3QE6A

Mouse pacsin 3 f-bar domain structure
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
290
structure length
283
Chain Sequence
GSFWEAGNYRRTVQRVEDGHRLCGDLVSCFQERARIEKAYAQQLADWARKWRGAVEKGPQYGTLEKAWHAFFTAAERLSELHLEVREKLHGPDSERVRTWQRGAFHRPVLGGFRESRAAEDGFRKAQKPWLKRLKEVEASKKSYHTARKDEKTAQTRESHAQEQLRKLQERVGRCTKEAEKMKTQYEQTLAELNRYTPRYMEDMEQAFESCQAAERQRLLFFKDVLLTLHQHLDLSSSDKFHELHRDLQQSIEAASDEEDLRWWRSTHGPGMAMNWPQFEEWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis
molecule keywords Protein kinase C and casein kinase II substrate protein 3
publication title Rigidity of wedge loop in PACSIN 3 protein is a key factor in dictating diameters of tubules
pubmed doi rcsb
source organism Mus musculus
total genus 117
structure length 283
sequence length 290
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00611 FCH Fes/CIP4, and EFC/F-BAR homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 3qe6A01
3G9GA 3ACOA 5C5BA 1I49A 2ELBA 2Z0VA 4BNEA 3PLTA 4WPCA 5C5BB 2D1LA 3SYVA 2RAIA 1URUA 4FZSA 3DYTA 4NQIA 2FICA 3OK8A 4NSWA 2V0OA 2Q12A 1X04A 4ATMA 2X3VA 3M3WA 2RAJA 3Q84A 2EFKA 2D4CA 2X3XA 4AVMA 2YKTA 2C08A 2Z0OA 1I4DA 2RAKA 1WDZA 3QNIA 2Z0NA 2Q13A 3Q0KA 4DYLA 3LLLA 2X3WA 3QE6A 4WPEA 3ABHA 2EFLA 3CAZA 3QWEA 1I4LA 1X03A 3HAJA 1ZWWA 1I4TA 4AKVA 3HAIA 1Y2OA 4H8SA 3SOGA 4I1QA 3HAHA 4DCNC 3I2WA
chains in the Genus database with same CATH superfamily
4FZPA 4H6HA 3ER9B 1TQTA 3OHXM 4JWCA 3B53X 4EZZA 1ZYLA 1GN9A 2PY6A 3BVVA 3QWEA 3BUBA 1YWMA 3ACOA 4EZYA 3T47A 4WPCA 5C5BB 4HR1B 2PMRA 3EJRA 4AZ6A 2RAJA 4JLCA 2QXLA 3CVRA 4EZRA 4DYLA 1LQ7A 1U00A 5FLEX 4EZSA 3CV5A 3QNJA 4R5KA 2F1BA 2GF4A 3DDGA 1O7DB 4AZBA 3RV1A 1WDZA 1HWWA 1MJGA 2YLAA 3LLLA 2MI7A 5E84A 3G9GA 4M0MA 4EZUA 5FIGA 2YL5A 2RAIA 2LM0A 2GAFD 2RT6A 3BUIA 4JN4A 3T4AG 3CAZA 1I4LA 3I39X 1QWUA 3DX2A 2ELBA 2D1LA 3EJPA 1TQSA 2YKTA 1QWNA 2RAKA 3BVTA 3Q0KA 3BUDA 4WPEA 3HAJA 1QX1A 1SU8A 2KHOA 3PLTA 2Z8YA 2F1AA 3KAVA 4JWIA 3SYVA 4FZSA 2FICA 4IW0A 5KBPA 3Q84A 3QA8A 4EZNA 4AVMA 2ND1A 4JWDA 2YL9A 3QNIA 4AZIA 3D52A 1X03A 3T49A 1ZWWA 3CZNA 3L3PA 3VEBA 3O3OB 1SUFA 2WYHA 2N3KA 4FZOA 4NQIA 2F7QA 2Q12A 3ZEDA 3B52X 4HY9A 2YLLA 2QFFA 2QKWA 1OA1A 4EZWA 1I4TA 2YIVX 2OO2A 3I2WA 2OW7A 1TQUA 1I49A 4EZQA 3EJQA 4EZXA 3D2EA 1TQWA 4HYBA 2X5CA 2X3VA 3OWGA 2EFKA 2X3XA 3D4YA 2X3WA 4JWEA 2JNKA 3C7NA 2YI8A 4BNEA 3B51X 2F7OA 4E3CA 4AZ5A 3CZSA 1URUA 3DX1A 3DDFA 4EZTA 2D4CA 2YI9A 4EZVA 1TQVA 2LXYA 4JL9A 3D4ZA 3DX0A 4AZCA 4DCNC 3LVTA 2OBMA 4IM0A 1W9MA 3BVXA 4UDXX 3BVUA 2ALWA 4NSWA 2F18A 1UPXA 3KAWA 4F00A 4AZ7A 2F7RA 2YIBA 1R33A 2ND0A 3BVWA 3HAIA 4EZOA 3LMFA 3KDRA 3RV0A 3F7WA 3DYTA 4AZGA 4ATMA 4F01A 3T46A 4KIKA 2OW6A 2FYVA 1I4DA 1HTYA 2YIAA 3QE6A 3I04A 4JNFA 4NPHA 1OA0A 4H6IA 2YL8A 3HAHA 3D2FA 4EZPA 3GI7A 4G6QA 4IWPA 4IWOA 1R5EA 1OAOA 3ERCC 3A98A 1PS3A 1DKZA 1SU6A 2GA9D 4FM3A 3M3WA 1DKYA 2C08A 3RPMA 2Z0NA 3DPPA 2EFLA 4AKVA 2F7PA 5TKYA 2OZNB 4I1QA 4E81A 2JNSA 5C5BA 4HR1A 2ZXQA 1X04A 2EWFA 1GNLA 3D50A 1DKXA 4JNEA 2OBLA 2Q13A 3DX4A 3ABHA 3CKDA 2O0I1 2WINM 4IM3A 3T48A 3D51A 4PO2A 3EJSA 3OK8A 4IM2A 3EJTA 4R5GA 3EJUA 3L3OM 4IWQA 4UDYX 3UITA 3ER8C 1R34A 4AZHA 1E2UA 1Y2OA 3VKHA 2Z0VA 4AZCB 2NCZA 3VEAA 3I01A 3DX3A 3O3NB 2V0OA 1SU7A 2WYIA 4R5JA 1E9VA 1HXKA 2EX3B 3BLBA 3DPOA 3FD9A 2YL6A 1O7DC 1JQKA 3BUPA 3BUQA 1GNTA 4R5IA 1E1DA 3DPQA 4KIKB 2Z0OA 4D8JA 3O3MB 4H8SA 3SOGA 4B9QA 4R5LA
chains in the Genus database with same CATH topology
3G9GA 3ACOA 5C5BA 1I49A 2ELBA 2Z0VA 4BNEA 3PLTA 4WPCA 5C5BB 2D1LA 3SYVA 2RAIA 1URUA 4FZSA 3DYTA 4NQIA 2FICA 3OK8A 4NSWA 2V0OA 2Q12A 1X04A 4ATMA 2X3VA 3M3WA 2RAJA 3Q84A 2EFKA 2D4CA 2X3XA 4AVMA 2YKTA 2C08A 2Z0OA 1I4DA 2RAKA 1WDZA 3QNIA 2Z0NA 2Q13A 3Q0KA 4DYLA 3LLLA 2X3WA 3QE6A 4WPEA 3ABHA 2EFLA 3CAZA 3QWEA 1I4LA 1X03A 3HAJA 1ZWWA 1I4TA 4AKVA 3HAIA 1Y2OA 4H8SA 3SOGA 4I1QA 3HAHA 4DCNC 3I2WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G9G A;  3ACO A;  5C5B A;  1I49 A;  2ELB A;  2Z0V A;  4BNE A;  3PLT A;  4WPC A;  5C5B B;  2D1L A;  3SYV A;  2RAI A;  1URU A;  4FZS A;  3DYT A;  4NQI A;  2FIC A;  3OK8 A;  4NSW A;  2V0O A;  2Q12 A;  1X04 A;  4ATM A;  2X3V A;  3M3W A;  2RAJ A;  3Q84 A;  2EFK A;  2D4C A;  2X3X A;  4AVM A;  2YKT A;  2C08 A;  2Z0O A;  1I4D A;  2RAK A;  1WDZ A;  3QNI A;  2Z0N A;  2Q13 A;  3Q0K A;  4DYL A;  3LLL A;  2X3W A;  3QE6 A;  4WPE A;  3ABH A;  2EFL A;  3CAZ A;  3QWE A;  1I4L A;  1X03 A;  3HAJ A;  1ZWW A;  1I4T A;  4AKV A;  3HAI A;  1Y2O A;  4H8S A;  3SOG A;  4I1Q A;  3HAH A;  4DCN C;  3I2W A; 
#chains in the Genus database with same CATH topology
 4FZP A;  4H6H A;  3ER9 B;  1TQT A;  3OHX M;  4JWC A;  3B53 X;  4EZZ A;  1ZYL A;  1GN9 A;  2PY6 A;  3BVV A;  3QWE A;  3BUB A;  1YWM A;  3ACO A;  4EZY A;  3T47 A;  4WPC A;  5C5B B;  4HR1 B;  2PMR A;  3EJR A;  4AZ6 A;  2RAJ A;  4JLC A;  2QXL A;  3CVR A;  4EZR A;  4DYL A;  1LQ7 A;  1U00 A;  5FLE X;  4EZS A;  3CV5 A;  3QNJ A;  4R5K A;  2F1B A;  2GF4 A;  3DDG A;  1O7D B;  4AZB A;  3RV1 A;  1WDZ A;  1HWW A;  1MJG A;  2YLA A;  3LLL A;  2MI7 A;  5E84 A;  3G9G A;  4M0M A;  4EZU A;  5FIG A;  2YL5 A;  2RAI A;  2LM0 A;  2GAF D;  2RT6 A;  3BUI A;  4JN4 A;  3T4A G;  3CAZ A;  1I4L A;  3I39 X;  1QWU A;  3DX2 A;  2ELB A;  2D1L A;  3EJP A;  1TQS A;  2YKT A;  1QWN A;  2RAK A;  3BVT A;  3Q0K A;  3BUD A;  4WPE A;  3HAJ A;  1QX1 A;  1SU8 A;  2KHO A;  3PLT A;  2Z8Y A;  2F1A A;  3KAV A;  4JWI A;  3SYV A;  4FZS A;  2FIC A;  4IW0 A;  5KBP A;  3Q84 A;  3QA8 A;  4EZN A;  4AVM A;  2ND1 A;  4JWD A;  2YL9 A;  3QNI A;  4AZI A;  3D52 A;  1X03 A;  3T49 A;  1ZWW A;  3CZN A;  3L3P A;  3VEB A;  3O3O B;  1SUF A;  2WYH A;  2N3K A;  4FZO A;  4NQI A;  2F7Q A;  2Q12 A;  3ZED A;  3B52 X;  4HY9 A;  2YLL A;  2QFF A;  2QKW A;  1OA1 A;  4EZW A;  1I4T A;  2YIV X;  2OO2 A;  3I2W A;  2OW7 A;  1TQU A;  1I49 A;  4EZQ A;  3EJQ A;  4EZX A;  3D2E A;  1TQW A;  4HYB A;  2X5C A;  2X3V A;  3OWG A;  2EFK A;  2X3X A;  3D4Y A;  2X3W A;  4JWE A;  2JNK A;  3C7N A;  2YI8 A;  4BNE A;  3B51 X;  2F7O A;  4E3C A;  4AZ5 A;  3CZS A;  1URU A;  3DX1 A;  3DDF A;  4EZT A;  2D4C A;  2YI9 A;  4EZV A;  1TQV A;  2LXY A;  4JL9 A;  3D4Z A;  3DX0 A;  4AZC A;  4DCN C;  3LVT A;  2OBM A;  4IM0 A;  1W9M A;  3BVX A;  4UDX X;  3BVU A;  2ALW A;  4NSW A;  2F18 A;  1UPX A;  3KAW A;  4F00 A;  4AZ7 A;  2F7R A;  2YIB A;  1R33 A;  2ND0 A;  3BVW A;  3HAI A;  4EZO A;  3LMF A;  3KDR A;  3RV0 A;  3F7W A;  3DYT A;  4AZG A;  4ATM A;  4F01 A;  3T46 A;  4KIK A;  2OW6 A;  2FYV A;  1I4D A;  1HTY A;  2YIA A;  3QE6 A;  3I04 A;  4JNF A;  4NPH A;  1OA0 A;  4H6I A;  2YL8 A;  3HAH A;  3D2F A;  4EZP A;  3GI7 A;  4G6Q A;  4IWP A;  4IWO A;  1R5E A;  1OAO A;  3ERC C;  3A98 A;  1PS3 A;  1DKZ A;  1SU6 A;  2GA9 D;  4FM3 A;  3M3W A;  1DKY A;  2C08 A;  3RPM A;  2Z0N A;  3DPP A;  2EFL A;  4AKV A;  2F7P A;  5TKY A;  2OZN B;  4I1Q A;  4E81 A;  2JNS A;  5C5B A;  4HR1 A;  2ZXQ A;  1X04 A;  2EWF A;  1GNL A;  3D50 A;  1DKX A;  4JNE A;  2OBL A;  2Q13 A;  3DX4 A;  3ABH A;  3CKD A;  2O0I 1;  2WIN M;  4IM3 A;  3T48 A;  3D51 A;  4PO2 A;  3EJS A;  3OK8 A;  4IM2 A;  3EJT A;  4R5G A;  3EJU A;  3L3O M;  4IWQ A;  4UDY X;  3UIT A;  3ER8 C;  1R34 A;  4AZH A;  1E2U A;  1Y2O A;  3VKH A;  2Z0V A;  4AZC B;  2NCZ A;  3VEA A;  3I01 A;  3DX3 A;  3O3N B;  2V0O A;  1SU7 A;  2WYI A;  4R5J A;  1E9V A;  1HXK A;  2EX3 B;  3BLB A;  3DPO A;  3FD9 A;  2YL6 A;  1O7D C;  1JQK A;  3BUP A;  3BUQ A;  1GNT A;  4R5I A;  1E1D A;  3DPQ A;  4KIK B;  2Z0O A;  4D8J A;  3O3M B;  4H8S A;  3SOG A;  4B9Q A;  4R5L A; 
#chains in the Genus database with same CATH homology
 3G9G A;  3ACO A;  5C5B A;  1I49 A;  2ELB A;  2Z0V A;  4BNE A;  3PLT A;  4WPC A;  5C5B B;  2D1L A;  3SYV A;  2RAI A;  1URU A;  4FZS A;  3DYT A;  4NQI A;  2FIC A;  3OK8 A;  4NSW A;  2V0O A;  2Q12 A;  1X04 A;  4ATM A;  2X3V A;  3M3W A;  2RAJ A;  3Q84 A;  2EFK A;  2D4C A;  2X3X A;  4AVM A;  2YKT A;  2C08 A;  2Z0O A;  1I4D A;  2RAK A;  1WDZ A;  3QNI A;  2Z0N A;  2Q13 A;  3Q0K A;  4DYL A;  3LLL A;  2X3W A;  3QE6 A;  4WPE A;  3ABH A;  2EFL A;  3CAZ A;  3QWE A;  1I4L A;  1X03 A;  3HAJ A;  1ZWW A;  1I4T A;  4AKV A;  3HAI A;  1Y2O A;  4H8S A;  3SOG A;  4I1Q A;  3HAH A;  4DCN C;  3I2W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...