1X04A

Crystal structure of endophilin bar domain (mutant)
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
200
structure length
200
Chain Sequence
GTKLDDDFKEMERKVDVTSRAVMEIMTKTIEYLAHLSSLLQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMRELSEVKDSLDIEVKQNFIDPLQNLHDKDLREIQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFDESKEIAESSMFNLLEMDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRLEERIRQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SH3-containing GRB2-like protein 2
publication title Endophilin BAR domain drives membrane curvature by two newly identified structure-based mechanisms
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 80
structure length 200
sequence length 200
ec nomenclature ec 2.3.1.-:
pdb deposition date 2005-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03114 BAR BAR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 1x04A00
2X3WA 4H8SA 5C5BB 4NSWA 4AVMA 2D1LA 1URUA 2FICA 4DYLA 1I4TA 2ELBA 1Y2OA 2RAKA 3DYTA 4DCNC 2V0OA 3I2WA 4WPEA 3ACOA 3QNIA 5C5BA 3G9GA 2Z0VA 1X03A 3Q84A 2YKTA 3SOGA 1I4DA 3HAJA 2Z0NA 2RAJA 3QE6A 3HAIA 3Q0KA 1WDZA 2C08A 3PLTA 4WPCA 4ATMA 3SYVA 1X04A 1ZWWA 2RAIA 3OK8A 3QWEA 1I49A 3ABHA 4FZSA 2D4CA 1I4LA 2Q13A 4NQIA 2Z0OA 2X3XA 3LLLA 2EFLA 2Q12A 3CAZA 3HAHA 3M3WA 4BNEA 2X3VA 2EFKA 4AKVA 4I1QA
chains in the Genus database with same CATH superfamily
3EJQA 2QKWA 1R33A 1I4TA 2GAFD 1Y2OA 4WPEA 4E81A 4IWPA 1YWMA 3KAWA 2C08A 2PY6A 3D51A 2QFFA 3I39X 3O3OB 3EJSA 4IM2A 4FZOA 4R5KA 3A98A 4UDXX 1O7DC 3T4AG 2ELBA 3DX3A 4EZPA 4B9QA 3B52X 2PMRA 1W9MA 1OAOA 3PLTA 4E3CA 2RAIA 1SUFA 2QXLA 2EFLA 2ALWA 2F1BA 3I01A 2OBLA 3OWGA 2F7OA 4IW0A 1TQSA 3Q84A 1O7DB 2YKTA 3GI7A 1OA1A 2YL9A 3T49A 4EZSA 2F7QA 3D2FA 3Q0KA 1HXKA 3VKHA 2EFKA 4KIKB 3DPPA 2YL6A 4HR1B 4JWEA 1SU7A 4NPHA 4AZCB 1GNTA 2YI8A 3VEBA 3EJRA 3HAIA 1TQTA 1ZWWA 4AZ6A 4EZQA 2JNSA 4JLCA 1URUA 4AZIA 3DDFA 1SU6A 1TQVA 1QWNA 3ERCC 3BVXA 4IM0A 3CVRA 4JNEA 4ATMA 3OK8A 2WYIA 1E9VA 1DKXA 1QWUA 2Z8YA 3LLLA 5C5BB 3D2EA 4D8JA 3EJTA 1E2UA 2LXYA 2Z0VA 4IM3A 1E1DA 2GF4A 2F1AA 3O3MB 2YI9A 3C7NA 1GNLA 3ER8C 3DX2A 2YLLA 3DX0A 4UDYX 2GA9D 2Q13A 3DPQA 3B51X 3BUPA 5FLEX 1SU8A 2YIAA 4AVMA 3CV5A 3ZEDA 3DYTA 3I2WA 3T47A 3I04A 4AZBA 3RPMA 1I4LA 3KDRA 2OO2A 4G6QA 3ER9B 2X3WA 2MI7A 3BVUA 3D52A 4H8SA 2ZXQA 2JNKA 3QNIA 3CZNA 3G9GA 5TKYA 4H6IA 1I4DA 3HAJA 3FD9A 3BUBA 3EJPA 4FZPA 4FZSA 1LQ7A 4AZ7A 2YLAA 5E84A 2WINM 2X5CA 2V0OA 3ACOA 3DX1A 3T46A 4KIKA 1PS3A 4HR1A 2EWFA 4R5JA 4AZCA 2ND0A 3QA8A 3QWEA 4EZOA 3DDGA 1I49A 5FIGA 2D4CA 3BVTA 4EZRA 3CAZA 2LM0A 4EZWA 3BUDA 4HY9A 4JWIA 4EZVA 2NCZA 3QE6A 1MJGA 2F7RA 3SYVA 2FYVA 3LMFA 2X3XA 2Q12A 4BNEA 3T48A 2YIBA 3L3PA 1GN9A 3CZSA 4JWDA 5C5BA 3RV1A 2OBMA 2OW7A 1X04A 3ABHA 3O3NB 1R34A 3BUIA 1DKZA 4JL9A 4EZXA 2FICA 4AZHA 2RAKA 3QNJA 4DCNC 3D4YA 1X03A 2OZNB 2RAJA 4EZUA 3LVTA 4EZYA 4F01A 4R5GA 1TQWA 3DPOA 3M3WA 4PO2A 4JNFA 2YL5A 3BLBA 1HTYA 4EZTA 3CKDA 1ZYLA 3SOGA 2N3KA 2Z0NA 4EZNA 4R5LA 2F18A 4IWOA 1JQKA 2F7PA 3VEAA 3DX4A 2OW6A 2KHOA 4NQIA 2Z0OA 3UITA 1R5EA 4AKVA 2O0I1 2D1LA 4F00A 4AZ5A 4JWCA 3D50A 1TQUA 2YL8A 3EJUA 3F7WA 4JN4A 1OA0A 1DKYA 2YIVX 4NSWA 4DYLA 2WYHA 1HWWA 3L3OM 4R5IA 3D4ZA 3BUQA 3B53X 3BVVA 4M0MA 4FM3A 4WPCA 3OHXM 4HYBA 1U00A 3RV0A 4EZZA 1QX1A 2X3VA 2EX3B 2ND1A 4IWQA 2RT6A 3KAVA 5KBPA 1WDZA 4H6HA 1UPXA 4AZGA 3BVWA 3HAHA 4I1QA
chains in the Genus database with same CATH topology
2X3WA 4H8SA 5C5BB 4NSWA 4AVMA 2D1LA 1URUA 2FICA 4DYLA 1I4TA 2ELBA 1Y2OA 2RAKA 3DYTA 4DCNC 2V0OA 3I2WA 4WPEA 3ACOA 3QNIA 5C5BA 3G9GA 2Z0VA 1X03A 3Q84A 2YKTA 3SOGA 1I4DA 3HAJA 2Z0NA 2RAJA 3QE6A 3HAIA 3Q0KA 1WDZA 2C08A 3PLTA 4WPCA 4ATMA 3SYVA 1X04A 1ZWWA 2RAIA 3OK8A 3QWEA 1I49A 3ABHA 4FZSA 2D4CA 1I4LA 2Q13A 4NQIA 2Z0OA 2X3XA 3LLLA 2EFLA 2Q12A 3CAZA 3HAHA 3M3WA 4BNEA 2X3VA 2EFKA 4AKVA 4I1QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X3W A;  4H8S A;  5C5B B;  4NSW A;  4AVM A;  2D1L A;  1URU A;  2FIC A;  4DYL A;  1I4T A;  2ELB A;  1Y2O A;  2RAK A;  3DYT A;  4DCN C;  2V0O A;  3I2W A;  4WPE A;  3ACO A;  3QNI A;  5C5B A;  3G9G A;  2Z0V A;  1X03 A;  3Q84 A;  2YKT A;  3SOG A;  1I4D A;  3HAJ A;  2Z0N A;  2RAJ A;  3QE6 A;  3HAI A;  3Q0K A;  1WDZ A;  2C08 A;  3PLT A;  4WPC A;  4ATM A;  3SYV A;  1X04 A;  1ZWW A;  2RAI A;  3OK8 A;  3QWE A;  1I49 A;  3ABH A;  4FZS A;  2D4C A;  1I4L A;  2Q13 A;  4NQI A;  2Z0O A;  2X3X A;  3LLL A;  2EFL A;  2Q12 A;  3CAZ A;  3HAH A;  3M3W A;  4BNE A;  2X3V A;  2EFK A;  4AKV A;  4I1Q A; 
#chains in the Genus database with same CATH topology
 3EJQ A;  2QKW A;  1R33 A;  1I4T A;  2GAF D;  1Y2O A;  4WPE A;  4E81 A;  4IWP A;  1YWM A;  3KAW A;  2C08 A;  2PY6 A;  3D51 A;  2QFF A;  3I39 X;  3O3O B;  3EJS A;  4IM2 A;  4FZO A;  4R5K A;  3A98 A;  4UDX X;  1O7D C;  3T4A G;  2ELB A;  3DX3 A;  4EZP A;  4B9Q A;  3B52 X;  2PMR A;  1W9M A;  1OAO A;  3PLT A;  4E3C A;  2RAI A;  1SUF A;  2QXL A;  2EFL A;  2ALW A;  2F1B A;  3I01 A;  2OBL A;  3OWG A;  2F7O A;  4IW0 A;  1TQS A;  3Q84 A;  1O7D B;  2YKT A;  3GI7 A;  1OA1 A;  2YL9 A;  3T49 A;  4EZS A;  2F7Q A;  3D2F A;  3Q0K A;  1HXK A;  3VKH A;  2EFK A;  4KIK B;  3DPP A;  2YL6 A;  4HR1 B;  4JWE A;  1SU7 A;  4NPH A;  4AZC B;  1GNT A;  2YI8 A;  3VEB A;  3EJR A;  3HAI A;  1TQT A;  1ZWW A;  4AZ6 A;  4EZQ A;  2JNS A;  4JLC A;  1URU A;  4AZI A;  3DDF A;  1SU6 A;  1TQV A;  1QWN A;  3ERC C;  3BVX A;  4IM0 A;  3CVR A;  4JNE A;  4ATM A;  3OK8 A;  2WYI A;  1E9V A;  1DKX A;  1QWU A;  2Z8Y A;  3LLL A;  5C5B B;  3D2E A;  4D8J A;  3EJT A;  1E2U A;  2LXY A;  2Z0V A;  4IM3 A;  1E1D A;  2GF4 A;  2F1A A;  3O3M B;  2YI9 A;  3C7N A;  1GNL A;  3ER8 C;  3DX2 A;  2YLL A;  3DX0 A;  4UDY X;  2GA9 D;  2Q13 A;  3DPQ A;  3B51 X;  3BUP A;  5FLE X;  1SU8 A;  2YIA A;  4AVM A;  3CV5 A;  3ZED A;  3DYT A;  3I2W A;  3T47 A;  3I04 A;  4AZB A;  3RPM A;  1I4L A;  3KDR A;  2OO2 A;  4G6Q A;  3ER9 B;  2X3W A;  2MI7 A;  3BVU A;  3D52 A;  4H8S A;  2ZXQ A;  2JNK A;  3QNI A;  3CZN A;  3G9G A;  5TKY A;  4H6I A;  1I4D A;  3HAJ A;  3FD9 A;  3BUB A;  3EJP A;  4FZP A;  4FZS A;  1LQ7 A;  4AZ7 A;  2YLA A;  5E84 A;  2WIN M;  2X5C A;  2V0O A;  3ACO A;  3DX1 A;  3T46 A;  4KIK A;  1PS3 A;  4HR1 A;  2EWF A;  4R5J A;  4AZC A;  2ND0 A;  3QA8 A;  3QWE A;  4EZO A;  3DDG A;  1I49 A;  5FIG A;  2D4C A;  3BVT A;  4EZR A;  3CAZ A;  2LM0 A;  4EZW A;  3BUD A;  4HY9 A;  4JWI A;  4EZV A;  2NCZ A;  3QE6 A;  1MJG A;  2F7R A;  3SYV A;  2FYV A;  3LMF A;  2X3X A;  2Q12 A;  4BNE A;  3T48 A;  2YIB A;  3L3P A;  1GN9 A;  3CZS A;  4JWD A;  5C5B A;  3RV1 A;  2OBM A;  2OW7 A;  1X04 A;  3ABH A;  3O3N B;  1R34 A;  3BUI A;  1DKZ A;  4JL9 A;  4EZX A;  2FIC A;  4AZH A;  2RAK A;  3QNJ A;  4DCN C;  3D4Y A;  1X03 A;  2OZN B;  2RAJ A;  4EZU A;  3LVT A;  4EZY A;  4F01 A;  4R5G A;  1TQW A;  3DPO A;  3M3W A;  4PO2 A;  4JNF A;  2YL5 A;  3BLB A;  1HTY A;  4EZT A;  3CKD A;  1ZYL A;  3SOG A;  2N3K A;  2Z0N A;  4EZN A;  4R5L A;  2F18 A;  4IWO A;  1JQK A;  2F7P A;  3VEA A;  3DX4 A;  2OW6 A;  2KHO A;  4NQI A;  2Z0O A;  3UIT A;  1R5E A;  4AKV A;  2O0I 1;  2D1L A;  4F00 A;  4AZ5 A;  4JWC A;  3D50 A;  1TQU A;  2YL8 A;  3EJU A;  3F7W A;  4JN4 A;  1OA0 A;  1DKY A;  2YIV X;  4NSW A;  4DYL A;  2WYH A;  1HWW A;  3L3O M;  4R5I A;  3D4Z A;  3BUQ A;  3B53 X;  3BVV A;  4M0M A;  4FM3 A;  4WPC A;  3OHX M;  4HYB A;  1U00 A;  3RV0 A;  4EZZ A;  1QX1 A;  2X3V A;  2EX3 B;  2ND1 A;  4IWQ A;  2RT6 A;  3KAV A;  5KBP A;  1WDZ A;  4H6H A;  1UPX A;  4AZG A;  3BVW A;  3HAH A;  4I1Q A; 
#chains in the Genus database with same CATH homology
 2X3W A;  4H8S A;  5C5B B;  4NSW A;  4AVM A;  2D1L A;  1URU A;  2FIC A;  4DYL A;  1I4T A;  2ELB A;  1Y2O A;  2RAK A;  3DYT A;  4DCN C;  2V0O A;  3I2W A;  4WPE A;  3ACO A;  3QNI A;  5C5B A;  3G9G A;  2Z0V A;  1X03 A;  3Q84 A;  2YKT A;  3SOG A;  1I4D A;  3HAJ A;  2Z0N A;  2RAJ A;  3QE6 A;  3HAI A;  3Q0K A;  1WDZ A;  2C08 A;  3PLT A;  4WPC A;  4ATM A;  3SYV A;  1X04 A;  1ZWW A;  2RAI A;  3OK8 A;  3QWE A;  1I49 A;  3ABH A;  4FZS A;  2D4C A;  1I4L A;  2Q13 A;  4NQI A;  2Z0O A;  2X3X A;  3LLL A;  2EFL A;  2Q12 A;  3CAZ A;  3HAH A;  3M3W A;  4BNE A;  2X3V A;  2EFK A;  4AKV A;  4I1Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...