3QE6A

Mouse pacsin 3 f-bar domain structure
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
290
structure length
283
Chain Sequence
GSFWEAGNYRRTVQRVEDGHRLCGDLVSCFQERARIEKAYAQQLADWARKWRGAVEKGPQYGTLEKAWHAFFTAAERLSELHLEVREKLHGPDSERVRTWQRGAFHRPVLGGFRESRAAEDGFRKAQKPWLKRLKEVEASKKSYHTARKDEKTAQTRESHAQEQLRKLQERVGRCTKEAEKMKTQYEQTLAELNRYTPRYMEDMEQAFESCQAAERQRLLFFKDVLLTLHQHLDLSSSDKFHELHRDLQQSIEAASDEEDLRWWRSTHGPGMAMNWPQFEEWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein kinase C and casein kinase II substrate protein 3
publication title Rigidity of wedge loop in PACSIN 3 protein is a key factor in dictating diameters of tubules
pubmed doi rcsb
source organism Mus musculus
molecule tags Endocytosis
total genus 117
structure length 283
sequence length 290
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00611 FCH Fes/CIP4, and EFC/F-BAR homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 3qe6A01
3HAHA 2RAIA 3QE6A 3ACOA 3M3WA 1I4TA 1I49A 2YKTA 3QNIA 3HAJA 2EFLA 4NQIA 1WDZA 2Z0OA 2X3WA 2Q12A 4AKVA 3PLTA 2V0OA 2Q13A 2Z0NA 3OK8A 3LLLA 4DYLA 1I4LA 3Q0KA 5C5BA 2C08A 2X3XA 4DCNC 2FICA 3I2WA 1ZWWA 2ELBA 1Y2OA 1X03A 4AVMA 3Q84A 4BNEA 4I1QA 4ATMA 2RAJA 2Z0VA 3G9GA 1URUA 3SYVA 4WPCA 3QWEA 4FZSA 3HAIA 5C5BB 2X3VA 2D1LA 2RAKA 3ABHA 3SOGA 3DYTA 4H8SA 3CAZA 4NSWA 1X04A 2EFKA 1I4DA 2D4CA 4WPEA
chains in the Genus database with same CATH superfamily
3M3WA 3I39X 2F7QA 3ER9B 2Z0NA 3D51A 4DCNC 3O3MB 3T49A 3BUQA 3CKDA 2KHOA 2YIAA 3T4AG 4EZXA 3KDRA 4R5KA 1UPXA 4JL9A 1I49A 1R5EA 2O0I1 4JWEA 3OK8A 3Q0KA 2X3XA 3KAVA 4EZNA 1HTYA 2WYIA 3DX4A 5FIGA 1R33A 3DDGA 1X04A 2EFKA 4EZTA 3EJUA 2Q13A 2OW6A 4M0MA 4DYLA 1ZWWA 3B52X 4AVMA 3T48A 2GAFD 1E2UA 3BLBA 4FM3A 4IM2A 3RPMA 4R5IA 1I4DA 4JWCA 3F7WA 4F00A 4UDYX 4AZ6A 3CVRA 1WDZA 2PMRA 3DX0A 1OA0A 5C5BA 2MI7A 2YIBA 2FICA 1MJGA 2F7OA 4FZPA 1URUA 2F1BA 4JWIA 3ABHA 1W9MA 2F1AA 3BUBA 2YKTA 2EFLA 4HR1B 4AZIA 3BUDA 1Y2OA 1DKYA 4BNEA 4EZZA 4FZSA 1O7DB 1DKXA 2QKWA 2JNKA 4PO2A 4EZWA 4NSWA 2GF4A 3LVTA 3O3NB 1QX1A 3ACOA 1I4TA 1OAOA 3FD9A 4AZCB 2YI9A 3OWGA 3BVUA 2F7RA 2QXLA 2D1LA 4R5JA 4R5LA 1QWNA 4H8SA 3CAZA 4D8JA 2D4CA 3EJPA 2NCZA 3BVWA 2ND1A 2GA9D 3LMFA 2C08A 3DPOA 1TQTA 2WINM 1TQSA 3EJQA 3EJSA 4EZQA 3BUIA 3QE6A 3OHXM 3HAJA 3DX3A 5TKYA 3RV1A 1X03A 4IM3A 3B53X 2OBLA 2RAJA 3G9GA 2ALWA 4WPCA 2JNSA 1ZYLA 2WYHA 4JLCA 2RT6A 3ER8C 3ZEDA 3DDFA 4E3CA 3I01A 2OO2A 3KAWA 1TQVA 2X3WA 2Q12A 3PLTA 4IW0A 1I4LA 4JNEA 3DX2A 4UDXX 4AZBA 4AZ5A 3CZSA 1E9VA 3D4ZA 3VEAA 1SU6A 2RAKA 4JNFA 1U00A 2RAIA 1R34A 2V0OA 2QFFA 4HY9A 3I04A 1LQ7A 2ELBA 4H6IA 4IM0A 4HYBA 1HXKA 4I1QA 5C5BB 2OW7A 4E81A 4KIKB 4IWQA 1GNTA 4AZCA 3DPPA 3UITA 2Z8YA 5FLEX 2Z0OA 3A98A 2N3KA 3Q84A 3ERCC 2YL8A 2YI8A 3DX1A 3HAIA 3B51X 4EZPA 3VKHA 1YWMA 1O7DC 3HAHA 3L3OM 2F18A 4AZHA 2LXYA 3L3PA 3BVXA 2EX3B 3I2WA 1HWWA 3BVVA 2YLAA 3SYVA 2X3VA 3DYTA 1TQUA 3VEBA 3O3OB 2X5CA 1JQKA 4AKVA 4AZ7A 1OA1A 2OZNB 4EZUA 3LLLA 3D50A 4IWOA 2ZXQA 3QWEA 3GI7A 4EZYA 2FYVA 2PY6A 3EJRA 2EWFA 4B9QA 3D2EA 2YL5A 3QNIA 4NQIA 2YL9A 2YL6A 4EZRA 5E84A 4IWPA 3T46A 3C7NA 3D2FA 1SUFA 3BVTA 4H6HA 2F7PA 1SU8A 3DPQA 3SOGA 4HR1A 2YLLA 1DKZA 4JWDA 4WPEA 4EZSA 4EZVA 1SU7A 3T47A 4FZOA 4KIKA 3EJTA 3RV0A 4ATMA 3BUPA 4EZOA 3D52A 1GNLA 3D4YA 1GN9A 4F01A 2YIVX 3CV5A 1PS3A 4R5GA 4NPHA 3QNJA 4G6QA 4JN4A 1E1DA 1TQWA 2LM0A 2Z0VA 2OBMA 4AZGA 1QWUA 5KBPA 3QA8A 3CZNA 2ND0A
chains in the Genus database with same CATH topology
3HAHA 2RAIA 3QE6A 3ACOA 3M3WA 1I4TA 1I49A 2YKTA 3QNIA 3HAJA 2EFLA 4NQIA 1WDZA 2Z0OA 2X3WA 2Q12A 4AKVA 3PLTA 2V0OA 2Q13A 2Z0NA 3OK8A 3LLLA 4DYLA 1I4LA 3Q0KA 5C5BA 2C08A 2X3XA 4DCNC 2FICA 3I2WA 1ZWWA 2ELBA 1Y2OA 1X03A 4AVMA 3Q84A 4BNEA 4I1QA 4ATMA 2RAJA 2Z0VA 3G9GA 1URUA 3SYVA 4WPCA 3QWEA 4FZSA 3HAIA 5C5BB 2X3VA 2D1LA 2RAKA 3ABHA 3SOGA 3DYTA 4H8SA 3CAZA 4NSWA 1X04A 2EFKA 1I4DA 2D4CA 4WPEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HAH A;  2RAI A;  3QE6 A;  3ACO A;  3M3W A;  1I4T A;  1I49 A;  2YKT A;  3QNI A;  3HAJ A;  2EFL A;  4NQI A;  1WDZ A;  2Z0O A;  2X3W A;  2Q12 A;  4AKV A;  3PLT A;  2V0O A;  2Q13 A;  2Z0N A;  3OK8 A;  3LLL A;  4DYL A;  1I4L A;  3Q0K A;  5C5B A;  2C08 A;  2X3X A;  4DCN C;  2FIC A;  3I2W A;  1ZWW A;  2ELB A;  1Y2O A;  1X03 A;  4AVM A;  3Q84 A;  4BNE A;  4I1Q A;  4ATM A;  2RAJ A;  2Z0V A;  3G9G A;  1URU A;  3SYV A;  4WPC A;  3QWE A;  4FZS A;  3HAI A;  5C5B B;  2X3V A;  2D1L A;  2RAK A;  3ABH A;  3SOG A;  3DYT A;  4H8S A;  3CAZ A;  4NSW A;  1X04 A;  2EFK A;  1I4D A;  2D4C A;  4WPE A; 
#chains in the Genus database with same CATH topology
 3M3W A;  3I39 X;  2F7Q A;  3ER9 B;  2Z0N A;  3D51 A;  4DCN C;  3O3M B;  3T49 A;  3BUQ A;  3CKD A;  2KHO A;  2YIA A;  3T4A G;  4EZX A;  3KDR A;  4R5K A;  1UPX A;  4JL9 A;  1I49 A;  1R5E A;  2O0I 1;  4JWE A;  3OK8 A;  3Q0K A;  2X3X A;  3KAV A;  4EZN A;  1HTY A;  2WYI A;  3DX4 A;  5FIG A;  1R33 A;  3DDG A;  1X04 A;  2EFK A;  4EZT A;  3EJU A;  2Q13 A;  2OW6 A;  4M0M A;  4DYL A;  1ZWW A;  3B52 X;  4AVM A;  3T48 A;  2GAF D;  1E2U A;  3BLB A;  4FM3 A;  4IM2 A;  3RPM A;  4R5I A;  1I4D A;  4JWC A;  3F7W A;  4F00 A;  4UDY X;  4AZ6 A;  3CVR A;  1WDZ A;  2PMR A;  3DX0 A;  1OA0 A;  5C5B A;  2MI7 A;  2YIB A;  2FIC A;  1MJG A;  2F7O A;  4FZP A;  1URU A;  2F1B A;  4JWI A;  3ABH A;  1W9M A;  2F1A A;  3BUB A;  2YKT A;  2EFL A;  4HR1 B;  4AZI A;  3BUD A;  1Y2O A;  1DKY A;  4BNE A;  4EZZ A;  4FZS A;  1O7D B;  1DKX A;  2QKW A;  2JNK A;  4PO2 A;  4EZW A;  4NSW A;  2GF4 A;  3LVT A;  3O3N B;  1QX1 A;  3ACO A;  1I4T A;  1OAO A;  3FD9 A;  4AZC B;  2YI9 A;  3OWG A;  3BVU A;  2F7R A;  2QXL A;  2D1L A;  4R5J A;  4R5L A;  1QWN A;  4H8S A;  3CAZ A;  4D8J A;  2D4C A;  3EJP A;  2NCZ A;  3BVW A;  2ND1 A;  2GA9 D;  3LMF A;  2C08 A;  3DPO A;  1TQT A;  2WIN M;  1TQS A;  3EJQ A;  3EJS A;  4EZQ A;  3BUI A;  3QE6 A;  3OHX M;  3HAJ A;  3DX3 A;  5TKY A;  3RV1 A;  1X03 A;  4IM3 A;  3B53 X;  2OBL A;  2RAJ A;  3G9G A;  2ALW A;  4WPC A;  2JNS A;  1ZYL A;  2WYH A;  4JLC A;  2RT6 A;  3ER8 C;  3ZED A;  3DDF A;  4E3C A;  3I01 A;  2OO2 A;  3KAW A;  1TQV A;  2X3W A;  2Q12 A;  3PLT A;  4IW0 A;  1I4L A;  4JNE A;  3DX2 A;  4UDX X;  4AZB A;  4AZ5 A;  3CZS A;  1E9V A;  3D4Z A;  3VEA A;  1SU6 A;  2RAK A;  4JNF A;  1U00 A;  2RAI A;  1R34 A;  2V0O A;  2QFF A;  4HY9 A;  3I04 A;  1LQ7 A;  2ELB A;  4H6I A;  4IM0 A;  4HYB A;  1HXK A;  4I1Q A;  5C5B B;  2OW7 A;  4E81 A;  4KIK B;  4IWQ A;  1GNT A;  4AZC A;  3DPP A;  3UIT A;  2Z8Y A;  5FLE X;  2Z0O A;  3A98 A;  2N3K A;  3Q84 A;  3ERC C;  2YL8 A;  2YI8 A;  3DX1 A;  3HAI A;  3B51 X;  4EZP A;  3VKH A;  1YWM A;  1O7D C;  3HAH A;  3L3O M;  2F18 A;  4AZH A;  2LXY A;  3L3P A;  3BVX A;  2EX3 B;  3I2W A;  1HWW A;  3BVV A;  2YLA A;  3SYV A;  2X3V A;  3DYT A;  1TQU A;  3VEB A;  3O3O B;  2X5C A;  1JQK A;  4AKV A;  4AZ7 A;  1OA1 A;  2OZN B;  4EZU A;  3LLL A;  3D50 A;  4IWO A;  2ZXQ A;  3QWE A;  3GI7 A;  4EZY A;  2FYV A;  2PY6 A;  3EJR A;  2EWF A;  4B9Q A;  3D2E A;  2YL5 A;  3QNI A;  4NQI A;  2YL9 A;  2YL6 A;  4EZR A;  5E84 A;  4IWP A;  3T46 A;  3C7N A;  3D2F A;  1SUF A;  3BVT A;  4H6H A;  2F7P A;  1SU8 A;  3DPQ A;  3SOG A;  4HR1 A;  2YLL A;  1DKZ A;  4JWD A;  4WPE A;  4EZS A;  4EZV A;  1SU7 A;  3T47 A;  4FZO A;  4KIK A;  3EJT A;  3RV0 A;  4ATM A;  3BUP A;  4EZO A;  3D52 A;  1GNL A;  3D4Y A;  1GN9 A;  4F01 A;  2YIV X;  3CV5 A;  1PS3 A;  4R5G A;  4NPH A;  3QNJ A;  4G6Q A;  4JN4 A;  1E1D A;  1TQW A;  2LM0 A;  2Z0V A;  2OBM A;  4AZG A;  1QWU A;  5KBP A;  3QA8 A;  3CZN A;  2ND0 A; 
#chains in the Genus database with same CATH homology
 3HAH A;  2RAI A;  3QE6 A;  3ACO A;  3M3W A;  1I4T A;  1I49 A;  2YKT A;  3QNI A;  3HAJ A;  2EFL A;  4NQI A;  1WDZ A;  2Z0O A;  2X3W A;  2Q12 A;  4AKV A;  3PLT A;  2V0O A;  2Q13 A;  2Z0N A;  3OK8 A;  3LLL A;  4DYL A;  1I4L A;  3Q0K A;  5C5B A;  2C08 A;  2X3X A;  4DCN C;  2FIC A;  3I2W A;  1ZWW A;  2ELB A;  1Y2O A;  1X03 A;  4AVM A;  3Q84 A;  4BNE A;  4I1Q A;  4ATM A;  2RAJ A;  2Z0V A;  3G9G A;  1URU A;  3SYV A;  4WPC A;  3QWE A;  4FZS A;  3HAI A;  5C5B B;  2X3V A;  2D1L A;  2RAK A;  3ABH A;  3SOG A;  3DYT A;  4H8S A;  3CAZ A;  4NSW A;  1X04 A;  2EFK A;  1I4D A;  2D4C A;  4WPE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...