3T49A

Crystal structure of truncated form of staphylococcal complement inhibitor b (scin-b) at 1.5 angstrom
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
70
structure length
70
Chain Sequence
GSAEELRTLLNKSNVYALAAGSLNPYYKRTIMMNEYRAKAALKKNDFVSMADAKVALEKIYKEIDEIINR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fibrinogen-binding protein
publication title Diversity in the C3b Convertase Contact Residues and Tertiary Structures of the Staphylococcal Complement Inhibitor (SCIN) Protein Family.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 29
structure length 70
sequence length 70
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3t49A00
4JNFA 3T48A 4R5GA 1DKZA 4JNEA 2KHOA 4F01A 4R5IA 4HYBA 4B9QA 4EZQA 4EZWA 3L3OM 4EZOA 2QFFA 4EZZA 3DPQA 4R5KA 4JWCA 4F00A 3OHXM 1DKYA 3D2EA 4JWIA 4H6HA 4EZNA 4R5JA 3C7NA 4JWEA 4EZSA 3DPOA 4EZPA 3QNJA 4EZYA 4JWDA 4R5LA 4EZXA 2WINM 4EZVA 4H6IA 4EZRA 2QXLA 3D2FA 4EZTA 4JN4A 3T46A 1U00A 3T4AG 4EZUA 3DPPA 3T47A 4PO2A 4HY9A 4E81A 5E84A 3T49A 5TKYA 1DKXA
chains in the Genus database with same CATH superfamily
3DDFA 3VEBA 1DKZA 4UDXX 3QNIA 4EZWA 4AKVA 1SU6A 1TQVA 2YKTA 2D1LA 3CKDA 4EZNA 2ZXQA 4JWDA 2GAFD 4EZRA 2QXLA 2X3XA 3F7WA 2LXYA 3DDGA 4JNFA 2YIAA 4R5GA 2ND0A 4BNEA 1W9MA 2MI7A 1PS3A 4JLCA 4F00A 2YIVX 1MJGA 1ZYLA 2Q13A 1X04A 3DX1A 2WINM 3I01A 3O3MB 2D4CA 2EFKA 4HR1B 3T49A 2OBMA 2F1AA 2OZNB 4DYLA 3OK8A 3L3OM 4IM0A 3DPQA 3I39X 4JWCA 4H6HA 2PY6A 1GN9A 2JNKA 2YL8A 1E9VA 2C08A 2YL5A 4PO2A 3GI7A 2QKWA 2YI8A 2KHOA 3D52A 3BUDA 4FZOA 2OW7A 2EFLA 2OW6A 3B53X 2Z8YA 2EWFA 2Q12A 4EZYA 1SUFA 4AZIA 2GF4A 4IM3A 3BLBA 4WPCA 4JNEA 2X3VA 1QX1A 2FYVA 4I1QA 4JWIA 4R5JA 4IW0A 3CV5A 3QNJA 4IM2A 2WYIA 3OWGA 4HR1A 4H6IA 2LM0A 4JN4A 3KAWA 4H8SA 4R5IA 4G6QA 2QFFA 3C7NA 3HAJA 3LLLA 3I04A 2YL6A 2Z0NA 4NPHA 3T46A 3SYVA 4AZCB 1QWNA 2RAJA 2ELBA 2OBLA 3D50A 3EJUA 2RAKA 4EZZA 1I4LA 4EZPA 2YIBA 3CAZA 4FM3A 1TQWA 1WDZA 4WPEA 3LVTA 1URUA 3B51X 3BVUA 3SOGA 3BVTA 4AZBA 1TQSA 1JQKA 4AZHA 2Z0VA 2F1BA 4JWEA 1I4DA 4KIKB 3QA8A 3ZEDA 1I4TA 4EZVA 3QE6A 1YWMA 3T4AG 3ERCC 1E1DA 3VEAA 2NCZA 3QWEA 4R5KA 3BVVA 1SU8A 2ALWA 4AZ5A 4D8JA 2N3KA 4IWPA 4AZCA 3BVXA 1QWUA 3EJQA 4HY9A 1I49A 5E84A 5KBPA 5FLEX 3RPMA 2EX3B 2PMRA 3EJRA 1ZWWA 1Y2OA 2X3WA 3L3PA 3BUQA 3DYTA 3G9GA 1OA0A 4R5LA 2F18A 1TQTA 4IWOA 3O3OB 3VKHA 1UPXA 2X5CA 4DCNC 3BUIA 3RV0A 5C5BB 4KIKA 3BVWA 4AZ7A 4EZSA 3ACOA 4ATMA 1OA1A 3I2WA 2WYHA 3BUBA 2JNSA 3M3WA 4AZGA 3Q84A 4FZPA 1HTYA 2YL9A 4E3CA 2F7RA 2RT6A 2Z0OA 3DPOA 2FICA 4NSWA 1R34A 2OO2A 4EZTA 1U00A 3KAVA 5FIGA 4NQIA 5TKYA 1DKXA 2RAIA 1HWWA 3CZNA 4B9QA 4AZ6A 3LMFA 1E2UA 4JL9A 3EJSA 3DX3A 3HAHA 1HXKA 4FZSA 4AVMA 3DX0A 4EZUA 2ND1A 1SU7A 4UDYX 3ER8C 5C5BA 2YLAA 1R5EA 3ABHA 3B52X 4EZQA 1OAOA 3DX2A 2V0OA 3Q0KA 3D2EA 3HAIA 1TQUA 3CZSA 3DX4A 4EZXA 3EJTA 3EJPA 2O0I1 3D4ZA 3ER9B 3D2FA 1GNLA 2YI9A 4E81A 1O7DB 2F7OA 3BUPA 3KDRA 3A98A 1DKYA 3UITA 2YLLA 3O3NB 3CVRA 2GA9D 3T48A 2F7PA 4F01A 4HYBA 1O7DC 4EZOA 3FD9A 4IWQA 3RV1A 2F7QA 3OHXM 3D51A 1GNTA 4M0MA 1LQ7A 3D4YA 1R33A 3DPPA 3PLTA 3T47A 1X03A
chains in the Genus database with same CATH topology
3VEBA 1DKZA 4JNEA 4UDXX 1E1DA 3VEAA 4B9QA 3ERCC 4EZWA 2NCZA 1SU6A 1E2UA 3LMFA 4R5KA 4JWIA 4EZNA 4JL9A 4R5JA 1SU8A 4IW0A 3QNJA 4JWDA 4IM2A 3OWGA 4D8JA 2N3KA 2GAFD 4HR1A 4H6IA 4IWPA 4EZRA 2QXLA 2LM0A 4JN4A 4EZUA 2ND1A 3KAWA 3F7WA 4HY9A 1SU7A 5E84A 4UDYX 3ER8C 4JNFA 2YIAA 4R5GA 2ND0A 5FLEX 1W9MA 4R5IA 2EX3B 3B52X 4G6QA 4EZQA 2QFFA 4JLCA 1OAOA 4F00A 2YIVX 3D2EA 3C7NA 1MJGA 1ZYLA 1OA0A 4R5LA 4EZXA 2WINM 4IWOA 3O3OB 3I01A 3VKHA 3I04A 3ER9B 3D2FA 4NPHA 3O3MB 3T46A 1GNLA 4HR1B 1UPXA 2X5CA 2YI9A 4E81A 3T49A 2OBMA 2OBLA 3RV0A 3L3OM 4IM0A 3KDRA 4EZZA 3DPQA 3A98A 3I39X 4JWCA 4KIKA 1DKYA 4H6HA 3UITA 4EZSA 3O3NB 4EZPA 1OA1A 2PY6A 2YIBA 2GA9D 1GN9A 4FM3A 1E9VA 2JNSA 4PO2A 3B51X 3GI7A 2YI8A 3T48A 4F01A 2KHOA 4HYBA 1JQKA 4EZOA 3FD9A 4IWQA 4E3CA 3RV1A 3OHXM 1GNTA 2RT6A 4JWEA 3DPOA 3B53X 2Z8YA 2EWFA 4KIKB 4EZYA 3QA8A 4M0MA 1SUFA 3ZEDA 4EZVA 4EZTA 4IM3A 1U00A 3T4AG 3KAVA 3DPPA 5FIGA 3T47A 5TKYA 1DKXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JNF A;  3T48 A;  4R5G A;  1DKZ A;  4JNE A;  2KHO A;  4F01 A;  4R5I A;  4HYB A;  4B9Q A;  4EZQ A;  4EZW A;  3L3O M;  4EZO A;  2QFF A;  4EZZ A;  3DPQ A;  4R5K A;  4JWC A;  4F00 A;  3OHX M;  1DKY A;  3D2E A;  4JWI A;  4H6H A;  4EZN A;  4R5J A;  3C7N A;  4JWE A;  4EZS A;  3DPO A;  4EZP A;  3QNJ A;  4EZY A;  4JWD A;  4R5L A;  4EZX A;  2WIN M;  4EZV A;  4H6I A;  4EZR A;  2QXL A;  3D2F A;  4EZT A;  4JN4 A;  3T46 A;  1U00 A;  3T4A G;  4EZU A;  3DPP A;  3T47 A;  4PO2 A;  4HY9 A;  4E81 A;  5E84 A;  3T49 A;  5TKY A;  1DKX A; 
#chains in the Genus database with same CATH topology
 3DDF A;  3VEB A;  1DKZ A;  4UDX X;  3QNI A;  4EZW A;  4AKV A;  1SU6 A;  1TQV A;  2YKT A;  2D1L A;  3CKD A;  4EZN A;  2ZXQ A;  4JWD A;  2GAF D;  4EZR A;  2QXL A;  2X3X A;  3F7W A;  2LXY A;  3DDG A;  4JNF A;  2YIA A;  4R5G A;  2ND0 A;  4BNE A;  1W9M A;  2MI7 A;  1PS3 A;  4JLC A;  4F00 A;  2YIV X;  1MJG A;  1ZYL A;  2Q13 A;  1X04 A;  3DX1 A;  2WIN M;  3I01 A;  3O3M B;  2D4C A;  2EFK A;  4HR1 B;  3T49 A;  2OBM A;  2F1A A;  2OZN B;  4DYL A;  3OK8 A;  3L3O M;  4IM0 A;  3DPQ A;  3I39 X;  4JWC A;  4H6H A;  2PY6 A;  1GN9 A;  2JNK A;  2YL8 A;  1E9V A;  2C08 A;  2YL5 A;  4PO2 A;  3GI7 A;  2QKW A;  2YI8 A;  2KHO A;  3D52 A;  3BUD A;  4FZO A;  2OW7 A;  2EFL A;  2OW6 A;  3B53 X;  2Z8Y A;  2EWF A;  2Q12 A;  4EZY A;  1SUF A;  4AZI A;  2GF4 A;  4IM3 A;  3BLB A;  4WPC A;  4JNE A;  2X3V A;  1QX1 A;  2FYV A;  4I1Q A;  4JWI A;  4R5J A;  4IW0 A;  3CV5 A;  3QNJ A;  4IM2 A;  2WYI A;  3OWG A;  4HR1 A;  4H6I A;  2LM0 A;  4JN4 A;  3KAW A;  4H8S A;  4R5I A;  4G6Q A;  2QFF A;  3C7N A;  3HAJ A;  3LLL A;  3I04 A;  2YL6 A;  2Z0N A;  4NPH A;  3T46 A;  3SYV A;  4AZC B;  1QWN A;  2RAJ A;  2ELB A;  2OBL A;  3D50 A;  3EJU A;  2RAK A;  4EZZ A;  1I4L A;  4EZP A;  2YIB A;  3CAZ A;  4FM3 A;  1TQW A;  1WDZ A;  4WPE A;  3LVT A;  1URU A;  3B51 X;  3BVU A;  3SOG A;  3BVT A;  4AZB A;  1TQS A;  1JQK A;  4AZH A;  2Z0V A;  2F1B A;  4JWE A;  1I4D A;  4KIK B;  3QA8 A;  3ZED A;  1I4T A;  4EZV A;  3QE6 A;  1YWM A;  3T4A G;  3ERC C;  1E1D A;  3VEA A;  2NCZ A;  3QWE A;  4R5K A;  3BVV A;  1SU8 A;  2ALW A;  4AZ5 A;  4D8J A;  2N3K A;  4IWP A;  4AZC A;  3BVX A;  1QWU A;  3EJQ A;  4HY9 A;  1I49 A;  5E84 A;  5KBP A;  5FLE X;  3RPM A;  2EX3 B;  2PMR A;  3EJR A;  1ZWW A;  1Y2O A;  2X3W A;  3L3P A;  3BUQ A;  3DYT A;  3G9G A;  1OA0 A;  4R5L A;  2F18 A;  1TQT A;  4IWO A;  3O3O B;  3VKH A;  1UPX A;  2X5C A;  4DCN C;  3BUI A;  3RV0 A;  5C5B B;  4KIK A;  3BVW A;  4AZ7 A;  4EZS A;  3ACO A;  4ATM A;  1OA1 A;  3I2W A;  2WYH A;  3BUB A;  2JNS A;  3M3W A;  4AZG A;  3Q84 A;  4FZP A;  1HTY A;  2YL9 A;  4E3C A;  2F7R A;  2RT6 A;  2Z0O A;  3DPO A;  2FIC A;  4NSW A;  1R34 A;  2OO2 A;  4EZT A;  1U00 A;  3KAV A;  5FIG A;  4NQI A;  5TKY A;  1DKX A;  2RAI A;  1HWW A;  3CZN A;  4B9Q A;  4AZ6 A;  3LMF A;  1E2U A;  4JL9 A;  3EJS A;  3DX3 A;  3HAH A;  1HXK A;  4FZS A;  4AVM A;  3DX0 A;  4EZU A;  2ND1 A;  1SU7 A;  4UDY X;  3ER8 C;  5C5B A;  2YLA A;  1R5E A;  3ABH A;  3B52 X;  4EZQ A;  1OAO A;  3DX2 A;  2V0O A;  3Q0K A;  3D2E A;  3HAI A;  1TQU A;  3CZS A;  3DX4 A;  4EZX A;  3EJT A;  3EJP A;  2O0I 1;  3D4Z A;  3ER9 B;  3D2F A;  1GNL A;  2YI9 A;  4E81 A;  1O7D B;  2F7O A;  3BUP A;  3KDR A;  3A98 A;  1DKY A;  3UIT A;  2YLL A;  3O3N B;  3CVR A;  2GA9 D;  3T48 A;  2F7P A;  4F01 A;  4HYB A;  1O7D C;  4EZO A;  3FD9 A;  4IWQ A;  3RV1 A;  2F7Q A;  3OHX M;  3D51 A;  1GNT A;  4M0M A;  1LQ7 A;  3D4Y A;  1R33 A;  3DPP A;  3PLT A;  3T47 A;  1X03 A; 
#chains in the Genus database with same CATH homology
 3VEB A;  1DKZ A;  4JNE A;  4UDX X;  1E1D A;  3VEA A;  4B9Q A;  3ERC C;  4EZW A;  2NCZ A;  1SU6 A;  1E2U A;  3LMF A;  4R5K A;  4JWI A;  4EZN A;  4JL9 A;  4R5J A;  1SU8 A;  4IW0 A;  3QNJ A;  4JWD A;  4IM2 A;  3OWG A;  4D8J A;  2N3K A;  2GAF D;  4HR1 A;  4H6I A;  4IWP A;  4EZR A;  2QXL A;  2LM0 A;  4JN4 A;  4EZU A;  2ND1 A;  3KAW A;  3F7W A;  4HY9 A;  1SU7 A;  5E84 A;  4UDY X;  3ER8 C;  4JNF A;  2YIA A;  4R5G A;  2ND0 A;  5FLE X;  1W9M A;  4R5I A;  2EX3 B;  3B52 X;  4G6Q A;  4EZQ A;  2QFF A;  4JLC A;  1OAO A;  4F00 A;  2YIV X;  3D2E A;  3C7N A;  1MJG A;  1ZYL A;  1OA0 A;  4R5L A;  4EZX A;  2WIN M;  4IWO A;  3O3O B;  3I01 A;  3VKH A;  3I04 A;  3ER9 B;  3D2F A;  4NPH A;  3O3M B;  3T46 A;  1GNL A;  4HR1 B;  1UPX A;  2X5C A;  2YI9 A;  4E81 A;  3T49 A;  2OBM A;  2OBL A;  3RV0 A;  3L3O M;  4IM0 A;  3KDR A;  4EZZ A;  3DPQ A;  3A98 A;  3I39 X;  4JWC A;  4KIK A;  1DKY A;  4H6H A;  3UIT A;  4EZS A;  3O3N B;  4EZP A;  1OA1 A;  2PY6 A;  2YIB A;  2GA9 D;  1GN9 A;  4FM3 A;  1E9V A;  2JNS A;  4PO2 A;  3B51 X;  3GI7 A;  2YI8 A;  3T48 A;  4F01 A;  2KHO A;  4HYB A;  1JQK A;  4EZO A;  3FD9 A;  4IWQ A;  4E3C A;  3RV1 A;  3OHX M;  1GNT A;  2RT6 A;  4JWE A;  3DPO A;  3B53 X;  2Z8Y A;  2EWF A;  4KIK B;  4EZY A;  3QA8 A;  4M0M A;  1SUF A;  3ZED A;  4EZV A;  4EZT A;  4IM3 A;  1U00 A;  3T4A G;  3KAV A;  3DPP A;  5FIG A;  3T47 A;  5TKY A;  1DKX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...