4NQIA

Structure of the n-terminal i-bar domain (1-259) of d.discoideum ibara
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
230
structure length
220
Chain Sequence
NPVIEITLKTINNLKVNSPPLFTEVIKAANKYQQQAQALSQAGLVLADTLTRLTIHNGGDFGEGFKKLADAIKDLENRRDDVAKVLLNEFITPNKQAIEDDQKAIATFEKNYKKDRDQMRQDILKLEAKTRKAGKITELNDKIKESEQLNANKLRDVVLMERRKHATFLSQFNQFLEKEIELSADTMSKFSTNLNTHRDLINSQSQLPLEMESMISKQER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SH3 domain-containing protein
publication title The inverse BAR domain protein IBARa drives membrane remodeling to control osmoregulation, phagocytosis and cytokinesis.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Signaling protein
total genus 92
structure length 220
sequence length 230
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08397 IMD IRSp53/MIM homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 4nqiA00
3ABHA 2D4CA 1X03A 3CAZA 3OK8A 3QWEA 4AVMA 3ACOA 4WPCA 2Z0NA 1Y2OA 2Z0OA 3HAHA 2X3XA 1I49A 2Q13A 2ELBA 2EFKA 1I4DA 2RAKA 3I2WA 3DYTA 3QE6A 2X3VA 4I1QA 3HAJA 1X04A 1URUA 2X3WA 2YKTA 1I4TA 1I4LA 5C5BA 2EFLA 4ATMA 3HAIA 2V0OA 4NQIA 5C5BB 4H8SA 4NSWA 4DYLA 2Z0VA 4FZSA 4WPEA 3G9GA 3PLTA 2Q12A 2C08A 3SOGA 3QNIA 3M3WA 4BNEA 4DCNC 2FICA 1ZWWA 2D1LA 3LLLA 3Q0KA 1WDZA 4AKVA 3SYVA 2RAJA 3Q84A 2RAIA
chains in the Genus database with same CATH superfamily
4HY9A 2YI9A 2Z8YA 2ND1A 1TQUA 3FD9A 3B52X 2Q13A 4HR1B 3I2WA 2PY6A 3RV1A 3VEBA 4IWQA 4JNFA 2LXYA 3DPPA 4AZIA 4AZBA 2RT6A 3T49A 4AZCA 2X5CA 1DKZA 1HWWA 4E81A 3ZEDA 5C5BA 2EFLA 3L3PA 3D4YA 3BUPA 4IW0A 1SU6A 2FICA 2D1LA 2YI8A 1DKYA 3QNJA 2YKTA 3DPOA 2YL9A 4AVMA 1W9MA 4HR1A 3BVWA 3BUDA 4EZOA 1I4DA 3QE6A 4IWPA 1GN9A 4I1QA 4EZZA 2OBLA 2QXLA 4ATMA 3OWGA 4H8SA 2Q12A 2GAFD 4BNEA 3KDRA 3LLLA 3QA8A 4EZPA 2FYVA 1LQ7A 4HYBA 4B9QA 2WYHA 3T4AG 1R34A 4FM3A 3BVTA 1O7DB 3EJQA 4DYLA 2F7PA 5E84A 1SU7A 2F7OA 4JNEA 3DX4A 3CZSA 3VEAA 4EZUA 4FZOA 1SUFA 4UDYX 1TQWA 4JL9A 2RAKA 1TQVA 3DYTA 1ZYLA 3CKDA 2F18A 3HAIA 3D52A 1QWUA 3F7WA 2JNKA 3BVUA 4KIKB 4EZTA 1QX1A 1GNLA 3EJUA 4JWCA 4R5IA 3D4ZA 3O3NB 3ER9B 3CV5A 2GA9D 4IM3A 4EZNA 2ALWA 1MJGA 3QNIA 1ZWWA 3EJRA 2OZNB 1HTYA 4R5JA 1X03A 3QWEA 4D8JA 3C7NA 3I01A 2Z0OA 3CZNA 1I49A 2EFKA 4JN4A 2EX3B 2PMRA 4R5GA 2QKWA 2NCZA 3O3MB 3D2EA 4F01A 3DDFA 4KIKA 3B51X 1TQTA 3DX1A 3OK8A 3ACOA 1PS3A 5KBPA 2YLAA 2GF4A 1DKXA 3O3OB 2F7QA 3LVTA 2MI7A 3I39X 3T46A 3OHXM 4JWIA 2ELBA 4UDXX 5TKYA 1URUA 1O7DC 4AZ5A 4EZSA 3Q0KA 1WDZA 4AKVA 3BVXA 4JWEA 2JNSA 3GI7A 1HXKA 4IM2A 2X3VA 3HAJA 4EZRA 2F7RA 4AZGA 4M0MA 4WPEA 2OBMA 2RAJA 3BUIA 4AZCB 2OO2A 3T47A 2X3WA 1I4TA 4R5LA 3BUQA 2V0OA 4EZVA 2N3KA 3D51A 3BVVA 4PO2A 2LM0A 3ERCC 4WPCA 1Y2OA 3HAHA 1R5EA 1JQKA 1GNTA 1X04A 4AZ7A 3ER8C 1OA0A 4F00A 3KAWA 1QWNA 4FZPA 3D2FA 2OW7A 2YIBA 3G9GA 5FLEX 2WYIA 2C08A 4E3CA 3DX2A 1SU8A 3EJSA 3Q84A 2QFFA 2D4CA 2OW6A 1E2UA 2Z0NA 3RPMA 3DPQA 2YL8A 2EWFA 4EZYA 2O0I1 1E9VA 3VKHA 4H6HA 3DX3A 3CVRA 4AZHA 4JLCA 4NPHA 3LMFA 2YLLA 3CAZA 3BLBA 2X3XA 3I04A 2YL5A 1E1DA 3BUBA 1R33A 2F1BA 3DDGA 1OAOA 3RV0A 3DX0A 1I4LA 4JWDA 3KAVA 4G6QA 4R5KA 2KHOA 4FZSA 3L3OM 2ZXQA 4DCNC 2ND0A 3EJTA 3SYVA 2F1AA 4AZ6A 4EZQA 4EZWA 2YL6A 3A98A 4EZXA 5FIGA 2WINM 1YWMA 3EJPA 3D50A 4NQIA 2Z0VA 4IM0A 1U00A 3PLTA 1TQSA 1OA1A 2RAIA 1UPXA 3ABHA 2YIVX 4H6IA 3UITA 3T48A 5C5BB 4NSWA 2YIAA 4IWOA 3SOGA 3M3WA 3B53X
chains in the Genus database with same CATH topology
3ABHA 2D4CA 1X03A 3CAZA 3OK8A 3QWEA 4AVMA 3ACOA 4WPCA 2Z0NA 1Y2OA 2Z0OA 3HAHA 2X3XA 1I49A 2Q13A 2ELBA 2EFKA 1I4DA 2RAKA 3I2WA 3DYTA 3QE6A 2X3VA 4I1QA 3HAJA 1X04A 1URUA 2X3WA 2YKTA 1I4TA 1I4LA 5C5BA 2EFLA 4ATMA 3HAIA 2V0OA 4NQIA 5C5BB 4H8SA 4NSWA 4DYLA 2Z0VA 4FZSA 4WPEA 3G9GA 3PLTA 2Q12A 2C08A 3SOGA 3QNIA 3M3WA 4BNEA 4DCNC 2FICA 1ZWWA 2D1LA 3LLLA 3Q0KA 1WDZA 4AKVA 3SYVA 2RAJA 3Q84A 2RAIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ABH A;  2D4C A;  1X03 A;  3CAZ A;  3OK8 A;  3QWE A;  4AVM A;  3ACO A;  4WPC A;  2Z0N A;  1Y2O A;  2Z0O A;  3HAH A;  2X3X A;  1I49 A;  2Q13 A;  2ELB A;  2EFK A;  1I4D A;  2RAK A;  3I2W A;  3DYT A;  3QE6 A;  2X3V A;  4I1Q A;  3HAJ A;  1X04 A;  1URU A;  2X3W A;  2YKT A;  1I4T A;  1I4L A;  5C5B A;  2EFL A;  4ATM A;  3HAI A;  2V0O A;  4NQI A;  5C5B B;  4H8S A;  4NSW A;  4DYL A;  2Z0V A;  4FZS A;  4WPE A;  3G9G A;  3PLT A;  2Q12 A;  2C08 A;  3SOG A;  3QNI A;  3M3W A;  4BNE A;  4DCN C;  2FIC A;  1ZWW A;  2D1L A;  3LLL A;  3Q0K A;  1WDZ A;  4AKV A;  3SYV A;  2RAJ A;  3Q84 A;  2RAI A; 
#chains in the Genus database with same CATH topology
 4HY9 A;  2YI9 A;  2Z8Y A;  2ND1 A;  1TQU A;  3FD9 A;  3B52 X;  2Q13 A;  4HR1 B;  3I2W A;  2PY6 A;  3RV1 A;  3VEB A;  4IWQ A;  4JNF A;  2LXY A;  3DPP A;  4AZI A;  4AZB A;  2RT6 A;  3T49 A;  4AZC A;  2X5C A;  1DKZ A;  1HWW A;  4E81 A;  3ZED A;  5C5B A;  2EFL A;  3L3P A;  3D4Y A;  3BUP A;  4IW0 A;  1SU6 A;  2FIC A;  2D1L A;  2YI8 A;  1DKY A;  3QNJ A;  2YKT A;  3DPO A;  2YL9 A;  4AVM A;  1W9M A;  4HR1 A;  3BVW A;  3BUD A;  4EZO A;  1I4D A;  3QE6 A;  4IWP A;  1GN9 A;  4I1Q A;  4EZZ A;  2OBL A;  2QXL A;  4ATM A;  3OWG A;  4H8S A;  2Q12 A;  2GAF D;  4BNE A;  3KDR A;  3LLL A;  3QA8 A;  4EZP A;  2FYV A;  1LQ7 A;  4HYB A;  4B9Q A;  2WYH A;  3T4A G;  1R34 A;  4FM3 A;  3BVT A;  1O7D B;  3EJQ A;  4DYL A;  2F7P A;  5E84 A;  1SU7 A;  2F7O A;  4JNE A;  3DX4 A;  3CZS A;  3VEA A;  4EZU A;  4FZO A;  1SUF A;  4UDY X;  1TQW A;  4JL9 A;  2RAK A;  1TQV A;  3DYT A;  1ZYL A;  3CKD A;  2F18 A;  3HAI A;  3D52 A;  1QWU A;  3F7W A;  2JNK A;  3BVU A;  4KIK B;  4EZT A;  1QX1 A;  1GNL A;  3EJU A;  4JWC A;  4R5I A;  3D4Z A;  3O3N B;  3ER9 B;  3CV5 A;  2GA9 D;  4IM3 A;  4EZN A;  2ALW A;  1MJG A;  3QNI A;  1ZWW A;  3EJR A;  2OZN B;  1HTY A;  4R5J A;  1X03 A;  3QWE A;  4D8J A;  3C7N A;  3I01 A;  2Z0O A;  3CZN A;  1I49 A;  2EFK A;  4JN4 A;  2EX3 B;  2PMR A;  4R5G A;  2QKW A;  2NCZ A;  3O3M B;  3D2E A;  4F01 A;  3DDF A;  4KIK A;  3B51 X;  1TQT A;  3DX1 A;  3OK8 A;  3ACO A;  1PS3 A;  5KBP A;  2YLA A;  2GF4 A;  1DKX A;  3O3O B;  2F7Q A;  3LVT A;  2MI7 A;  3I39 X;  3T46 A;  3OHX M;  4JWI A;  2ELB A;  4UDX X;  5TKY A;  1URU A;  1O7D C;  4AZ5 A;  4EZS A;  3Q0K A;  1WDZ A;  4AKV A;  3BVX A;  4JWE A;  2JNS A;  3GI7 A;  1HXK A;  4IM2 A;  2X3V A;  3HAJ A;  4EZR A;  2F7R A;  4AZG A;  4M0M A;  4WPE A;  2OBM A;  2RAJ A;  3BUI A;  4AZC B;  2OO2 A;  3T47 A;  2X3W A;  1I4T A;  4R5L A;  3BUQ A;  2V0O A;  4EZV A;  2N3K A;  3D51 A;  3BVV A;  4PO2 A;  2LM0 A;  3ERC C;  4WPC A;  1Y2O A;  3HAH A;  1R5E A;  1JQK A;  1GNT A;  1X04 A;  4AZ7 A;  3ER8 C;  1OA0 A;  4F00 A;  3KAW A;  1QWN A;  4FZP A;  3D2F A;  2OW7 A;  2YIB A;  3G9G A;  5FLE X;  2WYI A;  2C08 A;  4E3C A;  3DX2 A;  1SU8 A;  3EJS A;  3Q84 A;  2QFF A;  2D4C A;  2OW6 A;  1E2U A;  2Z0N A;  3RPM A;  3DPQ A;  2YL8 A;  2EWF A;  4EZY A;  2O0I 1;  1E9V A;  3VKH A;  4H6H A;  3DX3 A;  3CVR A;  4AZH A;  4JLC A;  4NPH A;  3LMF A;  2YLL A;  3CAZ A;  3BLB A;  2X3X A;  3I04 A;  2YL5 A;  1E1D A;  3BUB A;  1R33 A;  2F1B A;  3DDG A;  1OAO A;  3RV0 A;  3DX0 A;  1I4L A;  4JWD A;  3KAV A;  4G6Q A;  4R5K A;  2KHO A;  4FZS A;  3L3O M;  2ZXQ A;  4DCN C;  2ND0 A;  3EJT A;  3SYV A;  2F1A A;  4AZ6 A;  4EZQ A;  4EZW A;  2YL6 A;  3A98 A;  4EZX A;  5FIG A;  2WIN M;  1YWM A;  3EJP A;  3D50 A;  4NQI A;  2Z0V A;  4IM0 A;  1U00 A;  3PLT A;  1TQS A;  1OA1 A;  2RAI A;  1UPX A;  3ABH A;  2YIV X;  4H6I A;  3UIT A;  3T48 A;  5C5B B;  4NSW A;  2YIA A;  4IWO A;  3SOG A;  3M3W A;  3B53 X; 
#chains in the Genus database with same CATH homology
 3ABH A;  2D4C A;  1X03 A;  3CAZ A;  3OK8 A;  3QWE A;  4AVM A;  3ACO A;  4WPC A;  2Z0N A;  1Y2O A;  2Z0O A;  3HAH A;  2X3X A;  1I49 A;  2Q13 A;  2ELB A;  2EFK A;  1I4D A;  2RAK A;  3I2W A;  3DYT A;  3QE6 A;  2X3V A;  4I1Q A;  3HAJ A;  1X04 A;  1URU A;  2X3W A;  2YKT A;  1I4T A;  1I4L A;  5C5B A;  2EFL A;  4ATM A;  3HAI A;  2V0O A;  4NQI A;  5C5B B;  4H8S A;  4NSW A;  4DYL A;  2Z0V A;  4FZS A;  4WPE A;  3G9G A;  3PLT A;  2Q12 A;  2C08 A;  3SOG A;  3QNI A;  3M3W A;  4BNE A;  4DCN C;  2FIC A;  1ZWW A;  2D1L A;  3LLL A;  3Q0K A;  1WDZ A;  4AKV A;  3SYV A;  2RAJ A;  3Q84 A;  2RAI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...