1X04A

Crystal structure of endophilin bar domain (mutant)
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
200
structure length
200
Chain Sequence
b'GTKLDDDFKEMERKVDVTSRAVMEIMTKTIEYLAHLSSLLQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMRELSEVKDSLDIEVKQNFIDPLQNLHDKDLREIQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFDESKEIAESSMFNLLEMDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRLEERIRQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SH3-containing GRB2-like protein 2
publication title Endophilin BAR domain drives membrane curvature by two newly identified structure-based mechanisms
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 80
structure length 200
sequence length 200
ec nomenclature ec 2.3.1.-:
pdb deposition date 2005-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03114 BAR BAR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 1x04A00
1WDZA 2X3VA 2Z0VA 1URUA 3ABHA 3M3WA 4I1QA 2Z0OA 2ELBA 2FICA 2D4CA 2X3WA 2Z0NA 3Q0KA 2X3XA 3HAHA 3Q84A 3I2WA 2RAJA 3CAZA 4FZSA 2YKTA 2C08A 2RAIA 1I49A 3PLTA 4DCNC 3ACOA 1I4TA 3HAIA 2Q13A 3QWEA 3SYVA 4H8SA 2EFKA 5C5BB 4BNEA 4DYLA 1I4LA 1I4DA 2RAKA 3QE6A 3LLLA 4WPEA 1Y2OA 1X03A 4NSWA 2D1LA 4AKVA 3HAJA 3OK8A 4ATMA 2Q12A 3DYTA 3QNIA 4AVMA 3SOGA 1X04A 4NQIA 5C5BA 2EFLA 3G9GA 4WPCA 1ZWWA 2V0OA
chains in the Genus database with same CATH superfamily
4EZSA 1LQ7A 3O3MB 3Q0KA 4DCNC 1QWNA 3CKDA 3BUIA 3BVWA 1JQKA 3T47A 1I4LA 4R5GA 2GA9D 2YI9A 4KIKA 3LLLA 4EZXA 3RPMA 4IM3A 3BUDA 2FYVA 3T46A 4EZVA 2ND0A 3QA8A 2LXYA 4EZWA 2QKWA 2F7PA 2Q13A 3EJQA 1R33A 2F1AA 3D4YA 4DYLA 3QE6A 3D51A 1Y2OA 3FD9A 3OHXM 3F7WA 4HR1B 3I39X 3G9GA 3QNJA 3CVRA 2WYIA 2MI7A 2FICA 3CV5A 2OZNB 2RAJA 3CAZA 3DDGA 3EJRA 2F18A 5FLEX 1GN9A 1UPXA 4JWIA 2Q12A 3DYTA 1DKYA 2QXLA 3M3WA 2ELBA 1DKXA 4JN4A 2EFKA 2NCZA 4HY9A 3O3OB 4IWQA 2LM0A 4R5KA 3KAWA 4HR1A 4JWDA 2JNKA 1HWWA 3DPQA 2OBLA 5KBPA 4JLCA 1TQVA 4AZHA 3DDFA 3D50A 3D2FA 1E1DA 4AVMA 4WPCA 1ZWWA 1O7DC 2V0OA 3ZEDA 3LVTA 1R5EA 2X3XA 2X5CA 1TQTA 4R5IA 4JNFA 3ER8C 4EZNA 3GI7A 1TQSA 2WYHA 5C5BB 2RAKA 4EZUA 1OA1A 3DPOA 4NSWA 4D8JA 3OK8A 4ATMA 4EZOA 1GNTA 2F7OA 2YI8A 3D52A 3DX2A 1I49A 4AZ7A 4E3CA 4IM2A 3QWEA 3DX0A 4EZZA 1OAOA 2OBMA 1PS3A 4AKVA 3BVUA 2GAFD 2EX3B 3O3NB 2ZXQA 4G6QA 4AZGA 3I2WA 3RV0A 3PLTA 3T48A 3L3OM 4IM0A 3DPPA 1O7DB 3SYVA 2PMRA 4H6IA 3VKHA 2YIVX 1OA0A 1X03A 3BLBA 3DX1A 2YIBA 2N3KA 1SU7A 5C5BA 4UDYX 3LMFA 4F00A 3C7NA 1URUA 4I1QA 4M0MA 2D4CA 1R34A 3RV1A 1HTYA 3HAJA 2EFLA 3HAIA 1HXKA 4IW0A 3D4ZA 3KDRA 4E81A 3ACOA 2ND1A 4F01A 1SU8A 1QWUA 4B9QA 4H8SA 4BNEA 1I4DA 1SUFA 3EJPA 2D1LA 4JWCA 2OW7A 3ABHA 2O0I1 3ERCC 4FM3A 4PO2A 2GF4A 3BVXA 3EJTA 4NPHA 4HYBA 1ZYLA 3ER9B 3EJUA 3BVVA 3I04A 2Z0VA 3B53X 4FZOA 3T4AG 3BUPA 1YWMA 1MJGA 4JNEA 1SU6A 4AZ5A 2Z8YA 3CZSA 1W9MA 4AZCB 2YL9A 3T49A 3QNIA 2YL6A 1TQWA 4R5JA 4R5LA 4EZYA 2QFFA 4FZSA 2C08A 3EJSA 2YL8A 2EWFA 4UDXX 3L3PA 2PY6A 2YLAA 3DX4A 4WPEA 2YIAA 4AZBA 1DKZA 2YLLA 3B51X 3A98A 2X3VA 1QX1A 2Z0OA 5FIGA 2OO2A 3OWGA 3D2EA 3CZNA 3VEAA 2ALWA 1TQUA 2F7QA 2F7RA 1E9VA 4IWOA 1X04A 4NQIA 3KAVA 4AZCA 1WDZA 2X3WA 4EZQA 4H6HA 3HAHA 4FZPA 3Q84A 2RAIA 3BUQA 4EZRA 3UITA 4KIKB 4AZ6A 2KHOA 3BUBA 3I01A 1E2UA 2OW6A 5E84A 4AZIA 4JWEA 1GNLA 3B52X 2RT6A 2Z0NA 2YL5A 2F1BA 2YKTA 2JNSA 1I4TA 4EZPA 3VEBA 4JL9A 3DX3A 2WINM 3BVTA 3SOGA 1U00A 5TKYA 4IWPA 4EZTA
chains in the Genus database with same CATH topology
1WDZA 2X3VA 2Z0VA 1URUA 3ABHA 3M3WA 4I1QA 2Z0OA 2ELBA 2FICA 2D4CA 2X3WA 2Z0NA 3Q0KA 2X3XA 3HAHA 3Q84A 3I2WA 2RAJA 3CAZA 4FZSA 2YKTA 2C08A 2RAIA 1I49A 3PLTA 4DCNC 3ACOA 1I4TA 3HAIA 2Q13A 3QWEA 3SYVA 4H8SA 2EFKA 5C5BB 4BNEA 4DYLA 1I4LA 1I4DA 2RAKA 3QE6A 3LLLA 4WPEA 1Y2OA 1X03A 4NSWA 2D1LA 4AKVA 3HAJA 3OK8A 4ATMA 2Q12A 3DYTA 3QNIA 4AVMA 3SOGA 1X04A 4NQIA 5C5BA 2EFLA 3G9GA 4WPCA 1ZWWA 2V0OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WDZ A;  2X3V A;  2Z0V A;  1URU A;  3ABH A;  3M3W A;  4I1Q A;  2Z0O A;  2ELB A;  2FIC A;  2D4C A;  2X3W A;  2Z0N A;  3Q0K A;  2X3X A;  3HAH A;  3Q84 A;  3I2W A;  2RAJ A;  3CAZ A;  4FZS A;  2YKT A;  2C08 A;  2RAI A;  1I49 A;  3PLT A;  4DCN C;  3ACO A;  1I4T A;  3HAI A;  2Q13 A;  3QWE A;  3SYV A;  4H8S A;  2EFK A;  5C5B B;  4BNE A;  4DYL A;  1I4L A;  1I4D A;  2RAK A;  3QE6 A;  3LLL A;  4WPE A;  1Y2O A;  1X03 A;  4NSW A;  2D1L A;  4AKV A;  3HAJ A;  3OK8 A;  4ATM A;  2Q12 A;  3DYT A;  3QNI A;  4AVM A;  3SOG A;  1X04 A;  4NQI A;  5C5B A;  2EFL A;  3G9G A;  4WPC A;  1ZWW A;  2V0O A; 
#chains in the Genus database with same CATH topology
 4EZS A;  1LQ7 A;  3O3M B;  3Q0K A;  4DCN C;  1QWN A;  3CKD A;  3BUI A;  3BVW A;  1JQK A;  3T47 A;  1I4L A;  4R5G A;  2GA9 D;  2YI9 A;  4KIK A;  3LLL A;  4EZX A;  3RPM A;  4IM3 A;  3BUD A;  2FYV A;  3T46 A;  4EZV A;  2ND0 A;  3QA8 A;  2LXY A;  4EZW A;  2QKW A;  2F7P A;  2Q13 A;  3EJQ A;  1R33 A;  2F1A A;  3D4Y A;  4DYL A;  3QE6 A;  3D51 A;  1Y2O A;  3FD9 A;  3OHX M;  3F7W A;  4HR1 B;  3I39 X;  3G9G A;  3QNJ A;  3CVR A;  2WYI A;  2MI7 A;  2FIC A;  3CV5 A;  2OZN B;  2RAJ A;  3CAZ A;  3DDG A;  3EJR A;  2F18 A;  5FLE X;  1GN9 A;  1UPX A;  4JWI A;  2Q12 A;  3DYT A;  1DKY A;  2QXL A;  3M3W A;  2ELB A;  1DKX A;  4JN4 A;  2EFK A;  2NCZ A;  4HY9 A;  3O3O B;  4IWQ A;  2LM0 A;  4R5K A;  3KAW A;  4HR1 A;  4JWD A;  2JNK A;  1HWW A;  3DPQ A;  2OBL A;  5KBP A;  4JLC A;  1TQV A;  4AZH A;  3DDF A;  3D50 A;  3D2F A;  1E1D A;  4AVM A;  4WPC A;  1ZWW A;  1O7D C;  2V0O A;  3ZED A;  3LVT A;  1R5E A;  2X3X A;  2X5C A;  1TQT A;  4R5I A;  4JNF A;  3ER8 C;  4EZN A;  3GI7 A;  1TQS A;  2WYH A;  5C5B B;  2RAK A;  4EZU A;  1OA1 A;  3DPO A;  4NSW A;  4D8J A;  3OK8 A;  4ATM A;  4EZO A;  1GNT A;  2F7O A;  2YI8 A;  3D52 A;  3DX2 A;  1I49 A;  4AZ7 A;  4E3C A;  4IM2 A;  3QWE A;  3DX0 A;  4EZZ A;  1OAO A;  2OBM A;  1PS3 A;  4AKV A;  3BVU A;  2GAF D;  2EX3 B;  3O3N B;  2ZXQ A;  4G6Q A;  4AZG A;  3I2W A;  3RV0 A;  3PLT A;  3T48 A;  3L3O M;  4IM0 A;  3DPP A;  1O7D B;  3SYV A;  2PMR A;  4H6I A;  3VKH A;  2YIV X;  1OA0 A;  1X03 A;  3BLB A;  3DX1 A;  2YIB A;  2N3K A;  1SU7 A;  5C5B A;  4UDY X;  3LMF A;  4F00 A;  3C7N A;  1URU A;  4I1Q A;  4M0M A;  2D4C A;  1R34 A;  3RV1 A;  1HTY A;  3HAJ A;  2EFL A;  3HAI A;  1HXK A;  4IW0 A;  3D4Z A;  3KDR A;  4E81 A;  3ACO A;  2ND1 A;  4F01 A;  1SU8 A;  1QWU A;  4B9Q A;  4H8S A;  4BNE A;  1I4D A;  1SUF A;  3EJP A;  2D1L A;  4JWC A;  2OW7 A;  3ABH A;  2O0I 1;  3ERC C;  4FM3 A;  4PO2 A;  2GF4 A;  3BVX A;  3EJT A;  4NPH A;  4HYB A;  1ZYL A;  3ER9 B;  3EJU A;  3BVV A;  3I04 A;  2Z0V A;  3B53 X;  4FZO A;  3T4A G;  3BUP A;  1YWM A;  1MJG A;  4JNE A;  1SU6 A;  4AZ5 A;  2Z8Y A;  3CZS A;  1W9M A;  4AZC B;  2YL9 A;  3T49 A;  3QNI A;  2YL6 A;  1TQW A;  4R5J A;  4R5L A;  4EZY A;  2QFF A;  4FZS A;  2C08 A;  3EJS A;  2YL8 A;  2EWF A;  4UDX X;  3L3P A;  2PY6 A;  2YLA A;  3DX4 A;  4WPE A;  2YIA A;  4AZB A;  1DKZ A;  2YLL A;  3B51 X;  3A98 A;  2X3V A;  1QX1 A;  2Z0O A;  5FIG A;  2OO2 A;  3OWG A;  3D2E A;  3CZN A;  3VEA A;  2ALW A;  1TQU A;  2F7Q A;  2F7R A;  1E9V A;  4IWO A;  1X04 A;  4NQI A;  3KAV A;  4AZC A;  1WDZ A;  2X3W A;  4EZQ A;  4H6H A;  3HAH A;  4FZP A;  3Q84 A;  2RAI A;  3BUQ A;  4EZR A;  3UIT A;  4KIK B;  4AZ6 A;  2KHO A;  3BUB A;  3I01 A;  1E2U A;  2OW6 A;  5E84 A;  4AZI A;  4JWE A;  1GNL A;  3B52 X;  2RT6 A;  2Z0N A;  2YL5 A;  2F1B A;  2YKT A;  2JNS A;  1I4T A;  4EZP A;  3VEB A;  4JL9 A;  3DX3 A;  2WIN M;  3BVT A;  3SOG A;  1U00 A;  5TKY A;  4IWP A;  4EZT A; 
#chains in the Genus database with same CATH homology
 1WDZ A;  2X3V A;  2Z0V A;  1URU A;  3ABH A;  3M3W A;  4I1Q A;  2Z0O A;  2ELB A;  2FIC A;  2D4C A;  2X3W A;  2Z0N A;  3Q0K A;  2X3X A;  3HAH A;  3Q84 A;  3I2W A;  2RAJ A;  3CAZ A;  4FZS A;  2YKT A;  2C08 A;  2RAI A;  1I49 A;  3PLT A;  4DCN C;  3ACO A;  1I4T A;  3HAI A;  2Q13 A;  3QWE A;  3SYV A;  4H8S A;  2EFK A;  5C5B B;  4BNE A;  4DYL A;  1I4L A;  1I4D A;  2RAK A;  3QE6 A;  3LLL A;  4WPE A;  1Y2O A;  1X03 A;  4NSW A;  2D1L A;  4AKV A;  3HAJ A;  3OK8 A;  4ATM A;  2Q12 A;  3DYT A;  3QNI A;  4AVM A;  3SOG A;  1X04 A;  4NQI A;  5C5B A;  2EFL A;  3G9G A;  4WPC A;  1ZWW A;  2V0O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...