3T49A

Crystal structure of truncated form of staphylococcal complement inhibitor b (scin-b) at 1.5 angstrom
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
70
structure length
70
Chain Sequence
GSAEELRTLLNKSNVYALAAGSLNPYYKRTIMMNEYRAKAALKKNDFVSMADAKVALEKIYKEIDEIINR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrinogen-binding protein
publication title Diversity in the C3b Convertase Contact Residues and Tertiary Structures of the Staphylococcal Complement Inhibitor (SCIN) Protein Family.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Immune system
total genus 29
structure length 70
sequence length 70
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3t49A00
1DKXA 4JNFA 2WINM 4R5JA 3T4AG 3OHXM 4B9QA 4EZPA 4EZQA 3D2FA 3T47A 4EZRA 2KHOA 3D2EA 4EZUA 1U00A 4EZSA 4F01A 4H6IA 4PO2A 4JNEA 4EZXA 1DKYA 3DPQA 4JWEA 4F00A 1DKZA 4HY9A 5TKYA 3C7NA 3T46A 4E81A 4EZNA 3DPPA 4R5LA 5E84A 4R5GA 4JWIA 3T48A 2QXLA 3QNJA 4EZZA 4R5IA 3DPOA 2QFFA 4EZYA 4JWCA 4EZWA 4H6HA 4EZVA 3L3OM 4JN4A 4HYBA 4EZTA 3T49A 4R5KA 4EZOA 4JWDA
chains in the Genus database with same CATH superfamily
2Z0VA 3HAIA 1OA0A 2YL8A 4AZGA 3VKHA 1I4DA 2EWFA 3L3OM 2RAKA 4HYBA 4R5KA 3VEBA 4AKVA 3BUPA 4JNFA 2WINM 2YLAA 3D51A 1TQUA 2ELBA 2EFLA 3I01A 3QNJA 4FZPA 2YIAA 1X03A 2OZNB 4EZPA 3HAJA 3T47A 4AZCA 1I4TA 4D8JA 1QWNA 5TKYA 2PMRA 1ZYLA 3UITA 3LLLA 2F7OA 1QX1A 3EJUA 4R5IA 1QWUA 3PLTA 2YI8A 3G9GA 4BNEA 3OK8A 3T49A 2YL6A 3DX0A 1DKXA 2OO2A 1X04A 1DKZA 1TQTA 1SU8A 3Q84A 2EX3B 3T46A 3CAZA 3BUQA 4IW0A 3I04A 3BLBA 3DPOA 2RAJA 4PO2A 3EJSA 1SUFA 3QWEA 3D4ZA 4UDXX 3ERCC 3BUIA 4JNEA 1SU6A 4JWEA 2ND0A 4NSWA 2YIVX 4JWIA 3DYTA 3F7WA 2YKTA 4EZWA 3CKDA 1PS3A 2FICA 4DYLA 3OHXM 2JNKA 4H8SA 3GI7A 4ATMA 3O3NB 3VEAA 3FD9A 5FIGA 1E1DA 3DDGA 2X3XA 2X3WA 3O3MB 3BUBA 3DX2A 3DX4A 4WPCA 2GF4A 3B53X 4B9QA 3DX1A 3D2EA 1JQKA 1UPXA 2OBMA 1R34A 1WDZA 2RT6A 4FZSA 4HY9A 3LVTA 1ZWWA 1GN9A 1YWMA 3I2WA 1E9VA 3T48A 2Z0OA 4M0MA 4EZVA 4KIKB 3EJTA 4EZUA 2C08A 3EJPA 4AZIA 2F1AA 2YL5A 3D4YA 3DPPA 3Q0KA 4JWCA 1R5EA 2V0OA 4IM2A 4IWOA 3BVTA 3A98A 4AZHA 2WYIA 4JLCA 2D1LA 4F00A 2X5CA 2ND1A 2YIBA 2Q12A 4NPHA 1Y2OA 4EZZA 2ZXQA 3LMFA 2QFFA 2F7QA 4H6HA 3B51X 1E2UA 2Z0NA 2NCZA 3L3PA 4HR1B 3T4AG 3D52A 2N3KA 3BVUA 1HXKA 1O7DB 4F01A 4H6IA 4G6QA 3O3OB 4I1QA 4NQIA 3B52X 1GNTA 1HTYA 2OW7A 3ER8C 4R5LA 2GAFD 2F7RA 5C5BB 4IWQA 4EZYA 4AVMA 3QA8A 2YLLA 3KDRA 4EZRA 4EZSA 3ER9B 1W9MA 3M3WA 3CV5A 2F1BA 3RV1A 2YI9A 4R5JA 1GNLA 4JL9A 3ZEDA 3SYVA 4FZOA 3RV0A 2OBLA 2WYHA 2F7PA 3EJQA 3BVXA 1O7DC 1SU7A 4UDYX 2O0I1 3I39X 1TQSA 4EZTA 4AZ7A 4EZOA 2LXYA 4E3CA 4WPEA 2PY6A 1HWWA 2X3VA 3RPMA 2RAIA 3D50A 4AZCB 3ABHA 4EZXA 1TQVA 3C7NA 3BVVA 4E81A 3BVWA 3CZNA 1OAOA 1R33A 3CZSA 1I4LA 4KIKA 2JNSA 4DCNC 1LQ7A 4IWPA 2KHOA 4AZ5A 4FM3A 2ALWA 3DX3A 4EZNA 3BUDA 4IM0A 2Z8YA 1I49A 2QKWA 2YL9A 4JN4A 2D4CA 1MJGA 2EFKA 3CVRA 3D2FA 3KAWA 1U00A 3KAVA 3DPQA 2FYVA 3ACOA 2QXLA 2GA9D 4HR1A 3OWGA 4AZ6A 3HAHA 4EZQA 1OA1A 3QNIA 5KBPA 2OW6A 5FLEX 3SOGA 1DKYA 4IM3A 1URUA 2LM0A 2MI7A 3QE6A 5E84A 5C5BA 4R5GA 3DDFA 3EJRA 2F18A 4AZBA 2Q13A 1TQWA 4JWDA
chains in the Genus database with same CATH topology
1SUFA 2PY6A 4IM2A 4IWOA 3A98A 3ERCC 4UDXX 4JLCA 4JNEA 4EZXA 1OA0A 1SU6A 4F00A 4JWEA 2X5CA 2ND1A 3C7NA 3VKHA 2YIBA 4E81A 1OAOA 2ND0A 4NPHA 2YIVX 4JWIA 2EWFA 3F7WA 4EZZA 3LMFA 2QFFA 4EZWA 4H6HA 3L3OM 3B51X 1E2UA 4HYBA 4R5KA 4KIKA 2NCZA 3VEBA 2JNSA 4HR1B 4JNFA 3T4AG 2WINM 2N3KA 3OHXM 4IWPA 3GI7A 2KHOA 4F01A 3O3NB 3VEAA 4H6IA 4G6QA 3O3OB 4FM3A 3B52X 3FD9A 1GNTA 5FIGA 1E1DA 3ER8C 3I01A 4EZNA 4R5LA 2GAFD 4IM0A 2Z8YA 3QNJA 4IWQA 3O3MB 4EZYA 2YIAA 3QA8A 4JN4A 4EZPA 3B53X 1MJGA 3KDRA 4B9QA 3D2FA 3T47A 4EZRA 3D2EA 3KAWA 1U00A 4EZSA 3KAVA 1JQKA 1UPXA 2OBMA 3DPQA 2RT6A 4HY9A 4D8JA 5TKYA 3ER9B 1GN9A 1ZYLA 3UITA 1E9VA 3T48A 2QXLA 1W9MA 4R5IA 2GA9D 4M0MA 2YI8A 4EZVA 4HR1A 3OWGA 3T49A 3RV1A 2YI9A 1DKXA 4R5JA 4EZQA 4KIKB 1OA1A 1GNLA 4JL9A 4EZUA 3ZEDA 4PO2A 5FLEX 3RV0A 1DKYA 4IM3A 2OBLA 1DKZA 1SU8A 2EX3B 3T46A 2LM0A 4IW0A 3DPPA 5E84A 4R5GA 3I04A 3DPOA 1SU7A 4JWCA 4UDYX 3I39X 4EZTA 4EZOA 4E3CA 4JWDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DKX A;  4JNF A;  2WIN M;  4R5J A;  3T4A G;  3OHX M;  4B9Q A;  4EZP A;  4EZQ A;  3D2F A;  3T47 A;  4EZR A;  2KHO A;  3D2E A;  4EZU A;  1U00 A;  4EZS A;  4F01 A;  4H6I A;  4PO2 A;  4JNE A;  4EZX A;  1DKY A;  3DPQ A;  4JWE A;  4F00 A;  1DKZ A;  4HY9 A;  5TKY A;  3C7N A;  3T46 A;  4E81 A;  4EZN A;  3DPP A;  4R5L A;  5E84 A;  4R5G A;  4JWI A;  3T48 A;  2QXL A;  3QNJ A;  4EZZ A;  4R5I A;  3DPO A;  2QFF A;  4EZY A;  4JWC A;  4EZW A;  4H6H A;  4EZV A;  3L3O M;  4JN4 A;  4HYB A;  4EZT A;  3T49 A;  4R5K A;  4EZO A;  4JWD A; 
#chains in the Genus database with same CATH topology
 2Z0V A;  3HAI A;  1OA0 A;  2YL8 A;  4AZG A;  3VKH A;  1I4D A;  2EWF A;  3L3O M;  2RAK A;  4HYB A;  4R5K A;  3VEB A;  4AKV A;  3BUP A;  4JNF A;  2WIN M;  2YLA A;  3D51 A;  1TQU A;  2ELB A;  2EFL A;  3I01 A;  3QNJ A;  4FZP A;  2YIA A;  1X03 A;  2OZN B;  4EZP A;  3HAJ A;  3T47 A;  4AZC A;  1I4T A;  4D8J A;  1QWN A;  5TKY A;  2PMR A;  1ZYL A;  3UIT A;  3LLL A;  2F7O A;  1QX1 A;  3EJU A;  4R5I A;  1QWU A;  3PLT A;  2YI8 A;  3G9G A;  4BNE A;  3OK8 A;  3T49 A;  2YL6 A;  3DX0 A;  1DKX A;  2OO2 A;  1X04 A;  1DKZ A;  1TQT A;  1SU8 A;  3Q84 A;  2EX3 B;  3T46 A;  3CAZ A;  3BUQ A;  4IW0 A;  3I04 A;  3BLB A;  3DPO A;  2RAJ A;  4PO2 A;  3EJS A;  1SUF A;  3QWE A;  3D4Z A;  4UDX X;  3ERC C;  3BUI A;  4JNE A;  1SU6 A;  4JWE A;  2ND0 A;  4NSW A;  2YIV X;  4JWI A;  3DYT A;  3F7W A;  2YKT A;  4EZW A;  3CKD A;  1PS3 A;  2FIC A;  4DYL A;  3OHX M;  2JNK A;  4H8S A;  3GI7 A;  4ATM A;  3O3N B;  3VEA A;  3FD9 A;  5FIG A;  1E1D A;  3DDG A;  2X3X A;  2X3W A;  3O3M B;  3BUB A;  3DX2 A;  3DX4 A;  4WPC A;  2GF4 A;  3B53 X;  4B9Q A;  3DX1 A;  3D2E A;  1JQK A;  1UPX A;  2OBM A;  1R34 A;  1WDZ A;  2RT6 A;  4FZS A;  4HY9 A;  3LVT A;  1ZWW A;  1GN9 A;  1YWM A;  3I2W A;  1E9V A;  3T48 A;  2Z0O A;  4M0M A;  4EZV A;  4KIK B;  3EJT A;  4EZU A;  2C08 A;  3EJP A;  4AZI A;  2F1A A;  2YL5 A;  3D4Y A;  3DPP A;  3Q0K A;  4JWC A;  1R5E A;  2V0O A;  4IM2 A;  4IWO A;  3BVT A;  3A98 A;  4AZH A;  2WYI A;  4JLC A;  2D1L A;  4F00 A;  2X5C A;  2ND1 A;  2YIB A;  2Q12 A;  4NPH A;  1Y2O A;  4EZZ A;  2ZXQ A;  3LMF A;  2QFF A;  2F7Q A;  4H6H A;  3B51 X;  1E2U A;  2Z0N A;  2NCZ A;  3L3P A;  4HR1 B;  3T4A G;  3D52 A;  2N3K A;  3BVU A;  1HXK A;  1O7D B;  4F01 A;  4H6I A;  4G6Q A;  3O3O B;  4I1Q A;  4NQI A;  3B52 X;  1GNT A;  1HTY A;  2OW7 A;  3ER8 C;  4R5L A;  2GAF D;  2F7R A;  5C5B B;  4IWQ A;  4EZY A;  4AVM A;  3QA8 A;  2YLL A;  3KDR A;  4EZR A;  4EZS A;  3ER9 B;  1W9M A;  3M3W A;  3CV5 A;  2F1B A;  3RV1 A;  2YI9 A;  4R5J A;  1GNL A;  4JL9 A;  3ZED A;  3SYV A;  4FZO A;  3RV0 A;  2OBL A;  2WYH A;  2F7P A;  3EJQ A;  3BVX A;  1O7D C;  1SU7 A;  4UDY X;  2O0I 1;  3I39 X;  1TQS A;  4EZT A;  4AZ7 A;  4EZO A;  2LXY A;  4E3C A;  4WPE A;  2PY6 A;  1HWW A;  2X3V A;  3RPM A;  2RAI A;  3D50 A;  4AZC B;  3ABH A;  4EZX A;  1TQV A;  3C7N A;  3BVV A;  4E81 A;  3BVW A;  3CZN A;  1OAO A;  1R33 A;  3CZS A;  1I4L A;  4KIK A;  2JNS A;  4DCN C;  1LQ7 A;  4IWP A;  2KHO A;  4AZ5 A;  4FM3 A;  2ALW A;  3DX3 A;  4EZN A;  3BUD A;  4IM0 A;  2Z8Y A;  1I49 A;  2QKW A;  2YL9 A;  4JN4 A;  2D4C A;  1MJG A;  2EFK A;  3CVR A;  3D2F A;  3KAW A;  1U00 A;  3KAV A;  3DPQ A;  2FYV A;  3ACO A;  2QXL A;  2GA9 D;  4HR1 A;  3OWG A;  4AZ6 A;  3HAH A;  4EZQ A;  1OA1 A;  3QNI A;  5KBP A;  2OW6 A;  5FLE X;  3SOG A;  1DKY A;  4IM3 A;  1URU A;  2LM0 A;  2MI7 A;  3QE6 A;  5E84 A;  5C5B A;  4R5G A;  3DDF A;  3EJR A;  2F18 A;  4AZB A;  2Q13 A;  1TQW A;  4JWD A; 
#chains in the Genus database with same CATH homology
 1SUF A;  2PY6 A;  4IM2 A;  4IWO A;  3A98 A;  3ERC C;  4UDX X;  4JLC A;  4JNE A;  4EZX A;  1OA0 A;  1SU6 A;  4F00 A;  4JWE A;  2X5C A;  2ND1 A;  3C7N A;  3VKH A;  2YIB A;  4E81 A;  1OAO A;  2ND0 A;  4NPH A;  2YIV X;  4JWI A;  2EWF A;  3F7W A;  4EZZ A;  3LMF A;  2QFF A;  4EZW A;  4H6H A;  3L3O M;  3B51 X;  1E2U A;  4HYB A;  4R5K A;  4KIK A;  2NCZ A;  3VEB A;  2JNS A;  4HR1 B;  4JNF A;  3T4A G;  2WIN M;  2N3K A;  3OHX M;  4IWP A;  3GI7 A;  2KHO A;  4F01 A;  3O3N B;  3VEA A;  4H6I A;  4G6Q A;  3O3O B;  4FM3 A;  3B52 X;  3FD9 A;  1GNT A;  5FIG A;  1E1D A;  3ER8 C;  3I01 A;  4EZN A;  4R5L A;  2GAF D;  4IM0 A;  2Z8Y A;  3QNJ A;  4IWQ A;  3O3M B;  4EZY A;  2YIA A;  3QA8 A;  4JN4 A;  4EZP A;  3B53 X;  1MJG A;  3KDR A;  4B9Q A;  3D2F A;  3T47 A;  4EZR A;  3D2E A;  3KAW A;  1U00 A;  4EZS A;  3KAV A;  1JQK A;  1UPX A;  2OBM A;  3DPQ A;  2RT6 A;  4HY9 A;  4D8J A;  5TKY A;  3ER9 B;  1GN9 A;  1ZYL A;  3UIT A;  1E9V A;  3T48 A;  2QXL A;  1W9M A;  4R5I A;  2GA9 D;  4M0M A;  2YI8 A;  4EZV A;  4HR1 A;  3OWG A;  3T49 A;  3RV1 A;  2YI9 A;  1DKX A;  4R5J A;  4EZQ A;  4KIK B;  1OA1 A;  1GNL A;  4JL9 A;  4EZU A;  3ZED A;  4PO2 A;  5FLE X;  3RV0 A;  1DKY A;  4IM3 A;  2OBL A;  1DKZ A;  1SU8 A;  2EX3 B;  3T46 A;  2LM0 A;  4IW0 A;  3DPP A;  5E84 A;  4R5G A;  3I04 A;  3DPO A;  1SU7 A;  4JWC A;  4UDY X;  3I39 X;  4EZT A;  4EZO A;  4E3C A;  4JWD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...