A 4JNYA 3RGTA 4ML4A 3CO4A 3ZS4A 1JDEA 3APYA 1HIZA 4F79A 1VFSA 1UWQA 4E2DA 3W7RA 3C3NA 3B0UX 4J27A 2RDWA 3WL0A 3UG3A 1BYBA 3WLKX 5TAOA 3AC0A 3SO7A 4FLRA 1AJ0A 4MB3A 2NCZA 5CSUA 3KTXA 5EL1A 1CGTA 1UOKA 4UB9A 4UNKA 3SCNA 3HZ3A 2ZX7A 2WKGA 2W61A 5A1AA 4ATWA 5A2AA 3E74A 2WANA 3MW7A 1FFRA 1FWIC 4GZEA 2GZXA 1FWDC 4H8UA 1LUCB 4XZWA 7CGTA 4MM1A 3NVDA 2FYMA 3N4EA 3MYPA 4LAOA 4AVMA 2CBVA 3CIWA 3BG5A 3GLCA 4Z2IA 4DB7A 5D32A 1UKPA 2PLJA 5FF7A 3G24A 3M0IA 3K1DA 4DAIA 1EL3A 4ICMA 1JL8A 4MSSA 4Q32A 2I17A 1I1WA 1UUQA 5A6TC 3A22A 4I1QA 1JDDA 3GNOA 3B9NA 3HG4A 3OPSA 3KOWA 1S39A 4H19A 1YDVA 4RXFA 2OKTA 1M5WA 4MJZA 3HM7A 3WH7A 2Y85A 3R0KA 2AL1A 4ZSUA 4L9XA 1A49A 3FX4A 3V5OA 3G6MA 1QW7A 3P5ZA 3ZLGA 3IIPA 3L4YA 1LBFA 3NQMA 3KM8A 3C52A 4PMYA 1TQTA 5DT7A 3CC1A 3CHEA 2V0TA 3DEQA 4DJFA 4D6DA 2O7QA 1KCXA 3GYCA 3BXWA 3HPFA 3W2LA 3QXBA 1KRMA 2CZDA 3LU2A 4IWQA 4YCPA 4IFKB 4J2PA 2F1AA 4YLWA 3RIKA 3LCIA 5CJ5A 3BJSA 2J25A 3BZJA 3CQJA 1C9WA 2V2HA 1OIFA 3FD9A 1ICSA 4HIBA 4OV9A 4NU7A 1K6WA 1DIKA 3V16A 1GVFA 2NV2A 2TODA 4QROA 3VINA 2DQXA 2CC0A 2KAUC 2XGZA 3M0JA 1GOOA 4FM3A 1OIMA 2XFRA 2IXVA 5IXEA 1XKJA 4E0CA 2G3IA 3S1VA 4GX8A 1NIUA 5CPLA 1RZMA 3OIXA 3BLBA 2JKAA 1EFZA 2I16A 2CIPA 3PR2A 1SW3A 1PB0A 2BV9A 1V8EA 3U48A 4U33A 2AKMA 5FF4A 5TQLA 3DX5A 4BK9A 5FJOA 3VFCA 1ITQA 4XISA 4HR1B 3RR4A 3H6OA 3ABZA 4JWDA 5TF0A 4I9AA 1EO7A 1VYPX 3M6DA 3TU9A 3OLDA 2PU0A 1ZSXA 3MHFA 3UJFA 3PN8A 3RCMA 3ZT5A 7REQA 3AJXA 3MP4A 4LF1A 4CNUA 2CLPA 4WY0B 3KOXA 4GBUA 3TYEA 3TC7A 4YWSA 3M7SA 1CGWA 3NQ7A 4AB4A 3F7WA 3EEZA 1JZ5A 4JNEA 1TV5A 3MMWA 4IGSA 5BU6A 4EAYA 4CU6A 1PX3A 1XL9A 2VX7A 4K1GA 2J88A 1HQTA 5F2LA 1VIWA 1KO0A 3DESA 1YPIA 1OF8A 2VCCA 3IEBA 3PB0A 3EA3A 2POZA 4L9ZA 4XVEA 1F3XA 2DZWA 2ZX9A 3KUMA 1E6ZA 3ONCA 1TA3A 2PS2A 1AD4A 3O15A 3M0YA 2QAPA 3P6LA 2GVYA 3DYOA 3KZPA 3I2WA 1SO6A 1OEPA 1XH0A 1ML1A 4JIRA 4WOQA 3C61A 2V2CA 1XICA 2VDIA 3S2LA 2P1FA 4H6HA 3UEQA 1XDMA 4UDXX 1G0CA 4UTLA 1GW9A 1EX5A 3U5YA 1TWSA 5L6UA 1J11A 1PJ9A 4MJ2A 2XU2A 3N34A 4HYWA 4F01A 3S2JA 1QPOA 3SIMA 5E6ZA 3WK2A 4TTGA 1U1JA 3PNZA 2CWXA 4UNIA 1C9DA 5D04C 3LSCA 1VYSX 3QY6A 3D3FA 1L0PA 4QIUA 3TQKA 2YYUA 3VO0A 4ACZA 1OK4A 1A53A 2OWWA 4OOZA 3WG6A 1QW8A 3KHDA 2P3ZA 3UA3A 4CLMA 2PSNA 5KMYA 1Y2OA 3KBJA 3CZEA 4KEMA 1OCJA 3V7PA 1PZ1A 5E0KA 5BYWA 4NXSA 2IMRA 3CQ0A 4Z08A 4MUPA 4QDPA 3FV9A 4G6CA 4DEFA 2WINM 4K6AA 1K9EA 3A9IA 3WNKA 3GVWA 4M19A 3E5PA 1BVZA 3N19B 3O63A 3QOKA 1NU5A 1JUBA 1BWVA 3DG7A 1Q85A 5HJYA 2Y70A 4CN4A 3OIHA 2YSWA 4D2JA 2EPHA 2QJHA 4TX8A 4IWWA 4ZCWA 1AH3A 1NM9A 4GYJA 4IICA 4JIEA 1RPXA 3FA5A 2YPIA 3L5AA 4GZ7A 2FFCA 1M1BA 1VPYA 3ARPA 2YBTA 4JCMA 2VX6A 3W37A 4WLCA 4IGHA 2XFWA 4BQ3A 3WQCA 3F4VA 3R94A 3N6HA 1KQZA 1FBAA 1CGXA 4JHOA 4YVVA 4R5EA 3RN6A 4S3FA 3G9GA 4HOXA 2OWCA 3WH5A 4LFYA 2PGEA 3VNDA 3LB0A 4B2DA 5I0DA 4UFHA 2IQDA 4ZENA 4FX8A 5IFTA 4GC4A 3MHUA 3EKGA 1NTHA 2EBNA 4R3UA 3TIMA 7REQB 1VRXA 1UWSA 2NVDA 4NUWA 3V3WA 1AQHA 1L6SA 4F3HA 4LW7A 3LQLA 2R91A 4HNNA 4GISA 3W7IA 3L67A 4S3DA 2CZ5A 4NXKA 5JUVA 3QY7A 4C6JA 3UNTA 5BROA 3C0JA 4HA1A 3KCOA 3WK1A 4XSLA 2C8NA 4N02A 2YXGA 4OHQA 3ZZ1A 3VIMA 5D9MA 1K8YA 2OO6A 2QJMA 2WW5A 3IUHA 4H6QA 1XSJA 2PZ0A 2F38A 3AXHA 1P0EA 1TPB1 1EJTC 2B7NA 3LYEA 4FXRA 3AHZA 3QTGA 4IJBA 2C19A 5A8QA 2BLEA 3RM9A 3IIOA 4X3ZA 4IQLA 1M7OA 1LT8A 4XIAA 3AYSA 3BUBA 4FS9A 3BAXA 5JIPA 4X63A 1W9BM 5KSWA 3ANUA 3VNZA 3CL7A 3MPGA 5EB8A 3W7LA 3IVSA 4OU1A 3B40A 3LBCA 2WLZA 1DWGM 2A2IA 1X1NA 4JICA 4WEVX 3WQVA 1GQLA 2CETA 3CUHA 2WO5A 1OYAA 2BOGX 3WLTA 2HEJA 3R0DA 4D1IA 2WVUA 3APTA 1E40A 5G5IA 3TAKA 5KITA 2ZADA 3W1NA 8RUCA 2EPMX 3DI0A 1DE6A 2J7HA 3NQFA 3SR7A 4QNEA 1PIGA 3ITGA 3T0BA 5F4XA 4P2VA 1LWHA 3MY9A 3QW4B 4FF5A 1MMFA 3UT0A 3S1GA 4PB4A 1HVXA 2OLHA 1E56A 3M64A 2F1BA 3KXQA 3THAA 1OFEA 5ECVA 1UR1A 2C14A 4XBKA 2G37A 4D72A 4IIBA 2ACRA 4AU0A 3LXBA 3VM5A 4PCPA 1TJRA 4UTHA 3W6LA 5HPOA 1AJ2A 2ZE3A 2J9ZA 2XZ9A 1E0VA 3L68A 4GUIA 1I2QA 1O68A 4G2DA 4O18A 1DIEA 5KZMA 1UD3A 3A4AA 1LQAA 2CBIA 1SMAA 1MQPA 1XBVA 3F5JA 4Z2GA 4L1XA 3LTYA 2XSAA 3USBA 4A05A 4KRUA 1LLWA 1J01A 1HKWA 4HZ6A 4AH7A 5C2XA 1NAL1 1YNYA 3VGGA 3PPCA 3CWHA 3WUGA 4EAMA 2NT0A 4K36A 3VGFA 1YMYA 3VCNA 3UA4A 1ME7A 2G3JA 4S2CA 5IHSA 3A24A 4W8BA 2BVDA 4D1JA 4BEQA 3VKBA 3CBWA 2ZRVA 2Z0VA 4GUJA 4CNOA 5FSEC 2GSEA 4HTYA 4S3EA 4AYSA 1E73M 1FCVA 1HL8A 2QS8A 4CEXC 2Z8YA 4S3GA 1Z42A 2WVTA 5BMXA 2OG9A 4IF2A 4I7WA 1AD1A