4NQIA

Structure of the n-terminal i-bar domain (1-259) of d.discoideum ibara
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
230
structure length
220
Chain Sequence
NPVIEITLKTINNLKVNSPPLFTEVIKAANKYQQQAQALSQAGLVLADTLTRLTIHNGGDFGEGFKKLADAIKDLENRRDDVAKVLLNEFITPNKQAIEDDQKAIATFEKNYKKDRDQMRQDILKLEAKTRKAGKITELNDKIKESEQLNANKLRDVVLMERRKHATFLSQFNQFLEKEIELSADTMSKFSTNLNTHRDLINSQSQLPLEMESMISKQER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SH3 domain-containing protein
publication title The inverse BAR domain protein IBARa drives membrane remodeling to control osmoregulation, phagocytosis and cytokinesis.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Signaling protein
total genus 92
structure length 220
sequence length 230
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08397 IMD IRSp53/MIM homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 4nqiA00
3OK8A 3G9GA 4AVMA 4H8SA 4DCNC 4NQIA 3QE6A 2C08A 3Q0KA 3HAHA 3ACOA 3Q84A 4FZSA 3HAIA 2FICA 2Q13A 2X3XA 3SOGA 2RAIA 3QWEA 2ELBA 4NSWA 3SYVA 4AKVA 2V0OA 3ABHA 2D4CA 1I49A 4I1QA 5C5BB 1X03A 2D1LA 2Z0NA 2RAJA 5C5BA 3PLTA 2Z0OA 1I4LA 2EFLA 1URUA 1ZWWA 2EFKA 1I4TA 3DYTA 3QNIA 1WDZA 2RAKA 4ATMA 4BNEA 1I4DA 4WPEA 3M3WA 4WPCA 2X3VA 3I2WA 4DYLA 2Z0VA 2X3WA 1Y2OA 3LLLA 1X04A 2Q12A 3CAZA 3HAJA 2YKTA
chains in the Genus database with same CATH superfamily
2LXYA 4AZHA 3OK8A 3DX0A 3L3OM 3G9GA 3D50A 3ER9B 2F18A 3BUPA 2RAJA 3UITA 4IWPA 2OW6A 3C7NA 4EZPA 3RV0A 3VKHA 2YIBA 4JWCA 3LVTA 4EZUA 4AZCB 1DKYA 4HR1A 3EJPA 2YL9A 2GAFD 4M0MA 2GF4A 1QX1A 1E2UA 4EZYA 1U00A 1MJGA 3DX2A 3QE6A 4E81A 3QWEA 1W9MA 4AZIA 3D4ZA 1DKZA 3PLTA 3D4YA 2EFKA 3BLBA 1TQUA 3DYTA 4JN4A 2RAKA 4ATMA 4EZSA 3I2WA 3BVWA 3HAJA 1O7DB 3D2FA 2O0I1 3QA8A 1R34A 4EZQA 3O3NB 2ND0A 4JWDA 3T49A 4JWEA 1OA1A 3B51X 2LM0A 4DCNC 3BVUA 1UPXA 3EJTA 4JNEA 4R5KA 1GN9A 3SYVA 4KIKB 2V0OA 3DPQA 4IWOA 1X03A 1GNTA 2ALWA 1ZWWA 2YL8A 3BVXA 3F7WA 1HWWA 1SUFA 5KBPA 4EZVA 3CAZA 3ZEDA 4EZXA 1YWMA 2X5CA 2F7PA 2F7QA 1E9VA 3L3PA 3ER8C 2KHOA 3T4AG 3CVRA 3RV1A 4UDYX 4WPCA 3BUDA 3OWGA 2YI8A 2OZNB 1TQVA 4IM0A 2C08A 2YLAA 3SOGA 5FIGA 1OA0A 1QWNA 1GNLA 2ND1A 5C5BA 2QXLA 1URUA 3EJQA 3QNIA 1I4DA 1JQKA 3RPMA 2RT6A 4NPHA 3A98A 3D52A 3I04A 2EX3B 3EJRA 2X3XA 3DPOA 2WINM 3I01A 2YL5A 3CZNA 1Y2OA 1X04A 4AZGA 2RAIA 3ERCC 3EJSA 4UDXX 2F7RA 2YIVX 4R5JA 3D51A 4AZCA 1E1DA 1QWUA 4IM3A 1WDZA 4DYLA 4FZOA 3DX4A 2YKTA 4AZBA 2GA9D 4AZ7A 2WYIA 1HTYA 2YIAA 2QFFA 2YL6A 3QNJA 3D2EA 4BNEA 4FM3A 1TQTA 2F1AA 1TQSA 4R5IA 2X3WA 3OHXM 2Q12A 2PMRA 2OO2A 5FLEX 3BUQA 3HAHA 4FZSA 2Q13A 3VEBA 3ABHA 4I1QA 4AZ5A 1HXKA 4JLCA 4R5LA 4WPEA 2JNKA 1PS3A 2MI7A 2JNSA 3KAWA 2F1BA 3T47A 4PO2A 2NCZA 3B53X 2F7OA 2ELBA 5E84A 3DX1A 1ZYLA 4EZZA 4KIKA 1I49A 2WYHA 4H6IA 2N3KA 4B9QA 4IW0A 3FD9A 3DPPA 1OAOA 4EZTA 2YLLA 4EZWA 3LMFA 2OBMA 4JWIA 3O3MB 3Q0KA 4R5GA 3HAIA 2QKWA 4EZOA 4EZRA 3B52X 2D4CA 4JL9A 2D1LA 3GI7A 3KDRA 4D8JA 4AZ6A 3T46A 2Z0OA 3KAVA 4IWQA 3LLLA 2OBLA 1SU8A 2FYVA 4NQIA 2YI9A 3DDFA 4NSWA 4IM2A 4G6QA 4AKVA 1R33A 3BVVA 2Z0NA 4F01A 3T48A 2EFLA 1DKXA 5TKYA 4HY9A 4EZNA 2Z0VA 1LQ7A 3VEAA 1R5EA 3ACOA 3Q84A 2ZXQA 4E3CA 4H6HA 1SU6A 1SU7A 4HYBA 1O7DC 2Z8YA 4F00A 3DDGA 3I39X 2X3VA 2PY6A 3CV5A 3CZSA 3BUIA 4AVMA 4H8SA 3BUBA 2FICA 4FZPA 3BVTA 3CKDA 5C5BB 3O3OB 2EWFA 2OW7A 4HR1B 3DX3A 1I4LA 1I4TA 3EJUA 3M3WA 1TQWA 4JNFA
chains in the Genus database with same CATH topology
3OK8A 3G9GA 4AVMA 4H8SA 4DCNC 4NQIA 3QE6A 2C08A 3Q0KA 3HAHA 3ACOA 3Q84A 4FZSA 3HAIA 2FICA 2Q13A 2X3XA 3SOGA 2RAIA 3QWEA 2ELBA 4NSWA 3SYVA 4AKVA 2V0OA 3ABHA 2D4CA 1I49A 4I1QA 5C5BB 1X03A 2D1LA 2Z0NA 2RAJA 5C5BA 3PLTA 2Z0OA 1I4LA 2EFLA 1URUA 1ZWWA 2EFKA 1I4TA 3DYTA 3QNIA 1WDZA 2RAKA 4ATMA 4BNEA 1I4DA 4WPEA 3M3WA 4WPCA 2X3VA 3I2WA 4DYLA 2Z0VA 2X3WA 1Y2OA 3LLLA 1X04A 2Q12A 3CAZA 3HAJA 2YKTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OK8 A;  3G9G A;  4AVM A;  4H8S A;  4DCN C;  4NQI A;  3QE6 A;  2C08 A;  3Q0K A;  3HAH A;  3ACO A;  3Q84 A;  4FZS A;  3HAI A;  2FIC A;  2Q13 A;  2X3X A;  3SOG A;  2RAI A;  3QWE A;  2ELB A;  4NSW A;  3SYV A;  4AKV A;  2V0O A;  3ABH A;  2D4C A;  1I49 A;  4I1Q A;  5C5B B;  1X03 A;  2D1L A;  2Z0N A;  2RAJ A;  5C5B A;  3PLT A;  2Z0O A;  1I4L A;  2EFL A;  1URU A;  1ZWW A;  2EFK A;  1I4T A;  3DYT A;  3QNI A;  1WDZ A;  2RAK A;  4ATM A;  4BNE A;  1I4D A;  4WPE A;  3M3W A;  4WPC A;  2X3V A;  3I2W A;  4DYL A;  2Z0V A;  2X3W A;  1Y2O A;  3LLL A;  1X04 A;  2Q12 A;  3CAZ A;  3HAJ A;  2YKT A; 
#chains in the Genus database with same CATH topology
 2LXY A;  4AZH A;  3OK8 A;  3DX0 A;  3L3O M;  3G9G A;  3D50 A;  3ER9 B;  2F18 A;  3BUP A;  2RAJ A;  3UIT A;  4IWP A;  2OW6 A;  3C7N A;  4EZP A;  3RV0 A;  3VKH A;  2YIB A;  4JWC A;  3LVT A;  4EZU A;  4AZC B;  1DKY A;  4HR1 A;  3EJP A;  2YL9 A;  2GAF D;  4M0M A;  2GF4 A;  1QX1 A;  1E2U A;  4EZY A;  1U00 A;  1MJG A;  3DX2 A;  3QE6 A;  4E81 A;  3QWE A;  1W9M A;  4AZI A;  3D4Z A;  1DKZ A;  3PLT A;  3D4Y A;  2EFK A;  3BLB A;  1TQU A;  3DYT A;  4JN4 A;  2RAK A;  4ATM A;  4EZS A;  3I2W A;  3BVW A;  3HAJ A;  1O7D B;  3D2F A;  2O0I 1;  3QA8 A;  1R34 A;  4EZQ A;  3O3N B;  2ND0 A;  4JWD A;  3T49 A;  4JWE A;  1OA1 A;  3B51 X;  2LM0 A;  4DCN C;  3BVU A;  1UPX A;  3EJT A;  4JNE A;  4R5K A;  1GN9 A;  3SYV A;  4KIK B;  2V0O A;  3DPQ A;  4IWO A;  1X03 A;  1GNT A;  2ALW A;  1ZWW A;  2YL8 A;  3BVX A;  3F7W A;  1HWW A;  1SUF A;  5KBP A;  4EZV A;  3CAZ A;  3ZED A;  4EZX A;  1YWM A;  2X5C A;  2F7P A;  2F7Q A;  1E9V A;  3L3P A;  3ER8 C;  2KHO A;  3T4A G;  3CVR A;  3RV1 A;  4UDY X;  4WPC A;  3BUD A;  3OWG A;  2YI8 A;  2OZN B;  1TQV A;  4IM0 A;  2C08 A;  2YLA A;  3SOG A;  5FIG A;  1OA0 A;  1QWN A;  1GNL A;  2ND1 A;  5C5B A;  2QXL A;  1URU A;  3EJQ A;  3QNI A;  1I4D A;  1JQK A;  3RPM A;  2RT6 A;  4NPH A;  3A98 A;  3D52 A;  3I04 A;  2EX3 B;  3EJR A;  2X3X A;  3DPO A;  2WIN M;  3I01 A;  2YL5 A;  3CZN A;  1Y2O A;  1X04 A;  4AZG A;  2RAI A;  3ERC C;  3EJS A;  4UDX X;  2F7R A;  2YIV X;  4R5J A;  3D51 A;  4AZC A;  1E1D A;  1QWU A;  4IM3 A;  1WDZ A;  4DYL A;  4FZO A;  3DX4 A;  2YKT A;  4AZB A;  2GA9 D;  4AZ7 A;  2WYI A;  1HTY A;  2YIA A;  2QFF A;  2YL6 A;  3QNJ A;  3D2E A;  4BNE A;  4FM3 A;  1TQT A;  2F1A A;  1TQS A;  4R5I A;  2X3W A;  3OHX M;  2Q12 A;  2PMR A;  2OO2 A;  5FLE X;  3BUQ A;  3HAH A;  4FZS A;  2Q13 A;  3VEB A;  3ABH A;  4I1Q A;  4AZ5 A;  1HXK A;  4JLC A;  4R5L A;  4WPE A;  2JNK A;  1PS3 A;  2MI7 A;  2JNS A;  3KAW A;  2F1B A;  3T47 A;  4PO2 A;  2NCZ A;  3B53 X;  2F7O A;  2ELB A;  5E84 A;  3DX1 A;  1ZYL A;  4EZZ A;  4KIK A;  1I49 A;  2WYH A;  4H6I A;  2N3K A;  4B9Q A;  4IW0 A;  3FD9 A;  3DPP A;  1OAO A;  4EZT A;  2YLL A;  4EZW A;  3LMF A;  2OBM A;  4JWI A;  3O3M B;  3Q0K A;  4R5G A;  3HAI A;  2QKW A;  4EZO A;  4EZR A;  3B52 X;  2D4C A;  4JL9 A;  2D1L A;  3GI7 A;  3KDR A;  4D8J A;  4AZ6 A;  3T46 A;  2Z0O A;  3KAV A;  4IWQ A;  3LLL A;  2OBL A;  1SU8 A;  2FYV A;  4NQI A;  2YI9 A;  3DDF A;  4NSW A;  4IM2 A;  4G6Q A;  4AKV A;  1R33 A;  3BVV A;  2Z0N A;  4F01 A;  3T48 A;  2EFL A;  1DKX A;  5TKY A;  4HY9 A;  4EZN A;  2Z0V A;  1LQ7 A;  3VEA A;  1R5E A;  3ACO A;  3Q84 A;  2ZXQ A;  4E3C A;  4H6H A;  1SU6 A;  1SU7 A;  4HYB A;  1O7D C;  2Z8Y A;  4F00 A;  3DDG A;  3I39 X;  2X3V A;  2PY6 A;  3CV5 A;  3CZS A;  3BUI A;  4AVM A;  4H8S A;  3BUB A;  2FIC A;  4FZP A;  3BVT A;  3CKD A;  5C5B B;  3O3O B;  2EWF A;  2OW7 A;  4HR1 B;  3DX3 A;  1I4L A;  1I4T A;  3EJU A;  3M3W A;  1TQW A;  4JNF A; 
#chains in the Genus database with same CATH homology
 3OK8 A;  3G9G A;  4AVM A;  4H8S A;  4DCN C;  4NQI A;  3QE6 A;  2C08 A;  3Q0K A;  3HAH A;  3ACO A;  3Q84 A;  4FZS A;  3HAI A;  2FIC A;  2Q13 A;  2X3X A;  3SOG A;  2RAI A;  3QWE A;  2ELB A;  4NSW A;  3SYV A;  4AKV A;  2V0O A;  3ABH A;  2D4C A;  1I49 A;  4I1Q A;  5C5B B;  1X03 A;  2D1L A;  2Z0N A;  2RAJ A;  5C5B A;  3PLT A;  2Z0O A;  1I4L A;  2EFL A;  1URU A;  1ZWW A;  2EFK A;  1I4T A;  3DYT A;  3QNI A;  1WDZ A;  2RAK A;  4ATM A;  4BNE A;  1I4D A;  4WPE A;  3M3W A;  4WPC A;  2X3V A;  3I2W A;  4DYL A;  2Z0V A;  2X3W A;  1Y2O A;  3LLL A;  1X04 A;  2Q12 A;  3CAZ A;  3HAJ A;  2YKT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...