3QE6A

Mouse pacsin 3 f-bar domain structure
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
290
structure length
283
Chain Sequence
GSFWEAGNYRRTVQRVEDGHRLCGDLVSCFQERARIEKAYAQQLADWARKWRGAVEKGPQYGTLEKAWHAFFTAAERLSELHLEVREKLHGPDSERVRTWQRGAFHRPVLGGFRESRAAEDGFRKAQKPWLKRLKEVEASKKSYHTARKDEKTAQTRESHAQEQLRKLQERVGRCTKEAEKMKTQYEQTLAELNRYTPRYMEDMEQAFESCQAAERQRLLFFKDVLLTLHQHLDLSSSDKFHELHRDLQQSIEAASDEEDLRWWRSTHGPGMAMNWPQFEEWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein kinase C and casein kinase II substrate protein 3
publication title Rigidity of wedge loop in PACSIN 3 protein is a key factor in dictating diameters of tubules
pubmed doi rcsb
source organism Mus musculus
molecule tags Endocytosis
total genus 117
structure length 283
sequence length 290
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00611 FCH Fes/CIP4, and EFC/F-BAR homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 3qe6A01
2RAKA 2Z0VA 2RAJA 3HAJA 1WDZA 2D1LA 4BNEA 3M3WA 2D4CA 1ZWWA 1I4TA 2Z0NA 3QE6A 4NSWA 5C5BB 4AVMA 3Q0KA 1I49A 3ABHA 2X3WA 2Z0OA 2Q13A 3PLTA 4I1QA 2RAIA 4DYLA 3I2WA 1I4DA 3SOGA 2FICA 3Q84A 3DYTA 4AKVA 1X03A 1X04A 2Q12A 2C08A 2EFLA 5C5BA 3QNIA 4NQIA 2EFKA 3OK8A 1Y2OA 2ELBA 4WPEA 3CAZA 3QWEA 3G9GA 4WPCA 2YKTA 4FZSA 3LLLA 2X3XA 3ACOA 2V0OA 3HAHA 3SYVA 1I4LA 1URUA 4H8SA 2X3VA 3HAIA 4DCNC 4ATMA
chains in the Genus database with same CATH superfamily
2OBMA 2MI7A 3CZNA 2O0I1 3Q0KA 3I01A 3O3MB 2YL6A 3T46A 1YWMA 4KIKB 2OZNB 3GI7A 2JNKA 1E1DA 4EZNA 3QWEA 3EJQA 4HY9A 2ZXQA 3T4AG 4B9QA 1DKXA 3L3PA 4EZRA 1R34A 2F7OA 2WYHA 2Z0OA 4DYLA 1I4DA 4H6IA 3DYTA 4AKVA 2EFLA 4WPEA 3BUIA 1GN9A 4EZOA 1GNLA 4EZSA 2F7QA 4JNEA 2F18A 4H6HA 3O3NB 3KAWA 3EJTA 4EZYA 2LM0A 3PLTA 3BUBA 3D2FA 2F1BA 1JQKA 1OA1A 2QKWA 1QWNA 1ZYLA 3EJUA 3D51A 3CAZA 3DX4A 2Z8YA 2GAFD 2V0OA 4EZWA 3HAIA 1E2UA 2RAJA 2YL5A 4IM0A 3VKHA 3B53X 2C08A 2PMRA 3QNIA 4JL9A 4R5IA 2PY6A 3HAHA 2YLAA 1U00A 3B51X 4FZOA 3DX1A 1SU7A 5C5BA 2EFKA 4AZCA 3L3OM 3LMFA 3D4YA 4G6QA 4IM3A 4DCNC 3DX3A 2OBLA 4JWEA 2ND1A 3ERCC 4EZTA 3A98A 3EJRA 4I1QA 2X3WA 3Q84A 3BUDA 3C7NA 3CKDA 4UDXX 2F7PA 3G9GA 3B52X 5TKYA 4FZSA 2X3XA 3BVWA 4PO2A 3HAJA 1UPXA 4JN4A 2YI9A 1DKYA 1SU6A 3T48A 3DDGA 3OK8A 4EZPA 4HR1B 4R5LA 4EZVA 3DDFA 3BVXA 4AZBA 3ACOA 3DPQA 3I39X 2YLLA 1O7DC 4M0MA 2FYVA 4EZZA 1GNTA 4E81A 1X04A 1HWWA 1TQTA 4JWIA 4EZUA 3BUQA 1MJGA 1PS3A 4KIKA 3ZEDA 1QWUA 4JWDA 2WYIA 1URUA 2KHOA 4AZ5A 2Z0VA 2Z0NA 1I4TA 4AVMA 4EZXA 4AZ6A 1X03A 2F1AA 2YL8A 3CVRA 1SUFA 5FLEX 2NCZA 2YIAA 4IM2A 1I4LA 4FZPA 4E3CA 3VEAA 1OAOA 1OA0A 2RT6A 4BNEA 3VEBA 3M3WA 2YIBA 2GF4A 2FICA 3ER9B 3BVTA 2OW7A 4FM3A 4AZIA 1TQUA 3D2EA 3QA8A 3O3OB 3CZSA 4R5GA 3BLBA 3DPOA 1R5EA 4ATMA 3D4ZA 5FIGA 4F01A 2Q13A 3ER8C 4JLCA 2OW6A 3I2WA 1LQ7A 3OWGA 3F7WA 3LLLA 2YL9A 3T49A 4H8SA 1HTYA 4AZHA 3BVUA 2N3KA 1I49A 3LVTA 1TQWA 2RAIA 2YI8A 1HXKA 2WINM 4JNFA 2X5CA 4NQIA 1O7DB 2QXLA 2X3VA 1R33A 1QX1A 3KAVA 3BVVA 4R5JA 1DKZA 1ZWWA 2ND0A 4JWCA 3EJSA 2JNSA 3EJPA 3SOGA 2OO2A 3T47A 1Y2OA 3OHXM 4IWQA 5E84A 3DX2A 4IWPA 3BUPA 4R5KA 4F00A 2RAKA 1WDZA 2D4CA 5C5BB 3QE6A 4NSWA 3ABHA 4AZCB 4D8JA 2LXYA 2Q12A 2QFFA 2ELBA 4HYBA 4EZQA 2YKTA 4IWOA 4HR1A 2EWFA 5KBPA 3RV0A 2EX3B 2GA9D 1SU8A 3RV1A 3DPPA 3RPMA 1TQVA 1TQSA 4UDYX 4WPCA 3QNJA 2ALWA 3D52A 3I04A 2D1LA 3UITA 3KDRA 3FD9A 1E9VA 3DX0A 4AZ7A 3CV5A 2YIVX 4NPHA 1W9MA 4IW0A 2F7RA 3SYVA 4AZGA 3D50A
chains in the Genus database with same CATH topology
2RAKA 2Z0VA 2RAJA 3HAJA 1WDZA 2D1LA 4BNEA 3M3WA 2D4CA 1ZWWA 1I4TA 2Z0NA 3QE6A 4NSWA 5C5BB 4AVMA 3Q0KA 1I49A 3ABHA 2X3WA 2Z0OA 2Q13A 3PLTA 4I1QA 2RAIA 4DYLA 3I2WA 1I4DA 3SOGA 2FICA 3Q84A 3DYTA 4AKVA 1X03A 1X04A 2Q12A 2C08A 2EFLA 5C5BA 3QNIA 4NQIA 2EFKA 3OK8A 1Y2OA 2ELBA 4WPEA 3CAZA 3QWEA 3G9GA 4WPCA 2YKTA 4FZSA 3LLLA 2X3XA 3ACOA 2V0OA 3HAHA 3SYVA 1I4LA 1URUA 4H8SA 2X3VA 3HAIA 4DCNC 4ATMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RAK A;  2Z0V A;  2RAJ A;  3HAJ A;  1WDZ A;  2D1L A;  4BNE A;  3M3W A;  2D4C A;  1ZWW A;  1I4T A;  2Z0N A;  3QE6 A;  4NSW A;  5C5B B;  4AVM A;  3Q0K A;  1I49 A;  3ABH A;  2X3W A;  2Z0O A;  2Q13 A;  3PLT A;  4I1Q A;  2RAI A;  4DYL A;  3I2W A;  1I4D A;  3SOG A;  2FIC A;  3Q84 A;  3DYT A;  4AKV A;  1X03 A;  1X04 A;  2Q12 A;  2C08 A;  2EFL A;  5C5B A;  3QNI A;  4NQI A;  2EFK A;  3OK8 A;  1Y2O A;  2ELB A;  4WPE A;  3CAZ A;  3QWE A;  3G9G A;  4WPC A;  2YKT A;  4FZS A;  3LLL A;  2X3X A;  3ACO A;  2V0O A;  3HAH A;  3SYV A;  1I4L A;  1URU A;  4H8S A;  2X3V A;  3HAI A;  4DCN C;  4ATM A; 
#chains in the Genus database with same CATH topology
 2OBM A;  2MI7 A;  3CZN A;  2O0I 1;  3Q0K A;  3I01 A;  3O3M B;  2YL6 A;  3T46 A;  1YWM A;  4KIK B;  2OZN B;  3GI7 A;  2JNK A;  1E1D A;  4EZN A;  3QWE A;  3EJQ A;  4HY9 A;  2ZXQ A;  3T4A G;  4B9Q A;  1DKX A;  3L3P A;  4EZR A;  1R34 A;  2F7O A;  2WYH A;  2Z0O A;  4DYL A;  1I4D A;  4H6I A;  3DYT A;  4AKV A;  2EFL A;  4WPE A;  3BUI A;  1GN9 A;  4EZO A;  1GNL A;  4EZS A;  2F7Q A;  4JNE A;  2F18 A;  4H6H A;  3O3N B;  3KAW A;  3EJT A;  4EZY A;  2LM0 A;  3PLT A;  3BUB A;  3D2F A;  2F1B A;  1JQK A;  1OA1 A;  2QKW A;  1QWN A;  1ZYL A;  3EJU A;  3D51 A;  3CAZ A;  3DX4 A;  2Z8Y A;  2GAF D;  2V0O A;  4EZW A;  3HAI A;  1E2U A;  2RAJ A;  2YL5 A;  4IM0 A;  3VKH A;  3B53 X;  2C08 A;  2PMR A;  3QNI A;  4JL9 A;  4R5I A;  2PY6 A;  3HAH A;  2YLA A;  1U00 A;  3B51 X;  4FZO A;  3DX1 A;  1SU7 A;  5C5B A;  2EFK A;  4AZC A;  3L3O M;  3LMF A;  3D4Y A;  4G6Q A;  4IM3 A;  4DCN C;  3DX3 A;  2OBL A;  4JWE A;  2ND1 A;  3ERC C;  4EZT A;  3A98 A;  3EJR A;  4I1Q A;  2X3W A;  3Q84 A;  3BUD A;  3C7N A;  3CKD A;  4UDX X;  2F7P A;  3G9G A;  3B52 X;  5TKY A;  4FZS A;  2X3X A;  3BVW A;  4PO2 A;  3HAJ A;  1UPX A;  4JN4 A;  2YI9 A;  1DKY A;  1SU6 A;  3T48 A;  3DDG A;  3OK8 A;  4EZP A;  4HR1 B;  4R5L A;  4EZV A;  3DDF A;  3BVX A;  4AZB A;  3ACO A;  3DPQ A;  3I39 X;  2YLL A;  1O7D C;  4M0M A;  2FYV A;  4EZZ A;  1GNT A;  4E81 A;  1X04 A;  1HWW A;  1TQT A;  4JWI A;  4EZU A;  3BUQ A;  1MJG A;  1PS3 A;  4KIK A;  3ZED A;  1QWU A;  4JWD A;  2WYI A;  1URU A;  2KHO A;  4AZ5 A;  2Z0V A;  2Z0N A;  1I4T A;  4AVM A;  4EZX A;  4AZ6 A;  1X03 A;  2F1A A;  2YL8 A;  3CVR A;  1SUF A;  5FLE X;  2NCZ A;  2YIA A;  4IM2 A;  1I4L A;  4FZP A;  4E3C A;  3VEA A;  1OAO A;  1OA0 A;  2RT6 A;  4BNE A;  3VEB A;  3M3W A;  2YIB A;  2GF4 A;  2FIC A;  3ER9 B;  3BVT A;  2OW7 A;  4FM3 A;  4AZI A;  1TQU A;  3D2E A;  3QA8 A;  3O3O B;  3CZS A;  4R5G A;  3BLB A;  3DPO A;  1R5E A;  4ATM A;  3D4Z A;  5FIG A;  4F01 A;  2Q13 A;  3ER8 C;  4JLC A;  2OW6 A;  3I2W A;  1LQ7 A;  3OWG A;  3F7W A;  3LLL A;  2YL9 A;  3T49 A;  4H8S A;  1HTY A;  4AZH A;  3BVU A;  2N3K A;  1I49 A;  3LVT A;  1TQW A;  2RAI A;  2YI8 A;  1HXK A;  2WIN M;  4JNF A;  2X5C A;  4NQI A;  1O7D B;  2QXL A;  2X3V A;  1R33 A;  1QX1 A;  3KAV A;  3BVV A;  4R5J A;  1DKZ A;  1ZWW A;  2ND0 A;  4JWC A;  3EJS A;  2JNS A;  3EJP A;  3SOG A;  2OO2 A;  3T47 A;  1Y2O A;  3OHX M;  4IWQ A;  5E84 A;  3DX2 A;  4IWP A;  3BUP A;  4R5K A;  4F00 A;  2RAK A;  1WDZ A;  2D4C A;  5C5B B;  3QE6 A;  4NSW A;  3ABH A;  4AZC B;  4D8J A;  2LXY A;  2Q12 A;  2QFF A;  2ELB A;  4HYB A;  4EZQ A;  2YKT A;  4IWO A;  4HR1 A;  2EWF A;  5KBP A;  3RV0 A;  2EX3 B;  2GA9 D;  1SU8 A;  3RV1 A;  3DPP A;  3RPM A;  1TQV A;  1TQS A;  4UDY X;  4WPC A;  3QNJ A;  2ALW A;  3D52 A;  3I04 A;  2D1L A;  3UIT A;  3KDR A;  3FD9 A;  1E9V A;  3DX0 A;  4AZ7 A;  3CV5 A;  2YIV X;  4NPH A;  1W9M A;  4IW0 A;  2F7R A;  3SYV A;  4AZG A;  3D50 A; 
#chains in the Genus database with same CATH homology
 2RAK A;  2Z0V A;  2RAJ A;  3HAJ A;  1WDZ A;  2D1L A;  4BNE A;  3M3W A;  2D4C A;  1ZWW A;  1I4T A;  2Z0N A;  3QE6 A;  4NSW A;  5C5B B;  4AVM A;  3Q0K A;  1I49 A;  3ABH A;  2X3W A;  2Z0O A;  2Q13 A;  3PLT A;  4I1Q A;  2RAI A;  4DYL A;  3I2W A;  1I4D A;  3SOG A;  2FIC A;  3Q84 A;  3DYT A;  4AKV A;  1X03 A;  1X04 A;  2Q12 A;  2C08 A;  2EFL A;  5C5B A;  3QNI A;  4NQI A;  2EFK A;  3OK8 A;  1Y2O A;  2ELB A;  4WPE A;  3CAZ A;  3QWE A;  3G9G A;  4WPC A;  2YKT A;  4FZS A;  3LLL A;  2X3X A;  3ACO A;  2V0O A;  3HAH A;  3SYV A;  1I4L A;  1URU A;  4H8S A;  2X3V A;  3HAI A;  4DCN C;  4ATM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...