3A98A

Crystal structure of the complex of the interacting regions of dock2 and elmo1
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
168
structure length
157
Chain Sequence
GMAPWRKADKERHGVAIYNFQGSGAPQLSLQIGDVVRIQETCGDWYRGYLIKHKMLQGIFPKSFIHIKEVIPAEIPLAQEVTTTLWEWGSIWKQLYVASKKERFLQVQSMMYDLMEWRSQLLSGTLPKDELKELKQKVTSKIDYGNKILELDLIVRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Dedicator of cytokinesis protein 2
publication title Structural basis of functional complex formation between DOCK2 and ELMO1 for Rac activation in lymphocyte chemotaxis
rcsb
source organism Homo sapiens
total genus 45
structure length 157
sequence length 168
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-10-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.350 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3a98A02
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3a98A01
1T0HA 2BZYA 3EG3A 1K9AA 3VS0A 2CDTA 1ZUUA 4M4ZA 3IQLA 2GTOA 5IH2A 1YP5A 2KR3A 2D1XA 4JJDA 3I9QA 2PTKA 2AZVA 3VS4A 2KE9A 2AKLA 4RTWA 1QWEA 2ENMA 4AG2C 2BZXA 2CUBA 2DL4A 1SEMA 5GJVB 3C0CA 2OJ2A 2ROLA 1NEBA 2KBTA 3VRYA 2M0YA 1VYVA 4LE9A 4J9IA 2LMJA 1G2BA 1WX6A 3ZL7C 1JEGA 4CC3A 4RTTA 2C0OA 1PKSA 1Y57A 4Y92A 1OV3A 2KT8A 1KSWA 3NPFA 4J9HA 2G6FX 2DA9A 2EGAA 4OMMA 1WI7A 1UJ0A 3FJ5A 4AG1C 2YUNA 1K1ZA 4RUGA 1NG2A 3VS1A 1VA7A 2DX1A 4OMLA 2DNUA 1MV0B 5IXFA 1JO8A 2YDLA 2SRCA 3H41A 1UFFA 2FPFA 1BB9A 3RBBB 2C0TA 3I5SA 4EIKA 3EHRA 1ARKA 1JXOA 1LCKA 1XOVA 3PE0A 3EHQA 4K11A 2KT1A 2J6OA 1OPLA 3REAB 3REBB 2F2WA 2CREA 2CH4W 4CC2A 2GTJA 2VWFA 4RTVA 2P4RA 3A98A 1IO6A 1QKWA 2DLPA 3RNJA 1X43A 2CH4A 4D8DA 2CT4A 2DYBA 1A0NB 1KIKA 1OEBA 4CC7A 1MUZA 2EGEA 1AWXA 3UA7A 3VS5A 4AFSC 3PVQA 2EBPA 1FMKA 4Z89A 2QDLA 2H8HA 5L23A 1NYFA 1UE9A 1GBQA 2EW3A 3GBQA 3H0HA 4RTZA 2DRMA 5HCKA 1B3QA 3M0PA 1AEYA 2F2VA 2O2OA 1TUDA 4LUDA 1K4US 1PHTA 4J9DA 3EG2A 1FYNA 2DL7A 1ZBJA 1J3TA 4HXJA 5IHIA 2D0NA 2LZ6B 4AFQC 2EYYA 3M0RA 2FEIA 1UECA 2JMCA 4OMOA 2BTTA 4IIOA 1PRLC 2O31A 1M3CA 5FWBA 1PKTA 1X6GA 4DEYA 2A36A 2KEAA 2IIMA 3I5RA 2ESWA 1UUEA 4ZNXA 3NHNA 2YUQA 3VS3A 4RTYA 2OAWA 3M0QA 5IXBA 4RTXA 1GCPA 2CSQA 2SEMA 2HEQA 2EYWA 2A08A 1NLOC 2RQTA 1AZEA 5GJWB 2X3XD 1QLYA 1YN8A 2EVRA 2PNIA 4F17A 2RF0A 4RTUA 3VRZA 1ZUKA 4OMPA 3UA6A 2KXCA 2KROA 4J9GA 2C0IA 2LX7A 2PZ1A 3JV3A 3ULRB 2GNCA 1SSHA 1AWJA 2RQVA 1SRLA 1SRMA 1AWOA 1TUCA 2YSQA 1WA7A 1HSQA 2LNHB 3VS7A 2DMOA 4AFZC 2JS2A 1SHGA 2W0ZA 3M0TA 1JU5C 4DEXA 2DJQA 1RLQC 5FWCA 1GRIA 4R0KA 2KGTA 1WYXA 1X6BA 1ZLMA 3U23A 2LQWA 5I22A 1YCSB 4CC4B 1RUWA 4LN2A 2FPEA 2KRMA 2MIOA 1UG1A 1AWWA 1RLPC 3SHWA 3PVLA 3O5ZA 4A63B 1Y0MA 1YWPA 2RPNA 1ZX6A 3NMZC 1WLPB 2J6KA 2O88A 2DRKA 1WXTA 2DE0X 4WCIA 2DM1A 1E6HA 4JPBW 2J05A 2L2PA 2MCNA 4Z8AA 2DVJA 1OOTA 2RN8A 2E5KA 1VYUA 2LCSA 4GBQA 2KRNA 5I11A 1H3HA 3TSZA 2EQIA 3M0SA 4HVWA 4J9FA 2VVKA 2FPDA 3NGPA 2KYBA 1PRMC 3M0UA 2DL5A 2YUOA 2EYXA 2K79A 4KRTA 2ROTA 2LP5A 2W10A 2YT6A 2GBQA 3H0IA 5ECAA 2HSPA 2HCKA 1G83A 4Z88A 3QWYA 1T3LA 1QWFA 1BU1A 2B86A 1GBRA 4JZ4A 1V1CA 2L0AA 2NUZA 1KJWA 1OPKA 4AFUC 2KRSA 1M3BA 4ESRA 1B07A 2K3BA 2RQUA 1SHFA 2D8JA 2LJ1A 2JM8A 1NEGA 2JXBA 3TSWA 4JZ3A 1ZSGA 5IHNA 3QWXX 1WIEA 3LH5A 2RNAA 2K9GA 3KFVA 4OMNA 2KNBB 4HVUA 2EPDA 1T0JA 1X27A 1K0SA 1I07A 1Z9QA 2D8HA 2ABLA 2DILA 1UJYA 3THKA 2DBMA 1VYTA 1ZUYA 2YUPA 2GQIA 1CKBA 1Z9ZA 2FRWA 1H92A 2JT4A 1UHFA 2L3SA 2CSIA 1KFZA 2RMOA 2O9SA 1UTIA 1K76A 1NM7A 4OMQA 4FSSA 2BZ8A 3I35A 2AZSA 2M51A 5EC7A 1UGVA 1E7OA 3EGUA 1JXMA 1MV3A 2FO0A 2JMAA 4HVVA 1W70A 1BBZA 2AK5A 1UHCA 1U06A 2ED0A 2EGCA 2X3WD 3TVTA 2XMFA 2I0NA 3UATA 1WXUA 1X69A 1GFCA 1X2KA 2J7IA 1N5ZA 1PWTA 2DL8A 2FRYA 2RQWA 1U5SA 1WDXA 2DF6A 4J9EA 1NYGA 1M30A 5FW9A 1M27C 3R6NA 3CQTA 2AKKA 1GL5A 2A28A 1HJDA 4GLMA 2LJ3A 4LUEA 1NLPC 1BK2A 2VKNA 2HBWA 1QCFA 2EYZA 2RQRA 2JW4A 1M3AA 2HDAA 1PNJA 4QT7A 2O9VA 2DBKA 1AOJA 2JS0A 3EG0A 2L3PA 2JM9A 4E6RA 3UF4A 1I0CA 1RI9A 3VS6A 4F14A 1K0XA 1TG0A 1SPKA 2KYMA 1CKAA 2OI3A 1S1NA 1ABQA 1ABOA 2L3QA 1JQQA 2KXDA 4F16A 3EG1A 2K6DA 2DL3A 2GGRA 2K7AA 4LNPA 1W6XA 4HCKA 1UDLA 2JTEA 1WXBA 2A37A 5IHKA 4J9BA 4X1VA 2ECZA 4J9CA 4ORZA 1QKXA 1T3SA 1H8KA 2MOXA 4D8KA 4IIMA 2F2XA 2NWMA 1X2QA 2V1RA 2K2MA 3VS2A 1AVZC 4JJBA 1AD5A 1I1JA 2EKHA 3H0FA 1GCQC 1CSKA 2CUDA 2LJ0A 1E6GA 1WFWA 2LQNA 3SEMA 2FG0A 1GFDA 2J06A 2CT3A 1EFNA 1W1FA 1YWOA 1GCQA 1U3OA 4JJCA 1YNZA 1HD3A 1AZGB 2J6FA 2ED1A 2V1QA 1M8MA
chains in the Genus database with same CATH superfamily
2R58A 3L3PA 1JJ2P 2WSFE 1YI2Q 4ELYC 1VQ9Q 1C6VX 1V29B 3NTIA 1YP5A 2R5AA 2QTXA 4J6YA 3E9FA 3EFSA 4XU3A 5CCAA 5CO7A 4XTYA 3LWHA 4EZNA 1WHHA 2PTKA 2QQSA 2ENMA 4F7UE 2RAKA 4JNEA 3E9GA 4ATMA 1SEMA 3NFCA 5KYWB 2QK0A 1VYVA 1YJNA 2LMJA 1OU9A 1WX6A 4BE0A 3Q0KA 3ZL7C 1JEGA 4CC3A 4FYXB 1I8FA 1PKSA 4FT2A 4Y92A 2DXUA 1Y2OA 2HBPA 2KT8A 4AMCA 4EMHA 2BE9B 2H3JA 3JCMV 4J9HA 3UT1A 2DK3A 2CZ7B 4N0AC 3JCMJ 4I1QA 4AG1C 4H8SA 1NG2A 5FU6C 3VS1A 2OTLA 4XQ3A 1MV0B 1MNEA 3OBWA 2D4CA 4F7UB 3L2WA 3GNGA 4PJOC 2QQBA 3RBBB 1BB9A 2OO2A 3KBGA 4EIKA 1MMAA 2X4WA 4AZIA 2XIDA 1LCKA 1Q7YU 1SU6A 5GAN6 5LJ3g 2KK4A 3M9QA 1N8RC 2LTOA 2DXTA 2F2WA 4CC2A 2ZZDA 5GMKj 3KAWA 2Z0NA 1W2BP 5TKYA 2EQMA 2DLPA 2F7PA 1OX9A 1X43A 2VGNA 2DYBA 1YITQ 1A0NB 2ZPFB 5CIUA 4DA4A 1WPYA 4FL6A 3V8KA 3CCUQ 1FMWA 1KQSA 2JNKA 1WHMA 2P0PA 2H8HA 5CKBA 4C5GA 4C8QC 1QVGS 3CBPA 2EW3A 2OTJT 3DDGA 4BY6B 4ME7A 3KXTA 3GBQA 1E2UA 2NLUA 4EZOA 3HL8A 2HKQB 3M0PA 4B9QA 2DKGA 2IVWA 3GPLA 4LUDA 1RAGB 4M7DE 3I56Q 3META 4AZ7A 3BE3A 3QIIA 2QDYB 2ZPGB 3UWNA 1TXQA 1QCOA 5J39A 2X4JA 4AFQC 3M0RA 2D9TA 4JS4A 4OMOA 1PRLC 4OP0A 3T48A 2WSEE 3O3OB 4DEYA 3HSBA 3DX2A 3CCRQ 4PFOA 2IIMA 3OB9A 2RJDA 4M7DG 4ZNXA 5C6SA 1TQWA 3BVXA 3LLRA 3WVDB 3VS3A 4RTYA 3SWNC 2QYZA 3ABHA 4EMKA 5GAMf 2CSQA 2SEMA 4OGCA 1YJWA 2L8DA 1WGSA 1NLOC 3CCVA 4M7DB 2JJ9A 3HFNA 2VYTA 2X3XD 1QLYA 3MCAB 4F17A 2GFAA 4OMPA 1MMNA 4DBFA 1PD0A 3UA6A 1OYXA 2PZ1A 3EGDB 2ZCFB 4PL6A 4BI3A 2GNCA 1SSHA 2LRQA 2RQVA 3DLMA 3EFOB 1N8RU 1QMCA 4AZCB 1SRMA 1AWOA 5GAOq 1Q95G 2ZPEB 3OS2A 4D8JA 1WA7A 1BIBA 3MEVA 2RB6A 2DMOA 2Z0OA 1SHGA 2RM4A 3OK8A 5FWCA 2WACA 4ZTJA 3EJTA 2M02A 4R0KA 2OBMA 1M1KR 1ZWWA 2RHYA 5FIGA 3M53A 5I22A 3LYIA 1YCSB 4N0AA 4N4GA 3DLLA 1D0XA 3G4SA 1QVFA 3JSCA 5FRNA 3SHWA 3PVLA 3DX4A 4F7UF 3VU3C 2COZA 3D51A 1W9MA 4ANJA 3GNFB 3CPFA 2J6KA 2DE0X 4LD9K 1E6HA 2L2PA 3CMAA 1U00A 4Z8AA 2DVJA 3D52A 1K9MR 1OOTA 5LJ3d 4E7KA 3QZ9B 1QVGP 1QCNA 2WYHA 4KH0B 2HNIA 1Y7XA 1VQOT 3OS5A 5I11A 2DTHA 3EJSA 3TSZA 2QA4Q 2EQIA 2DJZA 4J9FA 2EWFA 2DZCA 5CKEA 2L89A 2L3RA 3HRSA 3CCQT 3HTRA 2YIAA 4EZTA 2ROTA 5GAMg 4LDYA 2D6FA 4BI4A 1VQ6Q 1KQ1A 2LM0A 2YL6A 1BU1A 2B86A 4E7HA 1IB8A 4MZPA 3A5ZB 3GP8A 2DTIA 3GI7A 2L0AA 3J7AF 4AFUC 2NUPB 1M3BA 3CCMQ 4IUPA 4ESRA 1YJ9A 2RQUA 3I55A 4AZBA 3SOGA 2LJ1A 3FDRA 3CAZA 3A8HB 4HCBA 1NEGA 2JXBA 3OYHA 4FZOA 3TSWA 1QP2A 2QEXQ 3LH5A 8AT1B 4DBRA 4NOYA 4TVRA 3SWNA 4PFPA 1VQKA 5GANf 3MO8A 4M7DF 2JNSA 4JWDA 1Y96B 1T0JA 2BE7D 2WINM 1X27A 1K0SA 1I07A 3X20B 3CC7T 2DILA 2DBMA 3BFMA 1ZUYA 3PGGA 2YUPA 2F7QA 1VQ8T 1CKBA 3LH0A 2FRWA 4C5EA 4C0ZA 6AT1B 1UHFA 4BY6C 1ZHIA 5LJ3j 3HAHA 2O9SA 4FIBA 2PUOB 3CXCS 1NE8A 3QNJA 2IPOB 3E19A 3OYEA 3URGA 3I35A 3D4YA 3UITA 5LJ5e 8ATCB 4JWIA 2V8IA 1MV3A 2FO0A 1N9RA 4JLIA 1WHKA 4PJNA 1U06A 5DY9A 4MZMA 2VXFA 1YIJA 1VQ4A 2F1LA 4R5GA 2JNGA 4L5GA 2YI9A 1GFCA 1YHQA 2J7IA 1N5ZA 1PWTA 2FRYA 1RL2A 1WHLA 3O8VA 1WDXA 1ZA1B 2DF6A 2KHOA 2LVMA 2YXYA 1BI0A 2X3VA 1HJDA 3QYGB 3DB3A 2LJ3A 3CD6T 3JB9J 4M7DC 3EJPA 1BK2A 4Q5WA 2DIGA 4AKVA 2X9HA 4R5LA 2HDAA 1JRIA 3JCMP 3EH1A 5AT1B 1OQKA 1ZBXA 2EFIA 1VQ5A 1AT1B 2DBKA 1DJ7B 2JS0A 4C5IA 4V2SA 1M5Q1 4M77E 5A0DA 4F14A 3MPUB 3VKIA 1SPKA 1YJNT 5KYWA 3H6ZA 4PNOA 1M90C 1ABQA 3MP6A 1JQQA 3QNIA 1IHWA 3X24B 2M9UA 1VQ7A 2DL3A 2GGRA 1UDLA 2ZPBB 1VQLQ 1WXBA 2LNVA 5GANg 4M77G 1Q81U 2ECZA 1QKXA 2XU8A 5GAMd 1T3SA 3CCEA 3E1SA 4HT9A 2OTLT 4JLCA 1K8AU 2CP6A 4L6V5 3TQ7P 2LX9A 3O3MB 2K2MA 3C7NA 2E65A 1AD5A 1I1JA 1UPXA 3L2ZA 3H0FA 2DYIA 1GCQC 3GOXA 4M77B 3FRNA 2CUDA 4F7UA 3SEMA 1GFDA 2YRDA 2FB7A 4ELZC 1EFNA 4H6IA 1KK7A 1YNZA 4JWEA 3X26B 4XTWA 3H8ZA 2RHUA 2J6FA 2ED1A 5GMKe 2VXEA 4IUQA 1JJ2A 3EG3A 3FD9A 2CP5A 3JCMQ 3B53X 4EPCA 3I01A 3G6EQ 3CXCP 5IH2A 3CPWS 5D6XA 3TCJA 3ZBDA 3VEAA 2KR3A 3ME9A 3JCMf 3EJUA 3RESA 1QWEA 4DOVA 3L2QA 1RACB 3B51X 2LXYA 2X4YA 2CUBA 2DL4A 4FW1A 2YL8A 2QQAA 2OJ2A 1Q82C 3M4YA 1TOVA 2KBTA 3CCJA 4WPEA 4J9IA 4KULA 1QX1A 2GF4A 5I21A 3OQ5A 4IWQA 3QWEA 2MI6A 1VIEA 3HAIA 4XU2A 2F69A 5GAOr 4OGEA 1I4TA 2XICA 4M7DD 3FJ5A 1K1ZA 1PSFA 2PY6A 3OYJA 1VA7A 2DX1A 3QDFA 3CMEA 5IXFA 1JO8A 2XDPA 5C5BB 2SRCA 4R55A 2KVQG 4M75E 1E1DA 5LJ5h 3UDCA 2WSCE 2C0TA 5GAMj 4JRIA 4EZUA 4HA8A 1KC8C 2VASA 3M5AA 2F7OA 4M0MA 2XDDA 1Q86R 3CCVT 1OPLA 4BDYA 3ACOA 2DAQA 4M7DA 1OX8A 4M75G 2QXLA 2GAFD 3VUBA 3QYHB 2EJFA 4ZGJB 1G3YA 2MK5A 3QZ5B 3S6WA 5KH6A 3BVWA 3RNJA 5HK3A 2CH4A 1I4LA 3RV0A 4D8DA 2CT4A 1S72A 2RD1A 3EGDA 4F04B 2RI3A 4HR1B 1KIKA 2QFFA 1EX4A 1MUZA 3EFOA 4E3CA 3UA7A 4AZCA 4Z89A 2QDLA 4M75B 2RK1A 2Y4XA 4PJJA 5FRMA 5I2MA 2COWA 1B34B 2JTFA 4B9XA 2EKOA 1D0ZA 1K73R 3H0HA 2CZ6B 2DRMA 3GF5A 3RMQA 1AEYA 1Q7YC 1MHNA 2HKNA 3EG2A 1FYNA 1ZBJA 3QSUA 4HXJA 5IHIA 3T47A 3LX7A 2OTJQ 2KMTA 2LZ6B 2MWOA 5GANd 3G4ST 2FEIA 1UECA 3PLTA 3JCMg 5IN1A 2O31A 2QGFB 4M77F 5D7UA 5M9OA 3N5BB 2ESWA 1UUEA 2YRVA 4M78E 3TREA 2R5MA 3NHNA 2F7RA 2E3HA 1LQ7A 2PUKB 2V8KA 2OAWA 5IXBA 1ZSZB 2DXBA 1M4ZA 3CMAT 1UGSB 4A4EA 3RIRA 3TEEA 4DBHA 1IGQA 1DKXA 2LQ8A 5I2SA 4FCYA 3A8MB 2OZNB 2RQTA 5J3BA 1AZEA 2PNIA 2EJGA 4M78G 2K3XA 2QA4A 2EYQA 1XQHA 2KROA 4J9GA 7AT1B 2C0IA 1KC8U 3JV3A 4D6WA 4FW2A 5GMKh 1VQPA 1X03A 3OYIA 4M78B 2IG0A 2LNHB 1Q82R 4XTVA 2JS2A 3M0TA 2W0ZA 1OU8A 3HPWA 2DJQA 4F7UG 2PVOB 4EZZA 1RAEB 2Z0WA 3OHXM 1ZLMA 2NUPA 3QJ6A 2LQWA 4IWPA 3LWIA 4KUDK 1YFNA 4CC4B 3PFSA 1YJ9T 4M77C 4C5HA 2HAXA 1RUWA 1M9SA 2HQXA 2KRMA 2K4YA 1R5EA 2YLAA 1F1BB 3A1PA 2EIFA 2BKDN 2Z0VA 1YWPA 1WJQA 3HRUA 3NMZC 2RH2A 2OW7A 5GANj 1VQKT 4E7IA 3NTHA 3QDRB 1TQUA 2L5QA 2DM1A 3OMCA 1TQSA 5FROA 3HHTB 1PSEA 1JBMA 3D2EA 2XK0A 4M7AE 2RN8A 2E5KA 2QASA 4EDUA 1G5VA 3ZFJA 3M0SA 3JCMc 2FPDA 4DBQA 4M75F 4P5NA 5LJ3e 2Y4YA 3QJYA 3M0UA 2EYXA 1VQOQ 4MMKA 2F1BA 3OYFA 1KD1C 3DX1A 2GBQA 1HWWA 4FZPA 2EWNA 3BY7A 1BI2A 4PO2A 3QWYA 1EIFA 1QWFA 1NJIR 3G1JA 3CCQQ 1GBRA 4IM3A 2ELBA 2NUZA 4FYWB 1YIJT 1VQ4T 2CS7A 1D3BB 3FLGA 1VOMA 4PLLA 4M7AB 1ACMB 1KQSS 4PJLA 2D8JA 5FU7C 1N9SA 1TWBA 2DEUA 4BE2A 1YWMA 4EZPA 4DYLA 4J6WA 3JCMd 4JL9A 1WIEA 4JN4A 3KUFA 4NPHA 4ZGDB 3RV1A 2RNAA 3KFVA 3OSVA 2KNBB 4MDWA 3ERCC 4J5YA 1M1KU 4IKFA 3V8LA 4OVAA 1VQ5T 1Z9QA 1W4SA 4KGVB 3THKA 3QA8A 3JB9G 1MJGA 2DVEA 2GQIA 2DXCA 2RHIA 1Z9ZA 2P0QA 2ND1A 4M77D 3HRTA 3M55A 4M78F 3CC7Q 2RMOA 2E64A 1VQ7T 3WVEB 1UTIA 1K76A 1VQ8Q 1JB0E 2E12A 1PCXA 2AZSA 1MGQA 3RPMA 1UGRB 2KY9A 1E7OA 5A0LA 1OULA 1JXMA 3CCET 3CC2A 4AZHA 3M57A 3OYCA 4DCNC 2QAZA 4A54A 2JMAA 4HVVA 2FHDA 1W70A 2ED0A 1UHCA 2X3WD 3TVTA 5GMKl 1WXUA 5KE3A 2JVVA 5CQYA 2LQKA 1KD1U 1X69A 3O3NB 4M77A 3T49A 3EAEA 1X2KA 5CR2A 5KYXB 4Y28E 2DL8A 1D1CA 1SUFA 5C0MA 2H3EB 1U5SA 1ZSZC 3CC4A 3R6NA 3P8BB 1GL5A 4ZTFA 1FX7A 3RKWA 4JWCA 1N8RR 1NLPC 5KYNA 1IREB 1M3AA 2JZ2A 3EG9B 2X3WA 2YLCA 2DD4A 1VQNA 3OMGA 2F18A 4RMOA 2QG9B 2O9VA 2RHXA 3CD6Q 1AOJA 4JRPA 4FYYB 4M78C 1K0XA 3CCJT 1CKAA 2V8JA 1VQMA 4UC4A 2KXDA 1BI3A 3LGLA 3EG1A 2X35A 4QKUA 1KQSP 2K6DA 1LPLA 4IUVA 4RKUE 4X9CA 3I2WA 3OBYA 4PK4A 1YJNQ 4X1VA 4J9CA 2E6ZA 4ORZA 2MOXA 2EQJA 2RJFA 5LJ3h 2OW6A 1ZYLA 2PMRA 2YL9A 4M7AF 2F2XA 2NWMA 3CMET 4OB3B 1N6AA 5C5BA 2V1RA 5D6YA 4F01A 3VS2A 4JJNK 2EKHA 2RK2A 2YIBA 2HL5C 4IW0A 3QBYA 5GAMe 1G3TA 1M1GA 1U1TA 2OTLQ 4M75D 4PLIA 3V7RA 1W1FA 1YWOA 1U3OA 2HZYA 1HD3A 3HP9A 2HQHA 2JUFA 1T0HA 1K9AA 2QXFA 3CCLA 2CDTA 1I49A 1ZUUA 2RA2A 1Q81C 1S72T 4M4ZA 3IQLA 4HR1A 1GNLA 1K8AC 2D1XA 3OYLA 3I9QA 2AZVA 1TU0B 3D50A 3X28B 4AG2C 4M75A 3OW2A 4J83A 3C0CA 1B34A 2ROLA 2GCXA 1NEBA 3VRYA 3ZEHA 2M0YA 4LE9A 3CCSA 1JQKA 4E7ZA 3JB9F 2MYSA 5D6WA 2EFKA 4X9DA 4ZN1A 2C0OA 2QKWA 4WF2A 1B7TA 1OV3A 4YTLA 3MEUA 3C12A 3G71A 3NPFA 4QW2A 1RAHB 3P8DA 2EJ9A 3INZA 2DA9A 1I5OB 2EGAA 4OMMA 5CK9A 1WI7A 1FWZA 3ER0A 4RUGA 3A8GB 1ZA2B 3TU4K 5KCHA 2LC4A 2K2VA 4XU1A 5AYFA 4OF1A 2KQWA 4IUUA 4FYVB 3ER8C 2YDLA 1NZ9A 2NYSA 2E70A 1UFFA 1LNXA 4B6MA 2K3YA 2RAJA 2FPFA 1URUA 3I5SA 3M54A 1QVFP 1P92A 1ARKA 4M78D 2DETA 1OI1A 1YI2A 1ZSZA 2AT1B 1VQ9A 3EHQA 4K11A 3OYKA 4HCCA 2P4TA 2FL7A 3REBB 2CREA 2E5QA 2GTJA 4RTVA 2P4RA 3A98A 1XTDA 2DIQA 3OYNA 2HD0A 1QKWA 1SF9A 3CCVQ 2ZGWA 1VQPT 4EZQA 1AWXA 1MNDA 2HL3A 2GF7A 4M78A 3F7WA 1KHCA 2V0OA 1GBQA 4E7JA 2DPPB 3ER9B 2LT1A 4MZTA 1O7DB 5GAN7 1K4US 2O2OA 3BUQA 3A8LB 3SDZA 4PJOE 1PHTA 1RI0A 4J9DA 2DL7A 4HKEA 1WDZA 2Q12A 1J3TA 3FIFA 3D7SB 1U8RA 2M1HA 3QE6A 5HKCA 2PVGB 1PS3A 2ALWA 1R8OB 3OYGA 1TUGB 4ATOA 1BKBA 2O4XB 1NPPA 1RAAB 1X6GA 2P84A 2EQUA 4PJOG 2YRCA 1Y71A 5GAN2 1IRXA 1WHJA 3CPWA 3VJPA 3G4SQ 5GANe 2YUQA 2AHJB 1UGQB 2RJEA 1GCPA 2HEQA 3B52X 4IM0A 5GAN8 1G3SA 2A08A 2BUDA 3OYYA 5KYYB 3L2VA 1YITA 4PJOB 4C8QE 2P0KA 1GNTA 4IURA 3CCUA 2FZGB 1PC0A 5GAMh 5GAN3 4RTUA 3PIPA 2EFLA 1ZUKA 2E4HA 4NQIA 3CMAQ 2KXCA 1XNIA 2PU9B 1DKYA 2FICA 3OS1A 1AWJA 1SRLA 1VQOA 1TUCA 4C8QG 1HK9A 4N4HA 4LDVA 5KYUB 3VS7A 4QVDA 3I56A 1QVPA 4AFZC 1Q86U 1JU5C 1KQ2A 1RLQC 4LXCA 1LVKA 2KGTA 3WXMB 1H3ZA 4C8QB 3DPPA 3DX3A 3U23A 1D3BA 4M7AA 3CCRA 4LN2A 2FPEA 2CZ0B 4X34A 1UG1A 3EGXB 3I04A 3O5ZA 4A63B 2BIVA 1YJWT 2RPNA 3CBMA 1YJ9Q 1IZ6A 2HMAA 1ZX6A 1K73U 1WLPB 2FVUA 2FYKA 1W2BA 3LGFA 1D0YA 2O88A 2X4XA 2JTMA 3JB9D 3NTKA 2MCNA 3S3OA 2EAYA 3P8HA 1IHVA 4JUVA 4KUIA 3QPHA 2E1HA 4J8OA 4FSXA 3OSSC 1VYUA 1VQKQ 2KRNA 4UDXX 2XG8D 2D1LA 4HVWA 1WJRA 1NPRA 3CC7A 3A8OB 2GQVA 2ATCB 2CZ1B 1M90R 2DL5A 2I2LA 2K79A 1VQ8A 1KG1A 2LP5A 2YT6A 3C95A 3H0IA 1OZ3A 2HCKA 4E2FB 2G3RA 3RKYA 3CC2T 1T3LA 1R77A 1V1CA 2YI8A 3ZEDA 1KJWA 3JAME 3D4ZA 1OPKA 3L42A 2KRSA 3PTAA 4BNEA 1B07A 2DEQA 2K3BA 2QQ9A 4EZXA 4LDWA 5KYXA 4NS5A 2JM8A 3HFOA 2QGGA 2KDSA 1TSFA 2XHCA 3CC4T 1YIJQ 1VQ4Q 3PMTA 3QWXX 5IHNA 2NUTB 1SU7A 5GAOl 3JCMX 5EG2A 4BE1A 2FZKB 1X75C 5GMKm 3CV5A 3G7ZA 4C92E 2EPDA 2EQKA 4QQDA 1PG5B 3L3OM 4PJOF 3CBOA 3DDFA 1VQNT 3EG9A 1I4K1 3JCMe 2MWPA 2RAIA 5CKHA 1VIFA 2DZ9A 3RDVA 5GANh 2XD0A 1VYTA 2Z8YA 2YWWA 4IUTA 4C92G 3D2FA 2JT4A 4L59A 3JB9I 1H92A 3F70A 1VQ5Q 1VQMT 2C08A 1O7DC 1VQ6A 1KFZA 3V8JA 1RADB 3RERA 1OZ2A 5EC7A 3SFMA 2VV5A 4C92B 3CCMA 2PQWA 4C8QF 3MP1A 2F1AA 4MMLA 3I55T 1M1KC 3BUBA 1VQ7Q 3DKMA 2AK5A 1FMVA 2PVDB 2XMFA 3UATA 4ZGEB 2QEXA 3Q1JA 3CCEQ 3BUIA 4EZRA 1WZOA 4J7IA 5CQXA 1BIAA 2ZPIB 4QVZA 3HKSA 3X25B 1IGUA 1KC8R 1NYGA 3CQTA 2RHZA 2AKKA 1Y96A 4R5KA 1YCYA 2KSSA 4GLMA 1RAFB 1QVGA 1HYOA 1LOJA 2JN0A 2VKNA 5KE2A 1NJIU 3GLXA 2RQRA 3CCLT 1VUBA 2KAFA 2DD5A 3LVTA 3T4AG 1R34A 1K9MC 4PKCC 3QKJA 1DKZA 3BVTA 4NSWA 4RG8A 5IT9E 1M2VB 2L3PA 2JM9A 3OS0A 3R6OA 4JS5A 4R5JA 4C0FA 1RI9A 3VS6A 3GIBA 2X51A 4M7AG 4UDYX 2CP2A 3CCST 2CP0A 2COYA 1S1NA 2RI2A 3BW1A 2L3QA 3MHXA 4F16A 2CP3A 2K5IA 4LNPA 1Q7YR 2DTOA 4HCKA 3G71T 4CRIA 2JTEA 4PJMA 3VUZA 3RMSA 3CCJQ 3DYTA 2MMPA 4J9BA 1I4DA 1YHQT 2B8AA 4HT8A 1SU8A 3M56A 5KBPA 2YLBA 1Y07A 1NBEB 1X2QA 2DO3A 1AVZC 4JJBA 2Q13A 1V76A 1CSKA 1E6GA 4IWOA 1N27A 2LQNA 1QQJA 1OAOA 2FG0A 1IXDA 2CT3A 5GAN5 3OYDA 3CMEQ 4JLGA 1YI2T 3PT9A 4BD3A 4EZWA 1VQ9T 4JJCA 2A0FB 3QHSA 4II1A 2OBLA 1QP3A 1X04A 4EZVA 4LDXA 2MAMA 4QQGA 1G8XA 1H641 2BZYA 4FM3A 4HCZA 3VS0A 4B9WA 4XAXB 4M75C 3CEYA 2GTOA 3M4GA 1M1FA 4JJDA 2HSEB 2E10A 4JDSA 3VS4A 2A3LA 2KE9A 2AKLA 4RTWA 4XU0A 2BZXA 5FLXE 1TQTA 1VQLA 5GJVB 1S72Q 4KBMB 2EX3B 3JCMh 3QUIA 4J6XA 1M8VA 1K9MU 1G2BA 4BDZA 3MKDA 4C92F 3L1AA 4RTTA 1Y57A 3BDUA 5GAOp 4ZN3A 1KSWA 3T9NA 1BYMA 4PJOD 2G6FX 4JRQA 1UJ0A 4Y91A 4VUBA 2YUNA 1LJOA 2X3XA 5LJ5f 2RI5A 2O4XA 4OMLA 2YIVX 2DNUA 4WPCA 4KIKB 3QG1A 3L2UA 4HY9A 3H41A 3VKHA 2X5CA 4A4KA 4AT1B 3EHRA 3EH2A 1R0BG 1JXOA 4LDUA 4OMFB 4BUGA 2C06A 4MDXA 3BLBA 1TH7A 1XOVA 3CKDA 4AZ6A 2FZCB 3PE0A 5CKFA 4OB1B 1YITT 3G6EA 2KT1A 2J6OA 5KYYA 1MMGA 2AIRB 5J26A 3REAB 4PJOA 3CCUT 2CH4W 1QVFS 1ZQ1A 1QW1A 2CP7A 2VWFA 3Q84A 4C8QD 3VYGA 1IO6A 2A7YA 4LD6A 1OEBA 4CC7A 1C1AA 2XKOC 2EGEA 4AFSC 3VS5A 3PVQA 2EBPA 1FMKA 4XTZA 3VYHB 3I56T 1KD1R 5KYUA 5L23A 4OB2B 1NYFA 1X6OA 1UE9A 3HAJA 4A4FA 4C92C 4J7FA 3EJQA 4RTZA 4Z02A 1TS9A 5HCKA 1VQPQ 1B3QA 1X01A 1RAIB 2K57A 2F2VA 3BUDA 1TUDA 4C8QA 3BVVA 2E6NA 1TTHB 4XK8E 3CCRT 2RJCA 4JNFA 2D0NA 2HQEA 3SB2A 1BI1A 3QO3A 2EYYA 3L2RA 3S3NA 2JMCA 3EGXA 2BTTA 4IIOA 1HXKA 1KHIA 1BCOA 3MJXA 1M3CA 5FWBA 1WNLA 1PKTA 4C0GA 2A36A 4DQ2A 1SG5A 2KEAA 2Y90A 2OAUA 3I5RA 2YLLA 4R5IA 5IAYA 1HTYA 3M0QA 2VC8A 4RTXA 4XTUA 2O01E 4E7LA 2EYWA 3CXCA 3H9NA 1U1SA 3V7CA 2GA9D 4AZ5A 5GJWB 1YN8A 2WYIA 2EVRA 2FYVA 3M3WA 2RF0A 3VRZA 2LCCA 5LJ5g 1SSFA 1R0CB 2LX7A 3ULRB 2ZXQA 4KH1B 3OYAA 1M2OA 4WTOB 1UB4A 4QVCA 3EJRA 2MI7A 2YSQA 2V26A 3BDLA 1HSQA 4C0DB 2QQRA 4DEXA 2YKTA 4M7AC 2OTJA 2XDBA 3FC3A 4OB0B 1GRIA 4GLKA 1WQWA 4AVMA 3RR6A 2YHTA 1WYXA 5GMKi 4XTXA 1X6BA 1QWNA 1RABB 3MEAA 1HXDA 1I5LA 3BVUA 2VGMA 3OW2S 2K5LA 2MIOA 1I81A 1SKUB 4FT4A 2JOYA 2QI2A 3VV0A 1AWWA 1RLPC 3EFRA 5E84A 2NCZA 2XI9A 1WJSA 4GY5A 4FM4B 3FJPA 2NUTA 1Y0MA 3M58A 4N4IA 3I39X 2F5TX 1EZZB 2CKKA 3OYBA 2DRKA 5GAOn 1WXTA 4WCIA 4QQ6A 4KT0E 1BCMA 2VB6A 4EMKB 4C92D 2QA4T 1O9SA 4JPBW 1Q86C 4G6QA 3AT1B 2J05A 1YJWQ 2M0OA 1GXIE 3S3MA 3CZSA 5GAN4 2LCSA 4GBQA 3BUPA 5GAOm 1H3HA 3PMIA 3JRZA 1UGPB 2VVKA 3M59A 1VQ6T 4A4GA 2CGHA 3NGPA 2KYBA 1PRMC 5DLQE 2YUOA 4O6JA 4KRTA 3DPOA 3C4SA 1E9VA 3JCMb 2O0I1 4NL2A 1GN9A 2W10A 3V7SA 5ECAA 3OA6A 2F5KA 4C92A 2HSPA 3CCMT 1G83A 1K73C 4Z88A 1FXXA 5CAIA 3OYMA 2RO0A 3MEWA 4JRKA 4JZ4A 4E7SA 2ND0A 3MP8A 4RCCA 2QEXT 3SD4A 4R56A 3CZNA 1D1AA 3DX0A 3AHUA 3CC2Q 1SHFA 5FU6B 3J80E 3QXEB 2LCLA 3RUXA 3OWGA 4JZ3A 1QWUA 1ZSGA 4BB7A 2K9GA 4OMNA 1PD1A 2QTVA 3CVRA 5FLEX 4HVUA 4KGZB 2DERA 3CC4Q 4E47A 4M7AD 1Q81R 3UPUA 4NL3A 2D8HA 2YL5A 2ABLA 4O5VA 2E3IA 1K8AR 1UJYA 2DFUA 1M2VA 2D0QB 1UEBA 5KCOA 3LLLA 1TQVA 1VQNQ 2ZPHB 4KGXB 3G9GA 4FU6A 5LJ5d 9ATCB 3PIOA 4AZGA 1JJ2S 2M16A 4A4HA 2L3SA 2CSIA 3CCQA 2KI7A 1R33A 2RT6A 1NM7A 2LT4A 1C0MA 3OW2P 4OMQA 4FSSA 5CKDA 2BZ8A 5HK0A 2M51A 1OA1A 1UGVA 3EGUA 1VQMQ 3LMFA 1BBZA 2EGCA 4CI0C 2E41A 2I0NA 5A0GA 4E81A 3SYVA 3I55Q 5A2QE 3VEBA 4IM2A 1M90U 2RQWA 4J9EA 3KAVA 1M30A 5FW9A 1M27C 2GFUA 3RKXA 3JCMW 2A28A 3LW5E 5FU7B 4HYBA 3KDRA 3T46A 4LUEA 4FZSA 1XJWB 2CYZB 2HBWA 4A53A 1WQ7A 1QCFA 3SWNB 2EYZA 2JW4A 4H6HA 3OY9A 5HY6A 3FB9A 2R57A 1PNJA 4QT7A 1MMDA 3EG0A 4BACA 1AHJB 2VUBA 4E6RA 3CCLQ 3DPQA 3UF4A 4F00A 1I0CA 4RG2A 1VQLT 4EZSA 4C0DC 1TG0A 3JB9H 1W2BS 1G3WA 2KYMA 2LDMA 3DB4A 3E2UA 2OI3A 1ABOA 1OA0A 2K7AA 5LJ3f 1W6XA 1YBYA 4EMGA 2N3KA 4EZYA 2A37A 5IHKA 5CVIA 4PFZA 4BI8B 3CCSQ 5LJ5j 4DOWA 1NJIC 1H8KA 5DLOA 1WHGA 1O75A 4D8KA 2MPXC 4IIMA 1D09B 3PNWC 3G71Q 4KIKA 2OX7A 3ASKA 3C94A 2MF2A 2LJ0A 1Q82U 1YHQQ 1WFWA 1PM3A 2ZAEA 2J06A 5L8RE 3J81E 4EMKC 3FEOA 4RCBA 1GCQA 5LL6S 3G6ET 2K5FA 1AZGB 1D1BA 2V1QA 5DM7R 3CPWP 3CD6A 1M8MA
chains in the Genus database with same CATH topology
1T0HA 2BZYA 4FM3A 3FD9A 1K9AA 3EG3A 3VS0A 2CDTA 3B53X 1ZUUA 3I01A 4M4ZA 3IQLA 2GTOA 5IH2A 1YP5A 4HR1A 1GNLA 3VEAA 2D1XA 2KR3A 4JJDA 3I9QA 4EZNA 2AZVA 2PTKA 3VS4A 2KE9A 2AKLA 4RTWA 1QWEA 2ENMA 4AG2C 3B51X 2BZXA 4JNEA 2CUBA 2DL4A 1SEMA 5GJVB 3C0CA 2OJ2A 2EX3B 2ROLA 1NEBA 2KBTA 3VRYA 2M0YA 1VYVA 4LE9A 4J9IA 1JQKA 2LMJA 4IWQA 1G2BA 1WX6A 3ZL7C 1JEGA 4CC3A 4RTTA 2C0OA 1PKSA 1Y57A 4Y92A 1OV3A 2KT8A 1KSWA 3NPFA 4J9HA 2G6FX 2DA9A 2EGAA 4OMMA 1WI7A 1UJ0A 3FJ5A 4AG1C 2YUNA 1K1ZA 4RUGA 1NG2A 2PY6A 3VS1A 1VA7A 2DX1A 4OMLA 2YIVX 1MV0B 2DNUA 5IXFA 4KIKB 3ER8C 1JO8A 2YDLA 2SRCA 4HY9A 3H41A 3VKHA 1UFFA 2X5CA 1E1DA 2FPFA 1BB9A 3RBBB 2C0TA 3I5SA 4EIKA 4EZUA 3EHRA 1ARKA 1JXOA 1LCKA 1SU6A 1XOVA 4M0MA 3PE0A 3EHQA 4K11A 2KT1A 2J6OA 1OPLA 3REAB 3REBB 2F2WA 2CREA 2CH4W 4CC2A 3KAWA 2GTJA 2VWFA 4RTVA 2P4RA 5TKYA 3A98A 2QXLA 2GAFD 1IO6A 1QKWA 2DLPA 3RNJA 1X43A 2CH4A 3RV0A 4D8DA 2CT4A 2DYBA 1A0NB 4HR1B 1KIKA 1OEBA 2QFFA 1MUZA 4CC7A 4E3CA 4EZQA 2EGEA 1AWXA 3UA7A 3VS5A 4AFSC 3PVQA 2EBPA 1FMKA 4Z89A 2QDLA 2H8HA 3F7WA 5L23A 1NYFA 1UE9A 1GBQA 2EW3A 3ER9B 3GBQA 1E2UA 3H0HA 4RTZA 2DRMA 5HCKA 4EZOA 1B3QA 3M0PA 4B9QA 1AEYA 2F2VA 2O2OA 1TUDA 4LUDA 1K4US 1PHTA 4J9DA 3EG2A 1FYNA 2DL7A 1ZBJA 1J3TA 4HXJA 5IHIA 3T47A 4JNFA 2D0NA 2LZ6B 4AFQC 2EYYA 3M0RA 2FEIA 1UECA 2JMCA 4OMOA 2BTTA 4IIOA 1PRLC 2O31A 1M3CA 3T48A 3O3OB 5FWBA 1PKTA 1X6GA 4DEYA 2A36A 2KEAA 2IIMA 3I5RA 2ESWA 1UUEA 4ZNXA 3NHNA 2YUQA 3VS3A 4R5IA 4RTYA 2OAWA 3M0QA 5IXBA 4RTXA 1GCPA 2CSQA 2SEMA 2HEQA 2EYWA 3B52X 4IM0A 2A08A 1DKXA 1NLOC 2RQTA 1AZEA 1GNTA 2GA9D 5GJWB 2X3XD 1QLYA 1YN8A 2EVRA 2PNIA 4F17A 2RF0A 4RTUA 3VRZA 1ZUKA 4OMPA 3UA6A 2KXCA 2KROA 4J9GA 2C0IA 2LX7A 2PZ1A 3JV3A 3ULRB 1DKYA 2GNCA 1SSHA 1AWJA 2RQVA 1SRLA 1SRMA 1AWOA 1TUCA 2YSQA 4D8JA 1WA7A 1HSQA 2LNHB 3VS7A 2DMOA 4AFZC 2JS2A 1SHGA 2W0ZA 3M0TA 1JU5C 4DEXA 2DJQA 1RLQC 5FWCA 1GRIA 4EZZA 4R0KA 2KGTA 2OBMA 1WYXA 3OHXM 1X6BA 1ZLMA 3DPPA 5FIGA 3U23A 2LQWA 4IWPA 5I22A 1YCSB 4CC4B 1RUWA 4LN2A 2FPEA 2KRMA 2MIOA 1UG1A 1AWWA 1RLPC 5E84A 3SHWA 3I04A 3PVLA 2NCZA 3O5ZA 4A63B 1Y0MA 1YWPA 2RPNA 1W9MA 3I39X 1ZX6A 3NMZC 1WLPB 2J6KA 2O88A 2DRKA 1WXTA 2DE0X 4WCIA 2DM1A 1E6HA 4JPBW 4G6QA 2J05A 2L2PA 2MCNA 1U00A 4Z8AA 2DVJA 1OOTA 3D2EA 2RN8A 2E5KA 1VYUA 2LCSA 4GBQA 2KRNA 4UDXX 5I11A 1H3HA 3TSZA 2EQIA 3M0SA 4HVWA 4J9FA 2VVKA 2FPDA 2EWFA 3NGPA 2KYBA 1PRMC 3M0UA 2DL5A 2YUOA 2EYXA 2K79A 2YIAA 4KRTA 3DPOA 1E9VA 4EZTA 2ROTA 1GN9A 2LP5A 2W10A 2YT6A 2GBQA 3H0IA 5ECAA 2HSPA 2HCKA 1G83A 4Z88A 4PO2A 3QWYA 1T3LA 1QWFA 2LM0A 1BU1A 2B86A 1GBRA 4JZ4A 1V1CA 2ND0A 2YI8A 3ZEDA 4IM3A 3GI7A 2L0AA 2NUZA 1KJWA 1OPKA 4AFUC 2KRSA 1M3BA 4ESRA 1B07A 2K3BA 2RQUA 4EZXA 1SHFA 2D8JA 2LJ1A 2JM8A 1NEGA 2JXBA 3TSWA 4EZPA 3OWGA 4JZ3A 1ZSGA 5IHNA 3QWXX 4JL9A 1WIEA 4JN4A 1SU7A 4NPHA 3RV1A 3LH5A 2RNAA 2K9GA 3KFVA 4OMNA 2KNBB 5FLEX 3ERCC 4HVUA 2EPDA 3L3OM 2JNSA 4JWDA 1T0JA 2WINM 1X27A 1K0SA 1I07A 1Z9QA 2D8HA 2ABLA 2DILA 1UJYA 3THKA 2DBMA 1VYTA 2Z8YA 3QA8A 1ZUYA 1MJGA 2YUPA 2GQIA 1CKBA 1Z9ZA 2FRWA 2ND1A 3D2FA 2JT4A 1H92A 1UHFA 2L3SA 2CSIA 1KFZA 2RMOA 2O9SA 3QNJA 2RT6A 1K76A 1UTIA 1NM7A 4OMQA 4FSSA 2BZ8A 3I35A 2AZSA 2M51A 5EC7A 1OA1A 1UGVA 3UITA 1E7OA 3EGUA 4JWIA 1JXMA 3LMFA 1MV3A 2FO0A 2JMAA 4HVVA 1W70A 1BBZA 2AK5A 1UHCA 1U06A 2ED0A 2EGCA 2X3WD 3TVTA 2XMFA 2I0NA 3UATA 1WXUA 4R5GA 1X69A 3O3NB 3T49A 2YI9A 1GFCA 4E81A 1X2KA 4EZRA 2J7IA 1N5ZA 1PWTA 3VEBA 4IM2A 2DL8A 2FRYA 1SUFA 2RQWA 1U5SA 1WDXA 2DF6A 4J9EA 3KAVA 2KHOA 1NYGA 1M30A 5FW9A 1M27C 3R6NA 3CQTA 2AKKA 1GL5A 2A28A 1HJDA 4R5KA 4HYBA 4GLMA 4JWCA 2LJ3A 3KDRA 3T46A 4LUEA 1NLPC 1BK2A 2VKNA 2HBWA 1QCFA 2EYZA 2RQRA 2JW4A 4H6HA 1M3AA 4R5LA 2HDAA 3T4AG 1PNJA 4QT7A 2O9VA 2DBKA 1DKZA 1AOJA 2JS0A 3EG0A 2L3PA 2JM9A 4E6RA 3DPQA 3UF4A 4R5JA 4F00A 1I0CA 1RI9A 3VS6A 4EZSA 4F14A 1K0XA 1TG0A 1SPKA 4UDYX 2KYMA 1CKAA 2OI3A 1S1NA 1ABQA 1ABOA 2L3QA 1JQQA 2KXDA 4F16A 1OA0A 3EG1A 2K6DA 2DL3A 2GGRA 2K7AA 4LNPA 1W6XA 4HCKA 1UDLA 2N3KA 2JTEA 1WXBA 4EZYA 2A37A 5IHKA 4J9BA 4X1VA 2ECZA 4J9CA 4ORZA 1QKXA 1T3SA 1H8KA 2MOXA 4D8KA 1SU8A 1ZYLA 4JLCA 4IIMA 2F2XA 2NWMA 3O3MB 1X2QA 4KIKA 2V1RA 4F01A 2K2MA 3C7NA 3VS2A 1AVZC 4JJBA 1AD5A 1I1JA 1UPXA 2EKHA 3H0FA 1GCQC 1CSKA 2CUDA 2LJ0A 2YIBA 4IW0A 1E6GA 4IWOA 1WFWA 2LQNA 1OAOA 3SEMA 2FG0A 1GFDA 2J06A 2CT3A 1EFNA 1W1FA 1YWOA 4EZWA 4H6IA 1GCQA 1U3OA 4JJCA 1YNZA 2OBLA 4JWEA 1HD3A 1AZGB 2J6FA 2ED1A 2V1QA 4EZVA 1M8MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T0H A;  2BZY A;  3EG3 A;  1K9A A;  3VS0 A;  2CDT A;  1ZUU A;  4M4Z A;  3IQL A;  2GTO A;  5IH2 A;  1YP5 A;  2KR3 A;  2D1X A;  4JJD A;  3I9Q A;  2PTK A;  2AZV A;  3VS4 A;  2KE9 A;  2AKL A;  4RTW A;  1QWE A;  2ENM A;  4AG2 C;  2BZX A;  2CUB A;  2DL4 A;  1SEM A;  5GJV B;  3C0C A;  2OJ2 A;  2ROL A;  1NEB A;  2KBT A;  3VRY A;  2M0Y A;  1VYV A;  4LE9 A;  4J9I A;  2LMJ A;  1G2B A;  1WX6 A;  3ZL7 C;  1JEG A;  4CC3 A;  4RTT A;  2C0O A;  1PKS A;  1Y57 A;  4Y92 A;  1OV3 A;  2KT8 A;  1KSW A;  3NPF A;  4J9H A;  2G6F X;  2DA9 A;  2EGA A;  4OMM A;  1WI7 A;  1UJ0 A;  3FJ5 A;  4AG1 C;  2YUN A;  1K1Z A;  4RUG A;  1NG2 A;  3VS1 A;  1VA7 A;  2DX1 A;  4OML A;  2DNU A;  1MV0 B;  5IXF A;  1JO8 A;  2YDL A;  2SRC A;  3H41 A;  1UFF A;  2FPF A;  1BB9 A;  3RBB B;  2C0T A;  3I5S A;  4EIK A;  3EHR A;  1ARK A;  1JXO A;  1LCK A;  1XOV A;  3PE0 A;  3EHQ A;  4K11 A;  2KT1 A;  2J6O A;  1OPL A;  3REA B;  3REB B;  2F2W A;  2CRE A;  2CH4 W;  4CC2 A;  2GTJ A;  2VWF A;  4RTV A;  2P4R A;  3A98 A;  1IO6 A;  1QKW A;  2DLP A;  3RNJ A;  1X43 A;  2CH4 A;  4D8D A;  2CT4 A;  2DYB A;  1A0N B;  1KIK A;  1OEB A;  4CC7 A;  1MUZ A;  2EGE A;  1AWX A;  3UA7 A;  3VS5 A;  4AFS C;  3PVQ A;  2EBP A;  1FMK A;  4Z89 A;  2QDL A;  2H8H A;  5L23 A;  1NYF A;  1UE9 A;  1GBQ A;  2EW3 A;  3GBQ A;  3H0H A;  4RTZ A;  2DRM A;  5HCK A;  1B3Q A;  3M0P A;  1AEY A;  2F2V A;  2O2O A;  1TUD A;  4LUD A;  1K4U S;  1PHT A;  4J9D A;  3EG2 A;  1FYN A;  2DL7 A;  1ZBJ A;  1J3T A;  4HXJ A;  5IHI A;  2D0N A;  2LZ6 B;  4AFQ C;  2EYY A;  3M0R A;  2FEI A;  1UEC A;  2JMC A;  4OMO A;  2BTT A;  4IIO A;  1PRL C;  2O31 A;  1M3C A;  5FWB A;  1PKT A;  1X6G A;  4DEY A;  2A36 A;  2KEA A;  2IIM A;  3I5R A;  2ESW A;  1UUE A;  4ZNX A;  3NHN A;  2YUQ A;  3VS3 A;  4RTY A;  2OAW A;  3M0Q A;  5IXB A;  4RTX A;  1GCP A;  2CSQ A;  2SEM A;  2HEQ A;  2EYW A;  2A08 A;  1NLO C;  2RQT A;  1AZE A;  5GJW B;  2X3X D;  1QLY A;  1YN8 A;  2EVR A;  2PNI A;  4F17 A;  2RF0 A;  4RTU A;  3VRZ A;  1ZUK A;  4OMP A;  3UA6 A;  2KXC A;  2KRO A;  4J9G A;  2C0I A;  2LX7 A;  2PZ1 A;  3JV3 A;  3ULR B;  2GNC A;  1SSH A;  1AWJ A;  2RQV A;  1SRL A;  1SRM A;  1AWO A;  1TUC A;  2YSQ A;  1WA7 A;  1HSQ A;  2LNH B;  3VS7 A;  2DMO A;  4AFZ C;  2JS2 A;  1SHG A;  2W0Z A;  3M0T A;  1JU5 C;  4DEX A;  2DJQ A;  1RLQ C;  5FWC A;  1GRI A;  4R0K A;  2KGT A;  1WYX A;  1X6B A;  1ZLM A;  3U23 A;  2LQW A;  5I22 A;  1YCS B;  4CC4 B;  1RUW A;  4LN2 A;  2FPE A;  2KRM A;  2MIO A;  1UG1 A;  1AWW A;  1RLP C;  3SHW A;  3PVL A;  3O5Z A;  4A63 B;  1Y0M A;  1YWP A;  2RPN A;  1ZX6 A;  3NMZ C;  1WLP B;  2J6K A;  2O88 A;  2DRK A;  1WXT A;  2DE0 X;  4WCI A;  2DM1 A;  1E6H A;  4JPB W;  2J05 A;  2L2P A;  2MCN A;  4Z8A A;  2DVJ A;  1OOT A;  2RN8 A;  2E5K A;  1VYU A;  2LCS A;  4GBQ A;  2KRN A;  5I11 A;  1H3H A;  3TSZ A;  2EQI A;  3M0S A;  4HVW A;  4J9F A;  2VVK A;  2FPD A;  3NGP A;  2KYB A;  1PRM C;  3M0U A;  2DL5 A;  2YUO A;  2EYX A;  2K79 A;  4KRT A;  2ROT A;  2LP5 A;  2W10 A;  2YT6 A;  2GBQ A;  3H0I A;  5ECA A;  2HSP A;  2HCK A;  1G83 A;  4Z88 A;  3QWY A;  1T3L A;  1QWF A;  1BU1 A;  2B86 A;  1GBR A;  4JZ4 A;  1V1C A;  2L0A A;  2NUZ A;  1KJW A;  1OPK A;  4AFU C;  2KRS A;  1M3B A;  4ESR A;  1B07 A;  2K3B A;  2RQU A;  1SHF A;  2D8J A;  2LJ1 A;  2JM8 A;  1NEG A;  2JXB A;  3TSW A;  4JZ3 A;  1ZSG A;  5IHN A;  3QWX X;  1WIE A;  3LH5 A;  2RNA A;  2K9G A;  3KFV A;  4OMN A;  2KNB B;  4HVU A;  2EPD A;  1T0J A;  1X27 A;  1K0S A;  1I07 A;  1Z9Q A;  2D8H A;  2ABL A;  2DIL A;  1UJY A;  3THK A;  2DBM A;  1VYT A;  1ZUY A;  2YUP A;  2GQI A;  1CKB A;  1Z9Z A;  2FRW A;  1H92 A;  2JT4 A;  1UHF A;  2L3S A;  2CSI A;  1KFZ A;  2RMO A;  2O9S A;  1UTI A;  1K76 A;  1NM7 A;  4OMQ A;  4FSS A;  2BZ8 A;  3I35 A;  2AZS A;  2M51 A;  5EC7 A;  1UGV A;  1E7O A;  3EGU A;  1JXM A;  1MV3 A;  2FO0 A;  2JMA A;  4HVV A;  1W70 A;  1BBZ A;  2AK5 A;  1UHC A;  1U06 A;  2ED0 A;  2EGC A;  2X3W D;  3TVT A;  2XMF A;  2I0N A;  3UAT A;  1WXU A;  1X69 A;  1GFC A;  1X2K A;  2J7I A;  1N5Z A;  1PWT A;  2DL8 A;  2FRY A;  2RQW A;  1U5S A;  1WDX A;  2DF6 A;  4J9E A;  1NYG A;  1M30 A;  5FW9 A;  1M27 C;  3R6N A;  3CQT A;  2AKK A;  1GL5 A;  2A28 A;  1HJD A;  4GLM A;  2LJ3 A;  4LUE A;  1NLP C;  1BK2 A;  2VKN A;  2HBW A;  1QCF A;  2EYZ A;  2RQR A;  2JW4 A;  1M3A A;  2HDA A;  1PNJ A;  4QT7 A;  2O9V A;  2DBK A;  1AOJ A;  2JS0 A;  3EG0 A;  2L3P A;  2JM9 A;  4E6R A;  3UF4 A;  1I0C A;  1RI9 A;  3VS6 A;  4F14 A;  1K0X A;  1TG0 A;  1SPK A;  2KYM A;  1CKA A;  2OI3 A;  1S1N A;  1ABQ A;  1ABO A;  2L3Q A;  1JQQ A;  2KXD A;  4F16 A;  3EG1 A;  2K6D A;  2DL3 A;  2GGR A;  2K7A A;  4LNP A;  1W6X A;  4HCK A;  1UDL A;  2JTE A;  1WXB A;  2A37 A;  5IHK A;  4J9B A;  4X1V A;  2ECZ A;  4J9C A;  4ORZ A;  1QKX A;  1T3S A;  1H8K A;  2MOX A;  4D8K A;  4IIM A;  2F2X A;  2NWM A;  1X2Q A;  2V1R A;  2K2M A;  3VS2 A;  1AVZ C;  4JJB A;  1AD5 A;  1I1J A;  2EKH A;  3H0F A;  1GCQ C;  1CSK A;  2CUD A;  2LJ0 A;  1E6G A;  1WFW A;  2LQN A;  3SEM A;  2FG0 A;  1GFD A;  2J06 A;  2CT3 A;  1EFN A;  1W1F A;  1YWO A;  1GCQ A;  1U3O A;  4JJC A;  1YNZ A;  1HD3 A;  1AZG B;  2J6F A;  2ED1 A;  2V1Q A;  1M8M A; 
#chains in the Genus database with same CATH topology
 2R58 A;  3L3P A;  1JJ2 P;  2WSF E;  1YI2 Q;  4ELY C;  1VQ9 Q;  1C6V X;  1V29 B;  3NTI A;  1YP5 A;  2R5A A;  2QTX A;  4J6Y A;  3E9F A;  3EFS A;  4XU3 A;  5CCA A;  5CO7 A;  4XTY A;  3LWH A;  4EZN A;  1WHH A;  2PTK A;  2QQS A;  2ENM A;  4F7U E;  2RAK A;  4JNE A;  3E9G A;  4ATM A;  1SEM A;  3NFC A;  5KYW B;  2QK0 A;  1VYV A;  1YJN A;  2LMJ A;  1OU9 A;  1WX6 A;  4BE0 A;  3Q0K A;  3ZL7 C;  1JEG A;  4CC3 A;  4FYX B;  1I8F A;  1PKS A;  4FT2 A;  4Y92 A;  2DXU A;  1Y2O A;  2HBP A;  2KT8 A;  4AMC A;  4EMH A;  2BE9 B;  2H3J A;  3JCM V;  4J9H A;  3UT1 A;  2DK3 A;  2CZ7 B;  4N0A C;  3JCM J;  4I1Q A;  4AG1 C;  4H8S A;  1NG2 A;  5FU6 C;  3VS1 A;  2OTL A;  4XQ3 A;  1MV0 B;  1MNE A;  3OBW A;  2D4C A;  4F7U B;  3L2W A;  3GNG A;  4PJO C;  2QQB A;  3RBB B;  1BB9 A;  2OO2 A;  3KBG A;  4EIK A;  1MMA A;  2X4W A;  4AZI A;  2XID A;  1LCK A;  1Q7Y U;  1SU6 A;  5GAN 6;  5LJ3 g;  2KK4 A;  3M9Q A;  1N8R C;  2LTO A;  2DXT A;  2F2W A;  4CC2 A;  2ZZD A;  5GMK j;  3KAW A;  2Z0N A;  1W2B P;  5TKY A;  2EQM A;  2DLP A;  2F7P A;  1OX9 A;  1X43 A;  2VGN A;  2DYB A;  1YIT Q;  1A0N B;  2ZPF B;  5CIU A;  4DA4 A;  1WPY A;  4FL6 A;  3V8K A;  3CCU Q;  1FMW A;  1KQS A;  2JNK A;  1WHM A;  2P0P A;  2H8H A;  5CKB A;  4C5G A;  4C8Q C;  1QVG S;  3CBP A;  2EW3 A;  2OTJ T;  3DDG A;  4BY6 B;  4ME7 A;  3KXT A;  3GBQ A;  1E2U A;  2NLU A;  4EZO A;  3HL8 A;  2HKQ B;  3M0P A;  4B9Q A;  2DKG A;  2IVW A;  3GPL A;  4LUD A;  1RAG B;  4M7D E;  3I56 Q;  3MET A;  4AZ7 A;  3BE3 A;  3QII A;  2QDY B;  2ZPG B;  3UWN A;  1TXQ A;  1QCO A;  5J39 A;  2X4J A;  4AFQ C;  3M0R A;  2D9T A;  4JS4 A;  4OMO A;  1PRL C;  4OP0 A;  3T48 A;  2WSE E;  3O3O B;  4DEY A;  3HSB A;  3DX2 A;  3CCR Q;  4PFO A;  2IIM A;  3OB9 A;  2RJD A;  4M7D G;  4ZNX A;  5C6S A;  1TQW A;  3BVX A;  3LLR A;  3WVD B;  3VS3 A;  4RTY A;  3SWN C;  2QYZ A;  3ABH A;  4EMK A;  5GAM f;  2CSQ A;  2SEM A;  4OGC A;  1YJW A;  2L8D A;  1WGS A;  1NLO C;  3CCV A;  4M7D B;  2JJ9 A;  3HFN A;  2VYT A;  2X3X D;  1QLY A;  3MCA B;  4F17 A;  2GFA A;  4OMP A;  1MMN A;  4DBF A;  1PD0 A;  3UA6 A;  1OYX A;  2PZ1 A;  3EGD B;  2ZCF B;  4PL6 A;  4BI3 A;  2GNC A;  1SSH A;  2LRQ A;  2RQV A;  3DLM A;  3EFO B;  1N8R U;  1QMC A;  4AZC B;  1SRM A;  1AWO A;  5GAO q;  1Q95 G;  2ZPE B;  3OS2 A;  4D8J A;  1WA7 A;  1BIB A;  3MEV A;  2RB6 A;  2DMO A;  2Z0O A;  1SHG A;  2RM4 A;  3OK8 A;  5FWC A;  2WAC A;  4ZTJ A;  3EJT A;  2M02 A;  4R0K A;  2OBM A;  1M1K R;  1ZWW A;  2RHY A;  5FIG A;  3M53 A;  5I22 A;  3LYI A;  1YCS B;  4N0A A;  4N4G A;  3DLL A;  1D0X A;  3G4S A;  1QVF A;  3JSC A;  5FRN A;  3SHW A;  3PVL A;  3DX4 A;  4F7U F;  3VU3 C;  2COZ A;  3D51 A;  1W9M A;  4ANJ A;  3GNF B;  3CPF A;  2J6K A;  2DE0 X;  4LD9 K;  1E6H A;  2L2P A;  3CMA A;  1U00 A;  4Z8A A;  2DVJ A;  3D52 A;  1K9M R;  1OOT A;  5LJ3 d;  4E7K A;  3QZ9 B;  1QVG P;  1QCN A;  2WYH A;  4KH0 B;  2HNI A;  1Y7X A;  1VQO T;  3OS5 A;  5I11 A;  2DTH A;  3EJS A;  3TSZ A;  2QA4 Q;  2EQI A;  2DJZ A;  4J9F A;  2EWF A;  2DZC A;  5CKE A;  2L89 A;  2L3R A;  3HRS A;  3CCQ T;  3HTR A;  2YIA A;  4EZT A;  2ROT A;  5GAM g;  4LDY A;  2D6F A;  4BI4 A;  1VQ6 Q;  1KQ1 A;  2LM0 A;  2YL6 A;  1BU1 A;  2B86 A;  4E7H A;  1IB8 A;  4MZP A;  3A5Z B;  3GP8 A;  2DTI A;  3GI7 A;  2L0A A;  3J7A F;  4AFU C;  2NUP B;  1M3B A;  3CCM Q;  4IUP A;  4ESR A;  1YJ9 A;  2RQU A;  3I55 A;  4AZB A;  3SOG A;  2LJ1 A;  3FDR A;  3CAZ A;  3A8H B;  4HCB A;  1NEG A;  2JXB A;  3OYH A;  4FZO A;  3TSW A;  1QP2 A;  2QEX Q;  3LH5 A;  8AT1 B;  4DBR A;  4NOY A;  4TVR A;  3SWN A;  4PFP A;  1VQK A;  5GAN f;  3MO8 A;  4M7D F;  2JNS A;  4JWD A;  1Y96 B;  1T0J A;  2BE7 D;  2WIN M;  1X27 A;  1K0S A;  1I07 A;  3X20 B;  3CC7 T;  2DIL A;  2DBM A;  3BFM A;  1ZUY A;  3PGG A;  2YUP A;  2F7Q A;  1VQ8 T;  1CKB A;  3LH0 A;  2FRW A;  4C5E A;  4C0Z A;  6AT1 B;  1UHF A;  4BY6 C;  1ZHI A;  5LJ3 j;  3HAH A;  2O9S A;  4FIB A;  2PUO B;  3CXC S;  1NE8 A;  3QNJ A;  2IPO B;  3E19 A;  3OYE A;  3URG A;  3I35 A;  3D4Y A;  3UIT A;  5LJ5 e;  8ATC B;  4JWI A;  2V8I A;  1MV3 A;  2FO0 A;  1N9R A;  4JLI A;  1WHK A;  4PJN A;  1U06 A;  5DY9 A;  4MZM A;  2VXF A;  1YIJ A;  1VQ4 A;  2F1L A;  4R5G A;  2JNG A;  4L5G A;  2YI9 A;  1GFC A;  1YHQ A;  2J7I A;  1N5Z A;  1PWT A;  2FRY A;  1RL2 A;  1WHL A;  3O8V A;  1WDX A;  1ZA1 B;  2DF6 A;  2KHO A;  2LVM A;  2YXY A;  1BI0 A;  2X3V A;  1HJD A;  3QYG B;  3DB3 A;  2LJ3 A;  3CD6 T;  3JB9 J;  4M7D C;  3EJP A;  1BK2 A;  4Q5W A;  2DIG A;  4AKV A;  2X9H A;  4R5L A;  2HDA A;  1JRI A;  3JCM P;  3EH1 A;  5AT1 B;  1OQK A;  1ZBX A;  2EFI A;  1VQ5 A;  1AT1 B;  2DBK A;  1DJ7 B;  2JS0 A;  4C5I A;  4V2S A;  1M5Q 1;  4M77 E;  5A0D A;  4F14 A;  3MPU B;  3VKI A;  1SPK A;  1YJN T;  5KYW A;  3H6Z A;  4PNO A;  1M90 C;  1ABQ A;  3MP6 A;  1JQQ A;  3QNI A;  1IHW A;  3X24 B;  2M9U A;  1VQ7 A;  2DL3 A;  2GGR A;  1UDL A;  2ZPB B;  1VQL Q;  1WXB A;  2LNV A;  5GAN g;  4M77 G;  1Q81 U;  2ECZ A;  1QKX A;  2XU8 A;  5GAM d;  1T3S A;  3CCE A;  3E1S A;  4HT9 A;  2OTL T;  4JLC A;  1K8A U;  2CP6 A;  4L6V 5;  3TQ7 P;  2LX9 A;  3O3M B;  2K2M A;  3C7N A;  2E65 A;  1AD5 A;  1I1J A;  1UPX A;  3L2Z A;  3H0F A;  2DYI A;  1GCQ C;  3GOX A;  4M77 B;  3FRN A;  2CUD A;  4F7U A;  3SEM A;  1GFD A;  2YRD A;  2FB7 A;  4ELZ C;  1EFN A;  4H6I A;  1KK7 A;  1YNZ A;  4JWE A;  3X26 B;  4XTW A;  3H8Z A;  2RHU A;  2J6F A;  2ED1 A;  5GMK e;  2VXE A;  4IUQ A;  1JJ2 A;  3EG3 A;  3FD9 A;  2CP5 A;  3JCM Q;  3B53 X;  4EPC A;  3I01 A;  3G6E Q;  3CXC P;  5IH2 A;  3CPW S;  5D6X A;  3TCJ A;  3ZBD A;  3VEA A;  2KR3 A;  3ME9 A;  3JCM f;  3EJU A;  3RES A;  1QWE A;  4DOV A;  3L2Q A;  1RAC B;  3B51 X;  2LXY A;  2X4Y A;  2CUB A;  2DL4 A;  4FW1 A;  2YL8 A;  2QQA A;  2OJ2 A;  1Q82 C;  3M4Y A;  1TOV A;  2KBT A;  3CCJ A;  4WPE A;  4J9I A;  4KUL A;  1QX1 A;  2GF4 A;  5I21 A;  3OQ5 A;  4IWQ A;  3QWE A;  2MI6 A;  1VIE A;  3HAI A;  4XU2 A;  2F69 A;  5GAO r;  4OGE A;  1I4T A;  2XIC A;  4M7D D;  3FJ5 A;  1K1Z A;  1PSF A;  2PY6 A;  3OYJ A;  1VA7 A;  2DX1 A;  3QDF A;  3CME A;  5IXF A;  1JO8 A;  2XDP A;  5C5B B;  2SRC A;  4R55 A;  2KVQ G;  4M75 E;  1E1D A;  5LJ5 h;  3UDC A;  2WSC E;  2C0T A;  5GAM j;  4JRI A;  4EZU A;  4HA8 A;  1KC8 C;  2VAS A;  3M5A A;  2F7O A;  4M0M A;  2XDD A;  1Q86 R;  3CCV T;  1OPL A;  4BDY A;  3ACO A;  2DAQ A;  4M7D A;  1OX8 A;  4M75 G;  2QXL A;  2GAF D;  3VUB A;  3QYH B;  2EJF A;  4ZGJ B;  1G3Y A;  2MK5 A;  3QZ5 B;  3S6W A;  5KH6 A;  3BVW A;  3RNJ A;  5HK3 A;  2CH4 A;  1I4L A;  3RV0 A;  4D8D A;  2CT4 A;  1S72 A;  2RD1 A;  3EGD A;  4F04 B;  2RI3 A;  4HR1 B;  1KIK A;  2QFF A;  1EX4 A;  1MUZ A;  3EFO A;  4E3C A;  3UA7 A;  4AZC A;  4Z89 A;  2QDL A;  4M75 B;  2RK1 A;  2Y4X A;  4PJJ A;  5FRM A;  5I2M A;  2COW A;  1B34 B;  2JTF A;  4B9X A;  2EKO A;  1D0Z A;  1K73 R;  3H0H A;  2CZ6 B;  2DRM A;  3GF5 A;  3RMQ A;  1AEY A;  1Q7Y C;  1MHN A;  2HKN A;  3EG2 A;  1FYN A;  1ZBJ A;  3QSU A;  4HXJ A;  5IHI A;  3T47 A;  3LX7 A;  2OTJ Q;  2KMT A;  2LZ6 B;  2MWO A;  5GAN d;  3G4S T;  2FEI A;  1UEC A;  3PLT A;  3JCM g;  5IN1 A;  2O31 A;  2QGF B;  4M77 F;  5D7U A;  5M9O A;  3N5B B;  2ESW A;  1UUE A;  2YRV A;  4M78 E;  3TRE A;  2R5M A;  3NHN A;  2F7R A;  2E3H A;  1LQ7 A;  2PUK B;  2V8K A;  2OAW A;  5IXB A;  1ZSZ B;  2DXB A;  1M4Z A;  3CMA T;  1UGS B;  4A4E A;  3RIR A;  3TEE A;  4DBH A;  1IGQ A;  1DKX A;  2LQ8 A;  5I2S A;  4FCY A;  3A8M B;  2OZN B;  2RQT A;  5J3B A;  1AZE A;  2PNI A;  2EJG A;  4M78 G;  2K3X A;  2QA4 A;  2EYQ A;  1XQH A;  2KRO A;  4J9G A;  7AT1 B;  2C0I A;  1KC8 U;  3JV3 A;  4D6W A;  4FW2 A;  5GMK h;  1VQP A;  1X03 A;  3OYI A;  4M78 B;  2IG0 A;  2LNH B;  1Q82 R;  4XTV A;  2JS2 A;  3M0T A;  2W0Z A;  1OU8 A;  3HPW A;  2DJQ A;  4F7U G;  2PVO B;  4EZZ A;  1RAE B;  2Z0W A;  3OHX M;  1ZLM A;  2NUP A;  3QJ6 A;  2LQW A;  4IWP A;  3LWI A;  4KUD K;  1YFN A;  4CC4 B;  3PFS A;  1YJ9 T;  4M77 C;  4C5H A;  2HAX A;  1RUW A;  1M9S A;  2HQX A;  2KRM A;  2K4Y A;  1R5E A;  2YLA A;  1F1B B;  3A1P A;  2EIF A;  2BKD N;  2Z0V A;  1YWP A;  1WJQ A;  3HRU A;  3NMZ C;  2RH2 A;  2OW7 A;  5GAN j;  1VQK T;  4E7I A;  3NTH A;  3QDR B;  1TQU A;  2L5Q A;  2DM1 A;  3OMC A;  1TQS A;  5FRO A;  3HHT B;  1PSE A;  1JBM A;  3D2E A;  2XK0 A;  4M7A E;  2RN8 A;  2E5K A;  2QAS A;  4EDU A;  1G5V A;  3ZFJ A;  3M0S A;  3JCM c;  2FPD A;  4DBQ A;  4M75 F;  4P5N A;  5LJ3 e;  2Y4Y A;  3QJY A;  3M0U A;  2EYX A;  1VQO Q;  4MMK A;  2F1B A;  3OYF A;  1KD1 C;  3DX1 A;  2GBQ A;  1HWW A;  4FZP A;  2EWN A;  3BY7 A;  1BI2 A;  4PO2 A;  3QWY A;  1EIF A;  1QWF A;  1NJI R;  3G1J A;  3CCQ Q;  1GBR A;  4IM3 A;  2ELB A;  2NUZ A;  4FYW B;  1YIJ T;  1VQ4 T;  2CS7 A;  1D3B B;  3FLG A;  1VOM A;  4PLL A;  4M7A B;  1ACM B;  1KQS S;  4PJL A;  2D8J A;  5FU7 C;  1N9S A;  1TWB A;  2DEU A;  4BE2 A;  1YWM A;  4EZP A;  4DYL A;  4J6W A;  3JCM d;  4JL9 A;  1WIE A;  4JN4 A;  3KUF A;  4NPH A;  4ZGD B;  3RV1 A;  2RNA A;  3KFV A;  3OSV A;  2KNB B;  4MDW A;  3ERC C;  4J5Y A;  1M1K U;  4IKF A;  3V8L A;  4OVA A;  1VQ5 T;  1Z9Q A;  1W4S A;  4KGV B;  3THK A;  3QA8 A;  3JB9 G;  1MJG A;  2DVE A;  2GQI A;  2DXC A;  2RHI A;  1Z9Z A;  2P0Q A;  2ND1 A;  4M77 D;  3HRT A;  3M55 A;  4M78 F;  3CC7 Q;  2RMO A;  2E64 A;  1VQ7 T;  3WVE B;  1UTI A;  1K76 A;  1VQ8 Q;  1JB0 E;  2E12 A;  1PCX A;  2AZS A;  1MGQ A;  3RPM A;  1UGR B;  2KY9 A;  1E7O A;  5A0L A;  1OUL A;  1JXM A;  3CCE T;  3CC2 A;  4AZH A;  3M57 A;  3OYC A;  4DCN C;  2QAZ A;  4A54 A;  2JMA A;  4HVV A;  2FHD A;  1W70 A;  2ED0 A;  1UHC A;  2X3W D;  3TVT A;  5GMK l;  1WXU A;  5KE3 A;  2JVV A;  5CQY A;  2LQK A;  1KD1 U;  1X69 A;  3O3N B;  4M77 A;  3T49 A;  3EAE A;  1X2K A;  5CR2 A;  5KYX B;  4Y28 E;  2DL8 A;  1D1C A;  1SUF A;  5C0M A;  2H3E B;  1U5S A;  1ZSZ C;  3CC4 A;  3R6N A;  3P8B B;  1GL5 A;  4ZTF A;  1FX7 A;  3RKW A;  4JWC A;  1N8R R;  1NLP C;  5KYN A;  1IRE B;  1M3A A;  2JZ2 A;  3EG9 B;  2X3W A;  2YLC A;  2DD4 A;  1VQN A;  3OMG A;  2F18 A;  4RMO A;  2QG9 B;  2O9V A;  2RHX A;  3CD6 Q;  1AOJ A;  4JRP A;  4FYY B;  4M78 C;  1K0X A;  3CCJ T;  1CKA A;  2V8J A;  1VQM A;  4UC4 A;  2KXD A;  1BI3 A;  3LGL A;  3EG1 A;  2X35 A;  4QKU A;  1KQS P;  2K6D A;  1LPL A;  4IUV A;  4RKU E;  4X9C A;  3I2W A;  3OBY A;  4PK4 A;  1YJN Q;  4X1V A;  4J9C A;  2E6Z A;  4ORZ A;  2MOX A;  2EQJ A;  2RJF A;  5LJ3 h;  2OW6 A;  1ZYL A;  2PMR A;  2YL9 A;  4M7A F;  2F2X A;  2NWM A;  3CME T;  4OB3 B;  1N6A A;  5C5B A;  2V1R A;  5D6Y A;  4F01 A;  3VS2 A;  4JJN K;  2EKH A;  2RK2 A;  2YIB A;  2HL5 C;  4IW0 A;  3QBY A;  5GAM e;  1G3T A;  1M1G A;  1U1T A;  2OTL Q;  4M75 D;  4PLI A;  3V7R A;  1W1F A;  1YWO A;  1U3O A;  2HZY A;  1HD3 A;  3HP9 A;  2HQH A;  2JUF A;  1T0H A;  1K9A A;  2QXF A;  3CCL A;  2CDT A;  1I49 A;  1ZUU A;  2RA2 A;  1Q81 C;  1S72 T;  4M4Z A;  3IQL A;  4HR1 A;  1GNL A;  1K8A C;  2D1X A;  3OYL A;  3I9Q A;  2AZV A;  1TU0 B;  3D50 A;  3X28 B;  4AG2 C;  4M75 A;  3OW2 A;  4J83 A;  3C0C A;  1B34 A;  2ROL A;  2GCX A;  1NEB A;  3VRY A;  3ZEH A;  2M0Y A;  4LE9 A;  3CCS A;  1JQK A;  4E7Z A;  3JB9 F;  2MYS A;  5D6W A;  2EFK A;  4X9D A;  4ZN1 A;  2C0O A;  2QKW A;  4WF2 A;  1B7T A;  1OV3 A;  4YTL A;  3MEU A;  3C12 A;  3G71 A;  3NPF A;  4QW2 A;  1RAH B;  3P8D A;  2EJ9 A;  3INZ A;  2DA9 A;  1I5O B;  2EGA A;  4OMM A;  5CK9 A;  1WI7 A;  1FWZ A;  3ER0 A;  4RUG A;  3A8G B;  1ZA2 B;  3TU4 K;  5KCH A;  2LC4 A;  2K2V A;  4XU1 A;  5AYF A;  4OF1 A;  2KQW A;  4IUU A;  4FYV B;  3ER8 C;  2YDL A;  1NZ9 A;  2NYS A;  2E70 A;  1UFF A;  1LNX A;  4B6M A;  2K3Y A;  2RAJ A;  2FPF A;  1URU A;  3I5S A;  3M54 A;  1QVF P;  1P92 A;  1ARK A;  4M78 D;  2DET A;  1OI1 A;  1YI2 A;  1ZSZ A;  2AT1 B;  1VQ9 A;  3EHQ A;  4K11 A;  3OYK A;  4HCC A;  2P4T A;  2FL7 A;  3REB B;  2CRE A;  2E5Q A;  2GTJ A;  4RTV A;  2P4R A;  3A98 A;  1XTD A;  2DIQ A;  3OYN A;  2HD0 A;  1QKW A;  1SF9 A;  3CCV Q;  2ZGW A;  1VQP T;  4EZQ A;  1AWX A;  1MND A;  2HL3 A;  2GF7 A;  4M78 A;  3F7W A;  1KHC A;  2V0O A;  1GBQ A;  4E7J A;  2DPP B;  3ER9 B;  2LT1 A;  4MZT A;  1O7D B;  5GAN 7;  1K4U S;  2O2O A;  3BUQ A;  3A8L B;  3SDZ A;  4PJO E;  1PHT A;  1RI0 A;  4J9D A;  2DL7 A;  4HKE A;  1WDZ A;  2Q12 A;  1J3T A;  3FIF A;  3D7S B;  1U8R A;  2M1H A;  3QE6 A;  5HKC A;  2PVG B;  1PS3 A;  2ALW A;  1R8O B;  3OYG A;  1TUG B;  4ATO A;  1BKB A;  2O4X B;  1NPP A;  1RAA B;  1X6G A;  2P84 A;  2EQU A;  4PJO G;  2YRC A;  1Y71 A;  5GAN 2;  1IRX A;  1WHJ A;  3CPW A;  3VJP A;  3G4S Q;  5GAN e;  2YUQ A;  2AHJ B;  1UGQ B;  2RJE A;  1GCP A;  2HEQ A;  3B52 X;  4IM0 A;  5GAN 8;  1G3S A;  2A08 A;  2BUD A;  3OYY A;  5KYY B;  3L2V A;  1YIT A;  4PJO B;  4C8Q E;  2P0K A;  1GNT A;  4IUR A;  3CCU A;  2FZG B;  1PC0 A;  5GAM h;  5GAN 3;  4RTU A;  3PIP A;  2EFL A;  1ZUK A;  2E4H A;  4NQI A;  3CMA Q;  2KXC A;  1XNI A;  2PU9 B;  1DKY A;  2FIC A;  3OS1 A;  1AWJ A;  1SRL A;  1VQO A;  1TUC A;  4C8Q G;  1HK9 A;  4N4H A;  4LDV A;  5KYU B;  3VS7 A;  4QVD A;  3I56 A;  1QVP A;  4AFZ C;  1Q86 U;  1JU5 C;  1KQ2 A;  1RLQ C;  4LXC A;  1LVK A;  2KGT A;  3WXM B;  1H3Z A;  4C8Q B;  3DPP A;  3DX3 A;  3U23 A;  1D3B A;  4M7A A;  3CCR A;  4LN2 A;  2FPE A;  2CZ0 B;  4X34 A;  1UG1 A;  3EGX B;  3I04 A;  3O5Z A;  4A63 B;  2BIV A;  1YJW T;  2RPN A;  3CBM A;  1YJ9 Q;  1IZ6 A;  2HMA A;  1ZX6 A;  1K73 U;  1WLP B;  2FVU A;  2FYK A;  1W2B A;  3LGF A;  1D0Y A;  2O88 A;  2X4X A;  2JTM A;  3JB9 D;  3NTK A;  2MCN A;  3S3O A;  2EAY A;  3P8H A;  1IHV A;  4JUV A;  4KUI A;  3QPH A;  2E1H A;  4J8O A;  4FSX A;  3OSS C;  1VYU A;  1VQK Q;  2KRN A;  4UDX X;  2XG8 D;  2D1L A;  4HVW A;  1WJR A;  1NPR A;  3CC7 A;  3A8O B;  2GQV A;  2ATC B;  2CZ1 B;  1M90 R;  2DL5 A;  2I2L A;  2K79 A;  1VQ8 A;  1KG1 A;  2LP5 A;  2YT6 A;  3C95 A;  3H0I A;  1OZ3 A;  2HCK A;  4E2F B;  2G3R A;  3RKY A;  3CC2 T;  1T3L A;  1R77 A;  1V1C A;  2YI8 A;  3ZED A;  1KJW A;  3JAM E;  3D4Z A;  1OPK A;  3L42 A;  2KRS A;  3PTA A;  4BNE A;  1B07 A;  2DEQ A;  2K3B A;  2QQ9 A;  4EZX A;  4LDW A;  5KYX A;  4NS5 A;  2JM8 A;  3HFO A;  2QGG A;  2KDS A;  1TSF A;  2XHC A;  3CC4 T;  1YIJ Q;  1VQ4 Q;  3PMT A;  3QWX X;  5IHN A;  2NUT B;  1SU7 A;  5GAO l;  3JCM X;  5EG2 A;  4BE1 A;  2FZK B;  1X75 C;  5GMK m;  3CV5 A;  3G7Z A;  4C92 E;  2EPD A;  2EQK A;  4QQD A;  1PG5 B;  3L3O M;  4PJO F;  3CBO A;  3DDF A;  1VQN T;  3EG9 A;  1I4K 1;  3JCM e;  2MWP A;  2RAI A;  5CKH A;  1VIF A;  2DZ9 A;  3RDV A;  5GAN h;  2XD0 A;  1VYT A;  2Z8Y A;  2YWW A;  4IUT A;  4C92 G;  3D2F A;  2JT4 A;  4L59 A;  3JB9 I;  1H92 A;  3F70 A;  1VQ5 Q;  1VQM T;  2C08 A;  1O7D C;  1VQ6 A;  1KFZ A;  3V8J A;  1RAD B;  3RER A;  1OZ2 A;  5EC7 A;  3SFM A;  2VV5 A;  4C92 B;  3CCM A;  2PQW A;  4C8Q F;  3MP1 A;  2F1A A;  4MML A;  3I55 T;  1M1K C;  3BUB A;  1VQ7 Q;  3DKM A;  2AK5 A;  1FMV A;  2PVD B;  2XMF A;  3UAT A;  4ZGE B;  2QEX A;  3Q1J A;  3CCE Q;  3BUI A;  4EZR A;  1WZO A;  4J7I A;  5CQX A;  1BIA A;  2ZPI B;  4QVZ A;  3HKS A;  3X25 B;  1IGU A;  1KC8 R;  1NYG A;  3CQT A;  2RHZ A;  2AKK A;  1Y96 A;  4R5K A;  1YCY A;  2KSS A;  4GLM A;  1RAF B;  1QVG A;  1HYO A;  1LOJ A;  2JN0 A;  2VKN A;  5KE2 A;  1NJI U;  3GLX A;  2RQR A;  3CCL T;  1VUB A;  2KAF A;  2DD5 A;  3LVT A;  3T4A G;  1R34 A;  1K9M C;  4PKC C;  3QKJ A;  1DKZ A;  3BVT A;  4NSW A;  4RG8 A;  5IT9 E;  1M2V B;  2L3P A;  2JM9 A;  3OS0 A;  3R6O A;  4JS5 A;  4R5J A;  4C0F A;  1RI9 A;  3VS6 A;  3GIB A;  2X51 A;  4M7A G;  4UDY X;  2CP2 A;  3CCS T;  2CP0 A;  2COY A;  1S1N A;  2RI2 A;  3BW1 A;  2L3Q A;  3MHX A;  4F16 A;  2CP3 A;  2K5I A;  4LNP A;  1Q7Y R;  2DTO A;  4HCK A;  3G71 T;  4CRI A;  2JTE A;  4PJM A;  3VUZ A;  3RMS A;  3CCJ Q;  3DYT A;  2MMP A;  4J9B A;  1I4D A;  1YHQ T;  2B8A A;  4HT8 A;  1SU8 A;  3M56 A;  5KBP A;  2YLB A;  1Y07 A;  1NBE B;  1X2Q A;  2DO3 A;  1AVZ C;  4JJB A;  2Q13 A;  1V76 A;  1CSK A;  1E6G A;  4IWO A;  1N27 A;  2LQN A;  1QQJ A;  1OAO A;  2FG0 A;  1IXD A;  2CT3 A;  5GAN 5;  3OYD A;  3CME Q;  4JLG A;  1YI2 T;  3PT9 A;  4BD3 A;  4EZW A;  1VQ9 T;  4JJC A;  2A0F B;  3QHS A;  4II1 A;  2OBL A;  1QP3 A;  1X04 A;  4EZV A;  4LDX A;  2MAM A;  4QQG A;  1G8X A;  1H64 1;  2BZY A;  4FM3 A;  4HCZ A;  3VS0 A;  4B9W A;  4XAX B;  4M75 C;  3CEY A;  2GTO A;  3M4G A;  1M1F A;  4JJD A;  2HSE B;  2E10 A;  4JDS A;  3VS4 A;  2A3L A;  2KE9 A;  2AKL A;  4RTW A;  4XU0 A;  2BZX A;  5FLX E;  1TQT A;  1VQL A;  5GJV B;  1S72 Q;  4KBM B;  2EX3 B;  3JCM h;  3QUI A;  4J6X A;  1M8V A;  1K9M U;  1G2B A;  4BDZ A;  3MKD A;  4C92 F;  3L1A A;  4RTT A;  1Y57 A;  3BDU A;  5GAO p;  4ZN3 A;  1KSW A;  3T9N A;  1BYM A;  4PJO D;  2G6F X;  4JRQ A;  1UJ0 A;  4Y91 A;  4VUB A;  2YUN A;  1LJO A;  2X3X A;  5LJ5 f;  2RI5 A;  2O4X A;  4OML A;  2YIV X;  2DNU A;  4WPC A;  4KIK B;  3QG1 A;  3L2U A;  4HY9 A;  3H41 A;  3VKH A;  2X5C A;  4A4K A;  4AT1 B;  3EHR A;  3EH2 A;  1R0B G;  1JXO A;  4LDU A;  4OMF B;  4BUG A;  2C06 A;  4MDX A;  3BLB A;  1TH7 A;  1XOV A;  3CKD A;  4AZ6 A;  2FZC B;  3PE0 A;  5CKF A;  4OB1 B;  1YIT T;  3G6E A;  2KT1 A;  2J6O A;  5KYY A;  1MMG A;  2AIR B;  5J26 A;  3REA B;  4PJO A;  3CCU T;  2CH4 W;  1QVF S;  1ZQ1 A;  1QW1 A;  2CP7 A;  2VWF A;  3Q84 A;  4C8Q D;  3VYG A;  1IO6 A;  2A7Y A;  4LD6 A;  1OEB A;  4CC7 A;  1C1A A;  2XKO C;  2EGE A;  4AFS C;  3VS5 A;  3PVQ A;  2EBP A;  1FMK A;  4XTZ A;  3VYH B;  3I56 T;  1KD1 R;  5KYU A;  5L23 A;  4OB2 B;  1NYF A;  1X6O A;  1UE9 A;  3HAJ A;  4A4F A;  4C92 C;  4J7F A;  3EJQ A;  4RTZ A;  4Z02 A;  1TS9 A;  5HCK A;  1VQP Q;  1B3Q A;  1X01 A;  1RAI B;  2K57 A;  2F2V A;  3BUD A;  1TUD A;  4C8Q A;  3BVV A;  2E6N A;  1TTH B;  4XK8 E;  3CCR T;  2RJC A;  4JNF A;  2D0N A;  2HQE A;  3SB2 A;  1BI1 A;  3QO3 A;  2EYY A;  3L2R A;  3S3N A;  2JMC A;  3EGX A;  2BTT A;  4IIO A;  1HXK A;  1KHI A;  1BCO A;  3MJX A;  1M3C A;  5FWB A;  1WNL A;  1PKT A;  4C0G A;  2A36 A;  4DQ2 A;  1SG5 A;  2KEA A;  2Y90 A;  2OAU A;  3I5R A;  2YLL A;  4R5I A;  5IAY A;  1HTY A;  3M0Q A;  2VC8 A;  4RTX A;  4XTU A;  2O01 E;  4E7L A;  2EYW A;  3CXC A;  3H9N A;  1U1S A;  3V7C A;  2GA9 D;  4AZ5 A;  5GJW B;  1YN8 A;  2WYI A;  2EVR A;  2FYV A;  3M3W A;  2RF0 A;  3VRZ A;  2LCC A;  5LJ5 g;  1SSF A;  1R0C B;  2LX7 A;  3ULR B;  2ZXQ A;  4KH1 B;  3OYA A;  1M2O A;  4WTO B;  1UB4 A;  4QVC A;  3EJR A;  2MI7 A;  2YSQ A;  2V26 A;  3BDL A;  1HSQ A;  4C0D B;  2QQR A;  4DEX A;  2YKT A;  4M7A C;  2OTJ A;  2XDB A;  3FC3 A;  4OB0 B;  1GRI A;  4GLK A;  1WQW A;  4AVM A;  3RR6 A;  2YHT A;  1WYX A;  5GMK i;  4XTX A;  1X6B A;  1QWN A;  1RAB B;  3MEA A;  1HXD A;  1I5L A;  3BVU A;  2VGM A;  3OW2 S;  2K5L A;  2MIO A;  1I81 A;  1SKU B;  4FT4 A;  2JOY A;  2QI2 A;  3VV0 A;  1AWW A;  1RLP C;  3EFR A;  5E84 A;  2NCZ A;  2XI9 A;  1WJS A;  4GY5 A;  4FM4 B;  3FJP A;  2NUT A;  1Y0M A;  3M58 A;  4N4I A;  3I39 X;  2F5T X;  1EZZ B;  2CKK A;  3OYB A;  2DRK A;  5GAO n;  1WXT A;  4WCI A;  4QQ6 A;  4KT0 E;  1BCM A;  2VB6 A;  4EMK B;  4C92 D;  2QA4 T;  1O9S A;  4JPB W;  1Q86 C;  4G6Q A;  3AT1 B;  2J05 A;  1YJW Q;  2M0O A;  1GXI E;  3S3M A;  3CZS A;  5GAN 4;  2LCS A;  4GBQ A;  3BUP A;  5GAO m;  1H3H A;  3PMI A;  3JRZ A;  1UGP B;  2VVK A;  3M59 A;  1VQ6 T;  4A4G A;  2CGH A;  3NGP A;  2KYB A;  1PRM C;  5DLQ E;  2YUO A;  4O6J A;  4KRT A;  3DPO A;  3C4S A;  1E9V A;  3JCM b;  2O0I 1;  4NL2 A;  1GN9 A;  2W10 A;  3V7S A;  5ECA A;  3OA6 A;  2F5K A;  4C92 A;  2HSP A;  3CCM T;  1G83 A;  1K73 C;  4Z88 A;  1FXX A;  5CAI A;  3OYM A;  2RO0 A;  3MEW A;  4JRK A;  4JZ4 A;  4E7S A;  2ND0 A;  3MP8 A;  4RCC A;  2QEX T;  3SD4 A;  4R56 A;  3CZN A;  1D1A A;  3DX0 A;  3AHU A;  3CC2 Q;  1SHF A;  5FU6 B;  3J80 E;  3QXE B;  2LCL A;  3RUX A;  3OWG A;  4JZ3 A;  1QWU A;  1ZSG A;  4BB7 A;  2K9G A;  4OMN A;  1PD1 A;  2QTV A;  3CVR A;  5FLE X;  4HVU A;  4KGZ B;  2DER A;  3CC4 Q;  4E47 A;  4M7A D;  1Q81 R;  3UPU A;  4NL3 A;  2D8H A;  2YL5 A;  2ABL A;  4O5V A;  2E3I A;  1K8A R;  1UJY A;  2DFU A;  1M2V A;  2D0Q B;  1UEB A;  5KCO A;  3LLL A;  1TQV A;  1VQN Q;  2ZPH B;  4KGX B;  3G9G A;  4FU6 A;  5LJ5 d;  9ATC B;  3PIO A;  4AZG A;  1JJ2 S;  2M16 A;  4A4H A;  2L3S A;  2CSI A;  3CCQ A;  2KI7 A;  1R33 A;  2RT6 A;  1NM7 A;  2LT4 A;  1C0M A;  3OW2 P;  4OMQ A;  4FSS A;  5CKD A;  2BZ8 A;  5HK0 A;  2M51 A;  1OA1 A;  1UGV A;  3EGU A;  1VQM Q;  3LMF A;  1BBZ A;  2EGC A;  4CI0 C;  2E41 A;  2I0N A;  5A0G A;  4E81 A;  3SYV A;  3I55 Q;  5A2Q E;  3VEB A;  4IM2 A;  1M90 U;  2RQW A;  4J9E A;  3KAV A;  1M30 A;  5FW9 A;  1M27 C;  2GFU A;  3RKX A;  3JCM W;  2A28 A;  3LW5 E;  5FU7 B;  4HYB A;  3KDR A;  3T46 A;  4LUE A;  4FZS A;  1XJW B;  2CYZ B;  2HBW A;  4A53 A;  1WQ7 A;  1QCF A;  3SWN B;  2EYZ A;  2JW4 A;  4H6H A;  3OY9 A;  5HY6 A;  3FB9 A;  2R57 A;  1PNJ A;  4QT7 A;  1MMD A;  3EG0 A;  4BAC A;  1AHJ B;  2VUB A;  4E6R A;  3CCL Q;  3DPQ A;  3UF4 A;  4F00 A;  1I0C A;  4RG2 A;  1VQL T;  4EZS A;  4C0D C;  1TG0 A;  3JB9 H;  1W2B S;  1G3W A;  2KYM A;  2LDM A;  3DB4 A;  3E2U A;  2OI3 A;  1ABO A;  1OA0 A;  2K7A A;  5LJ3 f;  1W6X A;  1YBY A;  4EMG A;  2N3K A;  4EZY A;  2A37 A;  5IHK A;  5CVI A;  4PFZ A;  4BI8 B;  3CCS Q;  5LJ5 j;  4DOW A;  1NJI C;  1H8K A;  5DLO A;  1WHG A;  1O75 A;  4D8K A;  2MPX C;  4IIM A;  1D09 B;  3PNW C;  3G71 Q;  4KIK A;  2OX7 A;  3ASK A;  3C94 A;  2MF2 A;  2LJ0 A;  1Q82 U;  1YHQ Q;  1WFW A;  1PM3 A;  2ZAE A;  2J06 A;  5L8R E;  3J81 E;  4EMK C;  3FEO A;  4RCB A;  1GCQ A;  5LL6 S;  3G6E T;  2K5F A;  1AZG B;  1D1B A;  2V1Q A;  5DM7 R;  3CPW P;  3CD6 A;  1M8M A; 
#chains in the Genus database with same CATH homology
 1T0H A;  2BZY A;  4FM3 A;  3FD9 A;  1K9A A;  3EG3 A;  3VS0 A;  2CDT A;  3B53 X;  1ZUU A;  3I01 A;  4M4Z A;  3IQL A;  2GTO A;  5IH2 A;  1YP5 A;  4HR1 A;  1GNL A;  3VEA A;  2D1X A;  2KR3 A;  4JJD A;  3I9Q A;  4EZN A;  2AZV A;  2PTK A;  3VS4 A;  2KE9 A;  2AKL A;  4RTW A;  1QWE A;  2ENM A;  4AG2 C;  3B51 X;  2BZX A;  4JNE A;  2CUB A;  2DL4 A;  1SEM A;  5GJV B;  3C0C A;  2OJ2 A;  2EX3 B;  2ROL A;  1NEB A;  2KBT A;  3VRY A;  2M0Y A;  1VYV A;  4LE9 A;  4J9I A;  1JQK A;  2LMJ A;  4IWQ A;  1G2B A;  1WX6 A;  3ZL7 C;  1JEG A;  4CC3 A;  4RTT A;  2C0O A;  1PKS A;  1Y57 A;  4Y92 A;  1OV3 A;  2KT8 A;  1KSW A;  3NPF A;  4J9H A;  2G6F X;  2DA9 A;  2EGA A;  4OMM A;  1WI7 A;  1UJ0 A;  3FJ5 A;  4AG1 C;  2YUN A;  1K1Z A;  4RUG A;  1NG2 A;  2PY6 A;  3VS1 A;  1VA7 A;  2DX1 A;  4OML A;  2YIV X;  1MV0 B;  2DNU A;  5IXF A;  4KIK B;  3ER8 C;  1JO8 A;  2YDL A;  2SRC A;  4HY9 A;  3H41 A;  3VKH A;  1UFF A;  2X5C A;  1E1D A;  2FPF A;  1BB9 A;  3RBB B;  2C0T A;  3I5S A;  4EIK A;  4EZU A;  3EHR A;  1ARK A;  1JXO A;  1LCK A;  1SU6 A;  1XOV A;  4M0M A;  3PE0 A;  3EHQ A;  4K11 A;  2KT1 A;  2J6O A;  1OPL A;  3REA B;  3REB B;  2F2W A;  2CRE A;  2CH4 W;  4CC2 A;  3KAW A;  2GTJ A;  2VWF A;  4RTV A;  2P4R A;  5TKY A;  3A98 A;  2QXL A;  2GAF D;  1IO6 A;  1QKW A;  2DLP A;  3RNJ A;  1X43 A;  2CH4 A;  3RV0 A;  4D8D A;  2CT4 A;  2DYB A;  1A0N B;  4HR1 B;  1KIK A;  1OEB A;  2QFF A;  1MUZ A;  4CC7 A;  4E3C A;  4EZQ A;  2EGE A;  1AWX A;  3UA7 A;  3VS5 A;  4AFS C;  3PVQ A;  2EBP A;  1FMK A;  4Z89 A;  2QDL A;  2H8H A;  3F7W A;  5L23 A;  1NYF A;  1UE9 A;  1GBQ A;  2EW3 A;  3ER9 B;  3GBQ A;  1E2U A;  3H0H A;  4RTZ A;  2DRM A;  5HCK A;  4EZO A;  1B3Q A;  3M0P A;  4B9Q A;  1AEY A;  2F2V A;  2O2O A;  1TUD A;  4LUD A;  1K4U S;  1PHT A;  4J9D A;  3EG2 A;  1FYN A;  2DL7 A;  1ZBJ A;  1J3T A;  4HXJ A;  5IHI A;  3T47 A;  4JNF A;  2D0N A;  2LZ6 B;  4AFQ C;  2EYY A;  3M0R A;  2FEI A;  1UEC A;  2JMC A;  4OMO A;  2BTT A;  4IIO A;  1PRL C;  2O31 A;  1M3C A;  3T48 A;  3O3O B;  5FWB A;  1PKT A;  1X6G A;  4DEY A;  2A36 A;  2KEA A;  2IIM A;  3I5R A;  2ESW A;  1UUE A;  4ZNX A;  3NHN A;  2YUQ A;  3VS3 A;  4R5I A;  4RTY A;  2OAW A;  3M0Q A;  5IXB A;  4RTX A;  1GCP A;  2CSQ A;  2SEM A;  2HEQ A;  2EYW A;  3B52 X;  4IM0 A;  2A08 A;  1DKX A;  1NLO C;  2RQT A;  1AZE A;  1GNT A;  2GA9 D;  5GJW B;  2X3X D;  1QLY A;  1YN8 A;  2EVR A;  2PNI A;  4F17 A;  2RF0 A;  4RTU A;  3VRZ A;  1ZUK A;  4OMP A;  3UA6 A;  2KXC A;  2KRO A;  4J9G A;  2C0I A;  2LX7 A;  2PZ1 A;  3JV3 A;  3ULR B;  1DKY A;  2GNC A;  1SSH A;  1AWJ A;  2RQV A;  1SRL A;  1SRM A;  1AWO A;  1TUC A;  2YSQ A;  4D8J A;  1WA7 A;  1HSQ A;  2LNH B;  3VS7 A;  2DMO A;  4AFZ C;  2JS2 A;  1SHG A;  2W0Z A;  3M0T A;  1JU5 C;  4DEX A;  2DJQ A;  1RLQ C;  5FWC A;  1GRI A;  4EZZ A;  4R0K A;  2KGT A;  2OBM A;  1WYX A;  3OHX M;  1X6B A;  1ZLM A;  3DPP A;  5FIG A;  3U23 A;  2LQW A;  4IWP A;  5I22 A;  1YCS B;  4CC4 B;  1RUW A;  4LN2 A;  2FPE A;  2KRM A;  2MIO A;  1UG1 A;  1AWW A;  1RLP C;  5E84 A;  3SHW A;  3I04 A;  3PVL A;  2NCZ A;  3O5Z A;  4A63 B;  1Y0M A;  1YWP A;  2RPN A;  1W9M A;  3I39 X;  1ZX6 A;  3NMZ C;  1WLP B;  2J6K A;  2O88 A;  2DRK A;  1WXT A;  2DE0 X;  4WCI A;  2DM1 A;  1E6H A;  4JPB W;  4G6Q A;  2J05 A;  2L2P A;  2MCN A;  1U00 A;  4Z8A A;  2DVJ A;  1OOT A;  3D2E A;  2RN8 A;  2E5K A;  1VYU A;  2LCS A;  4GBQ A;  2KRN A;  4UDX X;  5I11 A;  1H3H A;  3TSZ A;  2EQI A;  3M0S A;  4HVW A;  4J9F A;  2VVK A;  2FPD A;  2EWF A;  3NGP A;  2KYB A;  1PRM C;  3M0U A;  2DL5 A;  2YUO A;  2EYX A;  2K79 A;  2YIA A;  4KRT A;  3DPO A;  1E9V A;  4EZT A;  2ROT A;  1GN9 A;  2LP5 A;  2W10 A;  2YT6 A;  2GBQ A;  3H0I A;  5ECA A;  2HSP A;  2HCK A;  1G83 A;  4Z88 A;  4PO2 A;  3QWY A;  1T3L A;  1QWF A;  2LM0 A;  1BU1 A;  2B86 A;  1GBR A;  4JZ4 A;  1V1C A;  2ND0 A;  2YI8 A;  3ZED A;  4IM3 A;  3GI7 A;  2L0A A;  2NUZ A;  1KJW A;  1OPK A;  4AFU C;  2KRS A;  1M3B A;  4ESR A;  1B07 A;  2K3B A;  2RQU A;  4EZX A;  1SHF A;  2D8J A;  2LJ1 A;  2JM8 A;  1NEG A;  2JXB A;  3TSW A;  4EZP A;  3OWG A;  4JZ3 A;  1ZSG A;  5IHN A;  3QWX X;  4JL9 A;  1WIE A;  4JN4 A;  1SU7 A;  4NPH A;  3RV1 A;  3LH5 A;  2RNA A;  2K9G A;  3KFV A;  4OMN A;  2KNB B;  5FLE X;  3ERC C;  4HVU A;  2EPD A;  3L3O M;  2JNS A;  4JWD A;  1T0J A;  2WIN M;  1X27 A;  1K0S A;  1I07 A;  1Z9Q A;  2D8H A;  2ABL A;  2DIL A;  1UJY A;  3THK A;  2DBM A;  1VYT A;  2Z8Y A;  3QA8 A;  1ZUY A;  1MJG A;  2YUP A;  2GQI A;  1CKB A;  1Z9Z A;  2FRW A;  2ND1 A;  3D2F A;  2JT4 A;  1H92 A;  1UHF A;  2L3S A;  2CSI A;  1KFZ A;  2RMO A;  2O9S A;  3QNJ A;  2RT6 A;  1K76 A;  1UTI A;  1NM7 A;  4OMQ A;  4FSS A;  2BZ8 A;  3I35 A;  2AZS A;  2M51 A;  5EC7 A;  1OA1 A;  1UGV A;  3UIT A;  1E7O A;  3EGU A;  4JWI A;  1JXM A;  3LMF A;  1MV3 A;  2FO0 A;  2JMA A;  4HVV A;  1W70 A;  1BBZ A;  2AK5 A;  1UHC A;  1U06 A;  2ED0 A;  2EGC A;  2X3W D;  3TVT A;  2XMF A;  2I0N A;  3UAT A;  1WXU A;  4R5G A;  1X69 A;  3O3N B;  3T49 A;  2YI9 A;  1GFC A;  4E81 A;  1X2K A;  4EZR A;  2J7I A;  1N5Z A;  1PWT A;  3VEB A;  4IM2 A;  2DL8 A;  2FRY A;  1SUF A;  2RQW A;  1U5S A;  1WDX A;  2DF6 A;  4J9E A;  3KAV A;  2KHO A;  1NYG A;  1M30 A;  5FW9 A;  1M27 C;  3R6N A;  3CQT A;  2AKK A;  1GL5 A;  2A28 A;  1HJD A;  4R5K A;  4HYB A;  4GLM A;  4JWC A;  2LJ3 A;  3KDR A;  3T46 A;  4LUE A;  1NLP C;  1BK2 A;  2VKN A;  2HBW A;  1QCF A;  2EYZ A;  2RQR A;  2JW4 A;  4H6H A;  1M3A A;  4R5L A;  2HDA A;  3T4A G;  1PNJ A;  4QT7 A;  2O9V A;  2DBK A;  1DKZ A;  1AOJ A;  2JS0 A;  3EG0 A;  2L3P A;  2JM9 A;  4E6R A;  3DPQ A;  3UF4 A;  4R5J A;  4F00 A;  1I0C A;  1RI9 A;  3VS6 A;  4EZS A;  4F14 A;  1K0X A;  1TG0 A;  1SPK A;  4UDY X;  2KYM A;  1CKA A;  2OI3 A;  1S1N A;  1ABQ A;  1ABO A;  2L3Q A;  1JQQ A;  2KXD A;  4F16 A;  1OA0 A;  3EG1 A;  2K6D A;  2DL3 A;  2GGR A;  2K7A A;  4LNP A;  1W6X A;  4HCK A;  1UDL A;  2N3K A;  2JTE A;  1WXB A;  4EZY A;  2A37 A;  5IHK A;  4J9B A;  4X1V A;  2ECZ A;  4J9C A;  4ORZ A;  1QKX A;  1T3S A;  1H8K A;  2MOX A;  4D8K A;  1SU8 A;  1ZYL A;  4JLC A;  4IIM A;  2F2X A;  2NWM A;  3O3M B;  1X2Q A;  4KIK A;  2V1R A;  4F01 A;  2K2M A;  3C7N A;  3VS2 A;  1AVZ C;  4JJB A;  1AD5 A;  1I1J A;  1UPX A;  2EKH A;  3H0F A;  1GCQ C;  1CSK A;  2CUD A;  2LJ0 A;  2YIB A;  4IW0 A;  1E6G A;  4IWO A;  1WFW A;  2LQN A;  1OAO A;  3SEM A;  2FG0 A;  1GFD A;  2J06 A;  2CT3 A;  1EFN A;  1W1F A;  1YWO A;  4EZW A;  4H6I A;  1GCQ A;  1U3O A;  4JJC A;  1YNZ A;  2OBL A;  4JWE A;  1HD3 A;  1AZG B;  2J6F A;  2ED1 A;  2V1Q A;  4EZV A;  1M8M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...