1X04A

Crystal structure of endophilin bar domain (mutant)
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
200
structure length
200
Chain Sequence
GTKLDDDFKEMERKVDVTSRAVMEIMTKTIEYLAHLSSLLQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMRELSEVKDSLDIEVKQNFIDPLQNLHDKDLREIQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFDESKEIAESSMFNLLEMDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRLEERIRQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords SH3-containing GRB2-like protein 2
publication title Endophilin BAR domain drives membrane curvature by two newly identified structure-based mechanisms
pubmed doi rcsb
source organism Homo sapiens
total genus 80
structure length 200
sequence length 200
ec nomenclature ec 2.3.1.-:
pdb deposition date 2005-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03114 BAR BAR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 1x04A00
4DCNC 4I1QA 4H8SA 3PLTA 1Y2OA 3QWEA 1I49A 1WDZA 2X3VA 1URUA 2YKTA 5C5BB 3SOGA 2D4CA 2ELBA 4AVMA 3I2WA 2Q13A 3Q0KA 4NSWA 4FZSA 4NQIA 2C08A 2RAJA 2Z0NA 1I4LA 3QE6A 3LLLA 3OK8A 5C5BA 1ZWWA 4BNEA 3Q84A 1I4TA 1I4DA 2RAKA 2RAIA 2X3XA 3QNIA 2Z0VA 3M3WA 4DYLA 2EFKA 3HAHA 3SYVA 4ATMA 2FICA 2V0OA 3G9GA 4AKVA 4WPCA 3HAJA 3CAZA 1X03A 3ABHA 4WPEA 2Q12A 2D1LA 2X3WA 3HAIA 3ACOA 2EFLA 1X04A 3DYTA 2Z0OA
chains in the Genus database with same CATH superfamily
3PLTA 2ELBA 2Q13A 3EJPA 1HTYA 3EJRA 2LM0A 2FYVA 1I4TA 3BLBA 3B53X 3KAWA 3SYVA 3ZEDA 2YLAA 4IM3A 3HAIA 3ACOA 2YL9A 3LVTA 1LQ7A 1TQUA 4JNFA 4NSWA 3ER9B 3I04A 4AZHA 2WYHA 1I4LA 1SU7A 4R5IA 1UPXA 3ER8C 3CVRA 1O7DC 2V0OA 2O0I1 2OW6A 3T48A 4JWEA 1JQKA 3EJTA 4IM0A 2JNSA 2OZNB 4D8JA 4KIKB 4EZPA 4AZGA 3QNJA 3QA8A 3KDRA 2RAIA 1R33A 4EZVA 4IWPA 4ATMA 3BVXA 1HXKA 3KAVA 2KHOA 1W9MA 4M0MA 4HYBA 4DCNC 3DPOA 2X3VA 3D2FA 2D4CA 4JN4A 3RV0A 3CV5A 3LMFA 3B52X 3CZSA 3D51A 1O7DB 1DKYA 4EZRA 3DDGA 2OO2A 1QWUA 4UDXX 2EX3B 2RAJA 2YI9A 2ZXQA 2X3XA 2Z0VA 4H6HA 3DPPA 3T4AG 1E1DA 4IWOA 3O3NB 1X04A 2ND0A 3I01A 3BUQA 1HWWA 2OBLA 2OBMA 4EZZA 2YL6A 2RT6A 3BVVA 3M3WA 3DDFA 4EZOA 1SU8A 1DKXA 3T49A 2Z8YA 1R34A 4HR1A 4IWQA 4R5GA 3Q0KA 1YWMA 3D2EA 3T47A 3CKDA 3L3PA 4R5LA 1GN9A 2QFFA 1TQVA 5FIGA 5FLEX 4JWCA 3EJUA 4EZSA 4AKVA 2ND1A 2EWFA 1SU6A 4IM2A 1URUA 3EJSA 3SOGA 2ALWA 4NQIA 3F7WA 2F7PA 4DYLA 3BVWA 4JLCA 2GAFD 1TQSA 4R5JA 3T46A 4WPCA 3HAJA 1PS3A 1X03A 4HR1B 4NPHA 2X5CA 4H6IA 2F1BA 3D52A 4EZXA 2YKTA 3FD9A 2GA9D 3ERCC 2YLLA 2QKWA 3G9GA 3CAZA 2NCZA 3ABHA 3A98A 1GNTA 1E2UA 4B9QA 1QWNA 3DYTA 5E84A 4EZTA 3L3OM 4JWIA 2F7RA 3BUDA 3BUPA 5C5BA 1E9VA 4FM3A 1MJGA 1QX1A 2GF4A 2WYIA 3HAHA 1R5EA 1OAOA 4JNEA 2Q12A 2EFLA 3DPQA 2F7OA 5KBPA 1WDZA 3I2WA 2QXLA 3BVUA 2Z0NA 1ZWWA 2JNKA 4F00A 3B51X 2YIBA 4IW0A 4AZCA 2WINM 2N3KA 4EZWA 4H8SA 1TQTA 5C5BB 4KIKA 3VEBA 2YL5A 4AZ7A 4EZUA 4PO2A 2RAKA 3QNIA 2F7QA 4EZYA 3GI7A 2FICA 4AZIA 4E81A 3EJQA 2X3WA 1GNLA 3D50A 3BUBA 1OA1A 3DX1A 3VKHA 2C08A 3CZNA 3DX3A 4AZCB 4EZNA 1I4DA 4JL9A 1OA0A 2YI8A 3UITA 2YIVX 1ZYLA 3I39X 3D4YA 4HY9A 3QWEA 2OW7A 4BNEA 3Q84A 3BVTA 3O3OB 3C7NA 3VEAA 4JWDA 3RPMA 2D1LA 3D4ZA 2PY6A 1U00A 4I1QA 5TKYA 1Y2OA 2F1AA 3DX4A 4FZOA 4AVMA 4UDYX 4FZSA 1TQWA 2YL8A 3RV1A 4AZ6A 3QE6A 2MI7A 4R5KA 3DX0A 2YIAA 3BUIA 2EFKA 3OWGA 1SUFA 4WPEA 4G6QA 2F18A 2LXYA 4EZQA 1DKZA 4AZBA 1I49A 4FZPA 3OHXM 4E3CA 3LLLA 3OK8A 3O3MB 2PMRA 4F01A 4AZ5A 3DX2A 2Z0OA
chains in the Genus database with same CATH topology
4DCNC 4I1QA 4H8SA 3PLTA 1Y2OA 3QWEA 1I49A 1WDZA 2X3VA 1URUA 2YKTA 5C5BB 3SOGA 2D4CA 2ELBA 4AVMA 3I2WA 2Q13A 3Q0KA 4NSWA 4FZSA 4NQIA 2C08A 2RAJA 2Z0NA 1I4LA 3QE6A 3LLLA 3OK8A 5C5BA 1ZWWA 4BNEA 3Q84A 1I4TA 1I4DA 2RAKA 2RAIA 2X3XA 3QNIA 2Z0VA 3M3WA 4DYLA 2EFKA 3HAHA 3SYVA 4ATMA 2FICA 2V0OA 3G9GA 4AKVA 4WPCA 3HAJA 3CAZA 1X03A 3ABHA 4WPEA 2Q12A 2D1LA 2X3WA 3HAIA 3ACOA 2EFLA 1X04A 3DYTA 2Z0OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DCN C;  4I1Q A;  4H8S A;  3PLT A;  1Y2O A;  3QWE A;  1I49 A;  1WDZ A;  2X3V A;  1URU A;  2YKT A;  5C5B B;  3SOG A;  2D4C A;  2ELB A;  4AVM A;  3I2W A;  2Q13 A;  3Q0K A;  4NSW A;  4FZS A;  4NQI A;  2C08 A;  2RAJ A;  2Z0N A;  1I4L A;  3QE6 A;  3LLL A;  3OK8 A;  5C5B A;  1ZWW A;  4BNE A;  3Q84 A;  1I4T A;  1I4D A;  2RAK A;  2RAI A;  2X3X A;  3QNI A;  2Z0V A;  3M3W A;  4DYL A;  2EFK A;  3HAH A;  3SYV A;  4ATM A;  2FIC A;  2V0O A;  3G9G A;  4AKV A;  4WPC A;  3HAJ A;  3CAZ A;  1X03 A;  3ABH A;  4WPE A;  2Q12 A;  2D1L A;  2X3W A;  3HAI A;  3ACO A;  2EFL A;  1X04 A;  3DYT A;  2Z0O A; 
#chains in the Genus database with same CATH topology
 3PLT A;  2ELB A;  2Q13 A;  3EJP A;  1HTY A;  3EJR A;  2LM0 A;  2FYV A;  1I4T A;  3BLB A;  3B53 X;  3KAW A;  3SYV A;  3ZED A;  2YLA A;  4IM3 A;  3HAI A;  3ACO A;  2YL9 A;  3LVT A;  1LQ7 A;  1TQU A;  4JNF A;  4NSW A;  3ER9 B;  3I04 A;  4AZH A;  2WYH A;  1I4L A;  1SU7 A;  4R5I A;  1UPX A;  3ER8 C;  3CVR A;  1O7D C;  2V0O A;  2O0I 1;  2OW6 A;  3T48 A;  4JWE A;  1JQK A;  3EJT A;  4IM0 A;  2JNS A;  2OZN B;  4D8J A;  4KIK B;  4EZP A;  4AZG A;  3QNJ A;  3QA8 A;  3KDR A;  2RAI A;  1R33 A;  4EZV A;  4IWP A;  4ATM A;  3BVX A;  1HXK A;  3KAV A;  2KHO A;  1W9M A;  4M0M A;  4HYB A;  4DCN C;  3DPO A;  2X3V A;  3D2F A;  2D4C A;  4JN4 A;  3RV0 A;  3CV5 A;  3LMF A;  3B52 X;  3CZS A;  3D51 A;  1O7D B;  1DKY A;  4EZR A;  3DDG A;  2OO2 A;  1QWU A;  4UDX X;  2EX3 B;  2RAJ A;  2YI9 A;  2ZXQ A;  2X3X A;  2Z0V A;  4H6H A;  3DPP A;  3T4A G;  1E1D A;  4IWO A;  3O3N B;  1X04 A;  2ND0 A;  3I01 A;  3BUQ A;  1HWW A;  2OBL A;  2OBM A;  4EZZ A;  2YL6 A;  2RT6 A;  3BVV A;  3M3W A;  3DDF A;  4EZO A;  1SU8 A;  1DKX A;  3T49 A;  2Z8Y A;  1R34 A;  4HR1 A;  4IWQ A;  4R5G A;  3Q0K A;  1YWM A;  3D2E A;  3T47 A;  3CKD A;  3L3P A;  4R5L A;  1GN9 A;  2QFF A;  1TQV A;  5FIG A;  5FLE X;  4JWC A;  3EJU A;  4EZS A;  4AKV A;  2ND1 A;  2EWF A;  1SU6 A;  4IM2 A;  1URU A;  3EJS A;  3SOG A;  2ALW A;  4NQI A;  3F7W A;  2F7P A;  4DYL A;  3BVW A;  4JLC A;  2GAF D;  1TQS A;  4R5J A;  3T46 A;  4WPC A;  3HAJ A;  1PS3 A;  1X03 A;  4HR1 B;  4NPH A;  2X5C A;  4H6I A;  2F1B A;  3D52 A;  4EZX A;  2YKT A;  3FD9 A;  2GA9 D;  3ERC C;  2YLL A;  2QKW A;  3G9G A;  3CAZ A;  2NCZ A;  3ABH A;  3A98 A;  1GNT A;  1E2U A;  4B9Q A;  1QWN A;  3DYT A;  5E84 A;  4EZT A;  3L3O M;  4JWI A;  2F7R A;  3BUD A;  3BUP A;  5C5B A;  1E9V A;  4FM3 A;  1MJG A;  1QX1 A;  2GF4 A;  2WYI A;  3HAH A;  1R5E A;  1OAO A;  4JNE A;  2Q12 A;  2EFL A;  3DPQ A;  2F7O A;  5KBP A;  1WDZ A;  3I2W A;  2QXL A;  3BVU A;  2Z0N A;  1ZWW A;  2JNK A;  4F00 A;  3B51 X;  2YIB A;  4IW0 A;  4AZC A;  2WIN M;  2N3K A;  4EZW A;  4H8S A;  1TQT A;  5C5B B;  4KIK A;  3VEB A;  2YL5 A;  4AZ7 A;  4EZU A;  4PO2 A;  2RAK A;  3QNI A;  2F7Q A;  4EZY A;  3GI7 A;  2FIC A;  4AZI A;  4E81 A;  3EJQ A;  2X3W A;  1GNL A;  3D50 A;  3BUB A;  1OA1 A;  3DX1 A;  3VKH A;  2C08 A;  3CZN A;  3DX3 A;  4AZC B;  4EZN A;  1I4D A;  4JL9 A;  1OA0 A;  2YI8 A;  3UIT A;  2YIV X;  1ZYL A;  3I39 X;  3D4Y A;  4HY9 A;  3QWE A;  2OW7 A;  4BNE A;  3Q84 A;  3BVT A;  3O3O B;  3C7N A;  3VEA A;  4JWD A;  3RPM A;  2D1L A;  3D4Z A;  2PY6 A;  1U00 A;  4I1Q A;  5TKY A;  1Y2O A;  2F1A A;  3DX4 A;  4FZO A;  4AVM A;  4UDY X;  4FZS A;  1TQW A;  2YL8 A;  3RV1 A;  4AZ6 A;  3QE6 A;  2MI7 A;  4R5K A;  3DX0 A;  2YIA A;  3BUI A;  2EFK A;  3OWG A;  1SUF A;  4WPE A;  4G6Q A;  2F18 A;  2LXY A;  4EZQ A;  1DKZ A;  4AZB A;  1I49 A;  4FZP A;  3OHX M;  4E3C A;  3LLL A;  3OK8 A;  3O3M B;  2PMR A;  4F01 A;  4AZ5 A;  3DX2 A;  2Z0O A; 
#chains in the Genus database with same CATH homology
 4DCN C;  4I1Q A;  4H8S A;  3PLT A;  1Y2O A;  3QWE A;  1I49 A;  1WDZ A;  2X3V A;  1URU A;  2YKT A;  5C5B B;  3SOG A;  2D4C A;  2ELB A;  4AVM A;  3I2W A;  2Q13 A;  3Q0K A;  4NSW A;  4FZS A;  4NQI A;  2C08 A;  2RAJ A;  2Z0N A;  1I4L A;  3QE6 A;  3LLL A;  3OK8 A;  5C5B A;  1ZWW A;  4BNE A;  3Q84 A;  1I4T A;  1I4D A;  2RAK A;  2RAI A;  2X3X A;  3QNI A;  2Z0V A;  3M3W A;  4DYL A;  2EFK A;  3HAH A;  3SYV A;  4ATM A;  2FIC A;  2V0O A;  3G9G A;  4AKV A;  4WPC A;  3HAJ A;  3CAZ A;  1X03 A;  3ABH A;  4WPE A;  2Q12 A;  2D1L A;  2X3W A;  3HAI A;  3ACO A;  2EFL A;  1X04 A;  3DYT A;  2Z0O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...