4NQIA

Structure of the n-terminal i-bar domain (1-259) of d.discoideum ibara
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
230
structure length
220
Chain Sequence
NPVIEITLKTINNLKVNSPPLFTEVIKAANKYQQQAQALSQAGLVLADTLTRLTIHNGGDFGEGFKKLADAIKDLENRRDDVAKVLLNEFITPNKQAIEDDQKAIATFEKNYKKDRDQMRQDILKLEAKTRKAGKITELNDKIKESEQLNANKLRDVVLMERRKHATFLSQFNQFLEKEIELSADTMSKFSTNLNTHRDLINSQSQLPLEMESMISKQER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords SH3 domain-containing protein
publication title The inverse BAR domain protein IBARa drives membrane remodeling to control osmoregulation, phagocytosis and cytokinesis.
pubmed doi rcsb
source organism Dictyostelium discoideum
total genus 92
structure length 220
sequence length 230
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08397 IMD IRSp53/MIM homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 4nqiA00
4BNEA 3I2WA 1Y2OA 2RAJA 4WPCA 4AKVA 4NSWA 3ACOA 4WPEA 3HAJA 1I4LA 2Z0VA 3QWEA 5C5BB 4AVMA 4DYLA 2FICA 2Q13A 1I49A 1WDZA 3SYVA 2V0OA 3PLTA 1ZWWA 2ELBA 4ATMA 3OK8A 3Q0KA 3LLLA 2EFLA 1X04A 2Q12A 3HAHA 4FZSA 3QE6A 3G9GA 4H8SA 4NQIA 2YKTA 2Z0NA 2X3VA 2Z0OA 3CAZA 3Q84A 3ABHA 3DYTA 2D4CA 2C08A 2RAKA 5C5BA 4DCNC 3M3WA 1URUA 1I4TA 1X03A 2D1LA 3QNIA 2X3WA 3SOGA 1I4DA 4I1QA 2RAIA 2EFKA 3HAIA 2X3XA
chains in the Genus database with same CATH superfamily
2EWFA 4KIKA 4EZOA 2F1BA 1WDZA 3PLTA 3KDRA 4H8SA 2X3VA 3RPMA 3EJQA 2YLLA 3BVXA 3BUBA 4JNEA 3BVTA 3EJUA 4HR1B 4IM0A 2QKWA 2WYHA 4E81A 3I04A 1DKYA 3UITA 2QFFA 4JLCA 1ZWWA 3VEBA 4KIKB 2OBMA 1OA1A 4AVMA 1I4DA 1SUFA 3ACOA 4IWPA 3OWGA 3CZSA 3BUIA 3T4AG 2ND0A 2Z0NA 1R5EA 2Z0OA 3Q84A 5TKYA 4DCNC 2O0I1 3CZNA 4EZTA 2OZNB 3SOGA 1HWWA 4I1QA 1OA0A 1DKXA 2Z0VA 2PY6A 1QX1A 2KHOA 4R5JA 3RV0A 2YL6A 4ATMA 1X04A 4H6HA 2YKTA 4EZNA 1TQTA 2RAKA 3QNIA 1QWNA 4M0MA 2X3WA 3QE6A 1O7DB 3F7WA 3QWEA 4HYBA 2F1AA 2Q13A 1I49A 1E2UA 2ELBA 2MI7A 2EFLA 3BUDA 2ZXQA 3LMFA 4FZPA 3CVRA 1TQUA 4F00A 1X03A 3CV5A 1O7DC 2F7PA 2RAIA 4R5LA 4UDXX 3DPOA 1TQWA 2F18A 3B53X 4FZSA 3B51X 4EZUA 2YI9A 4H6IA 2YL9A 3D52A 4JWDA 5C5BA 4AZIA 3M3WA 2OW6A 4JN4A 4AZGA 2FYVA 1E1DA 3BVUA 3O3NB 1E9VA 2NCZA 3DPQA 4EZWA 1OAOA 4DYLA 4NPHA 3EJRA 4R5GA 3ABHA 3DX0A 3EJTA 1DKZA 1QWUA 1SU6A 2GAFD 5E84A 4BNEA 4NSWA 2YL8A 3EJPA 5C5BB 3BLBA 3D2EA 3G9GA 3DX1A 3L3OM 2X5CA 3T49A 1PS3A 1YWMA 2Z8YA 3ER9B 2OO2A 3T47A 2EFKA 3ZEDA 1UPXA 3RV1A 1Y2OA 4EZSA 1GN9A 1GNLA 3OHXM 2EX3B 4AZBA 3O3MB 3C7NA 1JQKA 2Q12A 2OW7A 3CAZA 3BUPA 2JNSA 2F7OA 4AKVA 1R34A 3HAJA 3ERCC 4F01A 2FICA 1SU7A 5FIGA 4JWIA 1LQ7A 2JNKA 3BUQA 3DX4A 3VKHA 3FD9A 4JWCA 4AZHA 4IWOA 4E3CA 3QA8A 1SU8A 2YLAA 1I4TA 2D1LA 3BVWA 3I01A 4G6QA 3LVTA 3DPPA 2GA9D 3DDFA 3VEAA 4EZPA 4IW0A 1HXKA 2LXYA 3T48A 4R5IA 2QXLA 3KAWA 5KBPA 3I2WA 3QNJA 4WPEA 3L3PA 2YL5A 3OK8A 3HAHA 3DYTA 2F7QA 2WYIA 3ER8C 4WPCA 3BVVA 3I39X 1I4LA 2YI8A 2N3KA 3DX3A 4JWEA 4JNFA 2F7RA 2YIBA 4IM2A 3D51A 4IM3A 1U00A 2D4CA 4JL9A 2LM0A 4EZYA 2X3XA 4HY9A 2RAJA 2WINM 4EZXA 1R33A 4IWQA 3EJSA 5FLEX 3B52X 4UDYX 3DDGA 2YIAA 2YIVX 2ND1A 2OBLA 2GF4A 3D50A 4B9QA 4AZCA 4EZQA 3GI7A 3D2FA 4EZRA 2ALWA 4PO2A 1MJGA 2PMRA 4AZ6A 1TQVA 4EZZA 2V0OA 4FM3A 4NQIA 4AZ5A 1W9MA 3CKDA 1ZYLA 2C08A 4D8JA 4EZVA 3D4ZA 4R5KA 1TQSA 1HTYA 4FZOA 1GNTA 4AZCB 4AZ7A 3KAVA 3SYVA 3D4YA 3A98A 3Q0KA 3LLLA 3O3OB 3T46A 4HR1A 3DX2A 2RT6A 1URUA 3HAIA
chains in the Genus database with same CATH topology
4BNEA 3I2WA 1Y2OA 2RAJA 4WPCA 4AKVA 4NSWA 3ACOA 4WPEA 3HAJA 1I4LA 2Z0VA 3QWEA 5C5BB 4AVMA 4DYLA 2FICA 2Q13A 1I49A 1WDZA 3SYVA 2V0OA 3PLTA 1ZWWA 2ELBA 4ATMA 3OK8A 3Q0KA 3LLLA 2EFLA 1X04A 2Q12A 3HAHA 4FZSA 3QE6A 3G9GA 4H8SA 4NQIA 2YKTA 2Z0NA 2X3VA 2Z0OA 3CAZA 3Q84A 3ABHA 3DYTA 2D4CA 2C08A 2RAKA 5C5BA 4DCNC 3M3WA 1URUA 1I4TA 1X03A 2D1LA 3QNIA 2X3WA 3SOGA 1I4DA 4I1QA 2RAIA 2EFKA 3HAIA 2X3XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BNE A;  3I2W A;  1Y2O A;  2RAJ A;  4WPC A;  4AKV A;  4NSW A;  3ACO A;  4WPE A;  3HAJ A;  1I4L A;  2Z0V A;  3QWE A;  5C5B B;  4AVM A;  4DYL A;  2FIC A;  2Q13 A;  1I49 A;  1WDZ A;  3SYV A;  2V0O A;  3PLT A;  1ZWW A;  2ELB A;  4ATM A;  3OK8 A;  3Q0K A;  3LLL A;  2EFL A;  1X04 A;  2Q12 A;  3HAH A;  4FZS A;  3QE6 A;  3G9G A;  4H8S A;  4NQI A;  2YKT A;  2Z0N A;  2X3V A;  2Z0O A;  3CAZ A;  3Q84 A;  3ABH A;  3DYT A;  2D4C A;  2C08 A;  2RAK A;  5C5B A;  4DCN C;  3M3W A;  1URU A;  1I4T A;  1X03 A;  2D1L A;  3QNI A;  2X3W A;  3SOG A;  1I4D A;  4I1Q A;  2RAI A;  2EFK A;  3HAI A;  2X3X A; 
#chains in the Genus database with same CATH topology
 2EWF A;  4KIK A;  4EZO A;  2F1B A;  1WDZ A;  3PLT A;  3KDR A;  4H8S A;  2X3V A;  3RPM A;  3EJQ A;  2YLL A;  3BVX A;  3BUB A;  4JNE A;  3BVT A;  3EJU A;  4HR1 B;  4IM0 A;  2QKW A;  2WYH A;  4E81 A;  3I04 A;  1DKY A;  3UIT A;  2QFF A;  4JLC A;  1ZWW A;  3VEB A;  4KIK B;  2OBM A;  1OA1 A;  4AVM A;  1I4D A;  1SUF A;  3ACO A;  4IWP A;  3OWG A;  3CZS A;  3BUI A;  3T4A G;  2ND0 A;  2Z0N A;  1R5E A;  2Z0O A;  3Q84 A;  5TKY A;  4DCN C;  2O0I 1;  3CZN A;  4EZT A;  2OZN B;  3SOG A;  1HWW A;  4I1Q A;  1OA0 A;  1DKX A;  2Z0V A;  2PY6 A;  1QX1 A;  2KHO A;  4R5J A;  3RV0 A;  2YL6 A;  4ATM A;  1X04 A;  4H6H A;  2YKT A;  4EZN A;  1TQT A;  2RAK A;  3QNI A;  1QWN A;  4M0M A;  2X3W A;  3QE6 A;  1O7D B;  3F7W A;  3QWE A;  4HYB A;  2F1A A;  2Q13 A;  1I49 A;  1E2U A;  2ELB A;  2MI7 A;  2EFL A;  3BUD A;  2ZXQ A;  3LMF A;  4FZP A;  3CVR A;  1TQU A;  4F00 A;  1X03 A;  3CV5 A;  1O7D C;  2F7P A;  2RAI A;  4R5L A;  4UDX X;  3DPO A;  1TQW A;  2F18 A;  3B53 X;  4FZS A;  3B51 X;  4EZU A;  2YI9 A;  4H6I A;  2YL9 A;  3D52 A;  4JWD A;  5C5B A;  4AZI A;  3M3W A;  2OW6 A;  4JN4 A;  4AZG A;  2FYV A;  1E1D A;  3BVU A;  3O3N B;  1E9V A;  2NCZ A;  3DPQ A;  4EZW A;  1OAO A;  4DYL A;  4NPH A;  3EJR A;  4R5G A;  3ABH A;  3DX0 A;  3EJT A;  1DKZ A;  1QWU A;  1SU6 A;  2GAF D;  5E84 A;  4BNE A;  4NSW A;  2YL8 A;  3EJP A;  5C5B B;  3BLB A;  3D2E A;  3G9G A;  3DX1 A;  3L3O M;  2X5C A;  3T49 A;  1PS3 A;  1YWM A;  2Z8Y A;  3ER9 B;  2OO2 A;  3T47 A;  2EFK A;  3ZED A;  1UPX A;  3RV1 A;  1Y2O A;  4EZS A;  1GN9 A;  1GNL A;  3OHX M;  2EX3 B;  4AZB A;  3O3M B;  3C7N A;  1JQK A;  2Q12 A;  2OW7 A;  3CAZ A;  3BUP A;  2JNS A;  2F7O A;  4AKV A;  1R34 A;  3HAJ A;  3ERC C;  4F01 A;  2FIC A;  1SU7 A;  5FIG A;  4JWI A;  1LQ7 A;  2JNK A;  3BUQ A;  3DX4 A;  3VKH A;  3FD9 A;  4JWC A;  4AZH A;  4IWO A;  4E3C A;  3QA8 A;  1SU8 A;  2YLA A;  1I4T A;  2D1L A;  3BVW A;  3I01 A;  4G6Q A;  3LVT A;  3DPP A;  2GA9 D;  3DDF A;  3VEA A;  4EZP A;  4IW0 A;  1HXK A;  2LXY A;  3T48 A;  4R5I A;  2QXL A;  3KAW A;  5KBP A;  3I2W A;  3QNJ A;  4WPE A;  3L3P A;  2YL5 A;  3OK8 A;  3HAH A;  3DYT A;  2F7Q A;  2WYI A;  3ER8 C;  4WPC A;  3BVV A;  3I39 X;  1I4L A;  2YI8 A;  2N3K A;  3DX3 A;  4JWE A;  4JNF A;  2F7R A;  2YIB A;  4IM2 A;  3D51 A;  4IM3 A;  1U00 A;  2D4C A;  4JL9 A;  2LM0 A;  4EZY A;  2X3X A;  4HY9 A;  2RAJ A;  2WIN M;  4EZX A;  1R33 A;  4IWQ A;  3EJS A;  5FLE X;  3B52 X;  4UDY X;  3DDG A;  2YIA A;  2YIV X;  2ND1 A;  2OBL A;  2GF4 A;  3D50 A;  4B9Q A;  4AZC A;  4EZQ A;  3GI7 A;  3D2F A;  4EZR A;  2ALW A;  4PO2 A;  1MJG A;  2PMR A;  4AZ6 A;  1TQV A;  4EZZ A;  2V0O A;  4FM3 A;  4NQI A;  4AZ5 A;  1W9M A;  3CKD A;  1ZYL A;  2C08 A;  4D8J A;  4EZV A;  3D4Z A;  4R5K A;  1TQS A;  1HTY A;  4FZO A;  1GNT A;  4AZC B;  4AZ7 A;  3KAV A;  3SYV A;  3D4Y A;  3A98 A;  3Q0K A;  3LLL A;  3O3O B;  3T46 A;  4HR1 A;  3DX2 A;  2RT6 A;  1URU A;  3HAI A; 
#chains in the Genus database with same CATH homology
 4BNE A;  3I2W A;  1Y2O A;  2RAJ A;  4WPC A;  4AKV A;  4NSW A;  3ACO A;  4WPE A;  3HAJ A;  1I4L A;  2Z0V A;  3QWE A;  5C5B B;  4AVM A;  4DYL A;  2FIC A;  2Q13 A;  1I49 A;  1WDZ A;  3SYV A;  2V0O A;  3PLT A;  1ZWW A;  2ELB A;  4ATM A;  3OK8 A;  3Q0K A;  3LLL A;  2EFL A;  1X04 A;  2Q12 A;  3HAH A;  4FZS A;  3QE6 A;  3G9G A;  4H8S A;  4NQI A;  2YKT A;  2Z0N A;  2X3V A;  2Z0O A;  3CAZ A;  3Q84 A;  3ABH A;  3DYT A;  2D4C A;  2C08 A;  2RAK A;  5C5B A;  4DCN C;  3M3W A;  1URU A;  1I4T A;  1X03 A;  2D1L A;  3QNI A;  2X3W A;  3SOG A;  1I4D A;  4I1Q A;  2RAI A;  2EFK A;  3HAI A;  2X3X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...