3T49A

Crystal structure of truncated form of staphylococcal complement inhibitor b (scin-b) at 1.5 angstrom
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
70
structure length
70
Chain Sequence
GSAEELRTLLNKSNVYALAAGSLNPYYKRTIMMNEYRAKAALKKNDFVSMADAKVALEKIYKEIDEIINR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrinogen-binding protein
publication title Diversity in the C3b Convertase Contact Residues and Tertiary Structures of the Staphylococcal Complement Inhibitor (SCIN) Protein Family.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Immune system
total genus 29
structure length 70
sequence length 70
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3t49A00
4JWDA 4F01A 2WINM 3D2FA 4B9QA 5TKYA 4EZQA 4JWEA 4R5GA 4EZSA 4PO2A 3DPOA 3D2EA 4H6IA 4JN4A 3L3OM 4EZUA 3C7NA 4EZTA 4EZWA 4H6HA 4JNFA 4EZPA 3T48A 4EZOA 4EZYA 4R5JA 4HY9A 4EZNA 3DPQA 4JWIA 4R5LA 2KHOA 1DKYA 4HYBA 5E84A 1DKXA 3T49A 4EZRA 4EZVA 4R5KA 3T46A 4E81A 4JWCA 3DPPA 4EZXA 4JNEA 4R5IA 2QFFA 3T4AG 1DKZA 4F00A 3QNJA 1U00A 2QXLA 4EZZA 3T47A 3OHXM
chains in the Genus database with same CATH superfamily
4JWDA 4F01A 1O7DC 4EZSA 3GI7A 1ZYLA 2Z0NA 4FM3A 2F18A 1GNTA 1TQUA 4FZPA 3D51A 4HYBA 4UDYX 2X5CA 4E81A 1TQWA 4HR1B 2GAFD 4ATMA 2WINM 1R5EA 2RAKA 2F7RA 1UPXA 4AZCB 1TQTA 1SU8A 2RT6A 4AVMA 1DKYA 2KHOA 2QFFA 3QNIA 3G9GA 3SYVA 3LMFA 3CZSA 4JLCA 3LVTA 3HAHA 3ZEDA 3DPOA 2C08A 1OA1A 1HXKA 3CV5A 3T48A 4EZYA 2O0I1 4DCNC 4AZ6A 3D52A 3LLLA 4AKVA 4R5KA 3EJUA 4WPEA 4R5GA 4PO2A 3D2EA 4JN4A 4JNFA 3ER8C 3RPMA 4AZGA 3ABHA 3EJQA 2PY6A 2PMRA 4R5LA 1SU6A 4JWCA 4IWQA 3RV0A 3PLTA 3BVUA 3DDGA 4FZSA 3I01A 2V0OA 2YLAA 2QKWA 1E1DA 3T46A 2OBMA 2YIBA 4IM3A 1R34A 3DX0A 3VEBA 1E2UA 2EFLA 3O3NB 2YIAA 4EZTA 1GN9A 4UDXX 3BVTA 4KIKA 3ACOA 3BUPA 5FIGA 2OW6A 4IM0A 3EJSA 5C5BA 4JNEA 1LQ7A 1X03A 3QNJA 2LM0A 3VKHA 2GA9D 4WPCA 1URUA 2Q12A 3L3PA 2OBLA 4EZNA 3DPQA 3O3MB 4JL9A 3SOGA 1R33A 2JNKA 3EJTA 1DKZA 1QX1A 2YI8A 5KBPA 2YLLA 2F7QA 2X3VA 3FD9A 1MJGA 4H8SA 3C7NA 2D4CA 2EX3B 2OO2A 1TQSA 5FLEX 4BNEA 2Q13A 4KIKB 2FICA 3O3OB 5E84A 3ERCC 2F7OA 3QA8A 3BLBA 3RV1A 4NPHA 4F00A 2YKTA 3OHXM 3OK8A 4AZ7A 4EZPA 2LXYA 2YL9A 4AZIA 4NSWA 1DKXA 2OW7A 3KAWA 2F7PA 2Z0VA 3CKDA 3DX1A 2EWFA 4IWPA 2MI7A 1SUFA 1SU7A 4EZWA 4H6HA 1I4LA 4I1QA 4HR1A 3BVXA 4IWOA 2RAJA 1Y2OA 1E9VA 1OA0A 2YI9A 4FZOA 1U00A 1O7DB 3ER9B 4AZCA 2RAIA 3BUIA 4B9QA 4AZHA 4H6IA 3L3OM 4G6QA 3DX2A 2X3XA 3D4ZA 1TQVA 3QWEA 2D1LA 2Z0OA 2YL8A 3B51X 3B52X 1GNLA 2YIVX 5TKYA 4EZQA 2FYVA 3Q0KA 2F1AA 3BUQA 3CAZA 2OZNB 3CVRA 1I4TA 1I49A 1JQKA 3T49A 3BVVA 3DX4A 3DX3A 2JNSA 2F1BA 1WDZA 1HWWA 1PS3A 3M3WA 2EFKA 4DYLA 2ELBA 4EZUA 1ZWWA 2X3WA 3D50A 1QWUA 2NCZA 3I04A 2YL5A 2GF4A 3UITA 2N3KA 4EZZA 5C5BB 3F7WA 2WYHA 3CZNA 2WYIA 3DYTA 3I39X 1HTYA 4NQIA 1QWNA 1X04A 3D4YA 4E3CA 3Q84A 4JWIA 4EZVA 3BVWA 3DPPA 3HAIA 3DDFA 3B53X 4M0MA 3BUBA 3T47A 3QE6A 3BUDA 2ND1A 1I4DA 4EZOA 1OAOA 2ALWA 4HY9A 4AZ5A 2ZXQA 1YWMA 4EZXA 4IW0A 3HAJA 3T4AG 3EJPA 4IM2A 2Z8YA 3D2FA 4JWEA 3VEAA 2YL6A 3KDRA 3KAVA 4AZBA 1W9MA 3EJRA 4R5JA 3I2WA 3A98A 4EZRA 4D8JA 4R5IA 2ND0A 3OWGA 2QXLA
chains in the Genus database with same CATH topology
4JWDA 4F01A 4EZSA 4EZUA 3I01A 3GI7A 1ZYLA 4EZPA 4FM3A 1GNTA 4HYBA 1DKXA 4UDYX 2X5CA 2NCZA 1E1DA 3I04A 3T46A 4E81A 2OBMA 2YIBA 3KAWA 4HR1B 3UITA 4IM3A 2N3KA 4EZZA 2GAFD 3F7WA 2EWFA 4IWPA 2WINM 3VEBA 1SUFA 1E2UA 3I39X 1UPXA 1SU7A 3O3NB 2YIAA 4EZTA 4EZWA 1GN9A 4H6HA 4UDXX 4KIKA 1SU8A 5FIGA 2RT6A 4E3CA 4JWIA 4HR1A 4IWOA 4IM0A 1DKYA 2KHOA 1E9VA 4EZVA 1OA0A 3DPPA 2YI9A 4JNEA 2QFFA 3B53X 3QNJA 1U00A 4M0MA 3T47A 3ER9B 2LM0A 3LMFA 2ND1A 4B9QA 4JLCA 3ZEDA 3VKHA 3DPOA 4H6IA 2GA9D 3L3OM 4G6QA 1OA1A 3T48A 4EZOA 4EZYA 1OAOA 2OBLA 4HY9A 4EZNA 3DPQA 3O3MB 4JL9A 4R5KA 4EZXA 4IW0A 3T4AG 1DKZA 2YI8A 3B51X 4IM2A 3B52X 2Z8YA 1GNLA 3D2FA 3FD9A 2YIVX 5TKYA 4EZQA 1MJGA 4JWEA 4R5GA 4PO2A 3VEAA 3D2EA 4JN4A 3C7NA 4JNFA 3KDRA 3ER8C 3KAVA 2EX3B 1W9MA 5FLEX 4R5JA 1JQKA 2PY6A 4KIKB 3O3OB 4R5LA 3A98A 5E84A 3T49A 3ERCC 4EZRA 1SU6A 4JWCA 4D8JA 4IWQA 3QA8A 3RV0A 4R5IA 3RV1A 4NPHA 2ND0A 3OWGA 4F00A 2QXLA 2JNSA 3OHXM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JWD A;  4F01 A;  2WIN M;  3D2F A;  4B9Q A;  5TKY A;  4EZQ A;  4JWE A;  4R5G A;  4EZS A;  4PO2 A;  3DPO A;  3D2E A;  4H6I A;  4JN4 A;  3L3O M;  4EZU A;  3C7N A;  4EZT A;  4EZW A;  4H6H A;  4JNF A;  4EZP A;  3T48 A;  4EZO A;  4EZY A;  4R5J A;  4HY9 A;  4EZN A;  3DPQ A;  4JWI A;  4R5L A;  2KHO A;  1DKY A;  4HYB A;  5E84 A;  1DKX A;  3T49 A;  4EZR A;  4EZV A;  4R5K A;  3T46 A;  4E81 A;  4JWC A;  3DPP A;  4EZX A;  4JNE A;  4R5I A;  2QFF A;  3T4A G;  1DKZ A;  4F00 A;  3QNJ A;  1U00 A;  2QXL A;  4EZZ A;  3T47 A;  3OHX M; 
#chains in the Genus database with same CATH topology
 4JWD A;  4F01 A;  1O7D C;  4EZS A;  3GI7 A;  1ZYL A;  2Z0N A;  4FM3 A;  2F18 A;  1GNT A;  1TQU A;  4FZP A;  3D51 A;  4HYB A;  4UDY X;  2X5C A;  4E81 A;  1TQW A;  4HR1 B;  2GAF D;  4ATM A;  2WIN M;  1R5E A;  2RAK A;  2F7R A;  1UPX A;  4AZC B;  1TQT A;  1SU8 A;  2RT6 A;  4AVM A;  1DKY A;  2KHO A;  2QFF A;  3QNI A;  3G9G A;  3SYV A;  3LMF A;  3CZS A;  4JLC A;  3LVT A;  3HAH A;  3ZED A;  3DPO A;  2C08 A;  1OA1 A;  1HXK A;  3CV5 A;  3T48 A;  4EZY A;  2O0I 1;  4DCN C;  4AZ6 A;  3D52 A;  3LLL A;  4AKV A;  4R5K A;  3EJU A;  4WPE A;  4R5G A;  4PO2 A;  3D2E A;  4JN4 A;  4JNF A;  3ER8 C;  3RPM A;  4AZG A;  3ABH A;  3EJQ A;  2PY6 A;  2PMR A;  4R5L A;  1SU6 A;  4JWC A;  4IWQ A;  3RV0 A;  3PLT A;  3BVU A;  3DDG A;  4FZS A;  3I01 A;  2V0O A;  2YLA A;  2QKW A;  1E1D A;  3T46 A;  2OBM A;  2YIB A;  4IM3 A;  1R34 A;  3DX0 A;  3VEB A;  1E2U A;  2EFL A;  3O3N B;  2YIA A;  4EZT A;  1GN9 A;  4UDX X;  3BVT A;  4KIK A;  3ACO A;  3BUP A;  5FIG A;  2OW6 A;  4IM0 A;  3EJS A;  5C5B A;  4JNE A;  1LQ7 A;  1X03 A;  3QNJ A;  2LM0 A;  3VKH A;  2GA9 D;  4WPC A;  1URU A;  2Q12 A;  3L3P A;  2OBL A;  4EZN A;  3DPQ A;  3O3M B;  4JL9 A;  3SOG A;  1R33 A;  2JNK A;  3EJT A;  1DKZ A;  1QX1 A;  2YI8 A;  5KBP A;  2YLL A;  2F7Q A;  2X3V A;  3FD9 A;  1MJG A;  4H8S A;  3C7N A;  2D4C A;  2EX3 B;  2OO2 A;  1TQS A;  5FLE X;  4BNE A;  2Q13 A;  4KIK B;  2FIC A;  3O3O B;  5E84 A;  3ERC C;  2F7O A;  3QA8 A;  3BLB A;  3RV1 A;  4NPH A;  4F00 A;  2YKT A;  3OHX M;  3OK8 A;  4AZ7 A;  4EZP A;  2LXY A;  2YL9 A;  4AZI A;  4NSW A;  1DKX A;  2OW7 A;  3KAW A;  2F7P A;  2Z0V A;  3CKD A;  3DX1 A;  2EWF A;  4IWP A;  2MI7 A;  1SUF A;  1SU7 A;  4EZW A;  4H6H A;  1I4L A;  4I1Q A;  4HR1 A;  3BVX A;  4IWO A;  2RAJ A;  1Y2O A;  1E9V A;  1OA0 A;  2YI9 A;  4FZO A;  1U00 A;  1O7D B;  3ER9 B;  4AZC A;  2RAI A;  3BUI A;  4B9Q A;  4AZH A;  4H6I A;  3L3O M;  4G6Q A;  3DX2 A;  2X3X A;  3D4Z A;  1TQV A;  3QWE A;  2D1L A;  2Z0O A;  2YL8 A;  3B51 X;  3B52 X;  1GNL A;  2YIV X;  5TKY A;  4EZQ A;  2FYV A;  3Q0K A;  2F1A A;  3BUQ A;  3CAZ A;  2OZN B;  3CVR A;  1I4T A;  1I49 A;  1JQK A;  3T49 A;  3BVV A;  3DX4 A;  3DX3 A;  2JNS A;  2F1B A;  1WDZ A;  1HWW A;  1PS3 A;  3M3W A;  2EFK A;  4DYL A;  2ELB A;  4EZU A;  1ZWW A;  2X3W A;  3D50 A;  1QWU A;  2NCZ A;  3I04 A;  2YL5 A;  2GF4 A;  3UIT A;  2N3K A;  4EZZ A;  5C5B B;  3F7W A;  2WYH A;  3CZN A;  2WYI A;  3DYT A;  3I39 X;  1HTY A;  4NQI A;  1QWN A;  1X04 A;  3D4Y A;  4E3C A;  3Q84 A;  4JWI A;  4EZV A;  3BVW A;  3DPP A;  3HAI A;  3DDF A;  3B53 X;  4M0M A;  3BUB A;  3T47 A;  3QE6 A;  3BUD A;  2ND1 A;  1I4D A;  4EZO A;  1OAO A;  2ALW A;  4HY9 A;  4AZ5 A;  2ZXQ A;  1YWM A;  4EZX A;  4IW0 A;  3HAJ A;  3T4A G;  3EJP A;  4IM2 A;  2Z8Y A;  3D2F A;  4JWE A;  3VEA A;  2YL6 A;  3KDR A;  3KAV A;  4AZB A;  1W9M A;  3EJR A;  4R5J A;  3I2W A;  3A98 A;  4EZR A;  4D8J A;  4R5I A;  2ND0 A;  3OWG A;  2QXL A; 
#chains in the Genus database with same CATH homology
 4JWD A;  4F01 A;  4EZS A;  4EZU A;  3I01 A;  3GI7 A;  1ZYL A;  4EZP A;  4FM3 A;  1GNT A;  4HYB A;  1DKX A;  4UDY X;  2X5C A;  2NCZ A;  1E1D A;  3I04 A;  3T46 A;  4E81 A;  2OBM A;  2YIB A;  3KAW A;  4HR1 B;  3UIT A;  4IM3 A;  2N3K A;  4EZZ A;  2GAF D;  3F7W A;  2EWF A;  4IWP A;  2WIN M;  3VEB A;  1SUF A;  1E2U A;  3I39 X;  1UPX A;  1SU7 A;  3O3N B;  2YIA A;  4EZT A;  4EZW A;  1GN9 A;  4H6H A;  4UDX X;  4KIK A;  1SU8 A;  5FIG A;  2RT6 A;  4E3C A;  4JWI A;  4HR1 A;  4IWO A;  4IM0 A;  1DKY A;  2KHO A;  1E9V A;  4EZV A;  1OA0 A;  3DPP A;  2YI9 A;  4JNE A;  2QFF A;  3B53 X;  3QNJ A;  1U00 A;  4M0M A;  3T47 A;  3ER9 B;  2LM0 A;  3LMF A;  2ND1 A;  4B9Q A;  4JLC A;  3ZED A;  3VKH A;  3DPO A;  4H6I A;  2GA9 D;  3L3O M;  4G6Q A;  1OA1 A;  3T48 A;  4EZO A;  4EZY A;  1OAO A;  2OBL A;  4HY9 A;  4EZN A;  3DPQ A;  3O3M B;  4JL9 A;  4R5K A;  4EZX A;  4IW0 A;  3T4A G;  1DKZ A;  2YI8 A;  3B51 X;  4IM2 A;  3B52 X;  2Z8Y A;  1GNL A;  3D2F A;  3FD9 A;  2YIV X;  5TKY A;  4EZQ A;  1MJG A;  4JWE A;  4R5G A;  4PO2 A;  3VEA A;  3D2E A;  4JN4 A;  3C7N A;  4JNF A;  3KDR A;  3ER8 C;  3KAV A;  2EX3 B;  1W9M A;  5FLE X;  4R5J A;  1JQK A;  2PY6 A;  4KIK B;  3O3O B;  4R5L A;  3A98 A;  5E84 A;  3T49 A;  3ERC C;  4EZR A;  1SU6 A;  4JWC A;  4D8J A;  4IWQ A;  3QA8 A;  3RV0 A;  4R5I A;  3RV1 A;  4NPH A;  2ND0 A;  3OWG A;  4F00 A;  2QXL A;  2JNS A;  3OHX M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...