3A98A

Crystal structure of the complex of the interacting regions of dock2 and elmo1
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
168
structure length
157
Chain Sequence
GMAPWRKADKERHGVAIYNFQGSGAPQLSLQIGDVVRIQETCGDWYRGYLIKHKMLQGIFPKSFIHIKEVIPAEIPLAQEVTTTLWEWGSIWKQLYVASKKERFLQVQSMMYDLMEWRSQLLSGTLPKDELKELKQKVTSKIDYGNKILELDLIVRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dedicator of cytokinesis protein 2
publication title Structural basis of functional complex formation between DOCK2 and ELMO1 for Rac activation in lymphocyte chemotaxis
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 45
structure length 157
sequence length 168
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-10-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.350 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3a98A02
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3a98A01
2EGEA 4J9CA 2A08A 2E5KA 4AG1C 4J9HA 2LCSA 4AG2C 1Y0MA 1Z9QA 2KR3A 1YNZA 2RMOA 2O9SA 1H8KA 1MV0B 2J05A 1BB9A 2KYBA 4CC2A 1E6GA 5FW9A 2HBWA 2JS0A 4WCIA 2KROA 2W0ZA 2CDTA 2HDAA 1X43A 2MIOA 1I0CA 1NYFA 3ULRB 4J9EA 1AZGB 4GLMA 3EG2A 2DILA 2FEIA 2JM8A 1OPKA 2ECZA 2JS2A 1NYGA 2BTTA 4F16A 4ESRA 3M0TA 3PVLA 1NEBA 1WDXA 1BBZA 3CQTA 4JJCA 2SEMA 4AFZC 2K3BA 4KRTA 2M0YA 1AEYA 5FWBA 4RTYA 1RLPC 1QWEA 1BK2A 2DMOA 3H41A 5IHNA 4E6RA 1WXTA 4JPBW 2C0TA 1OPLA 1HSQA 4RTUA 2J7IA 4CC4B 2KT8A 4Z88A 2LMJA 2IIMA 4EIKA 1M3CA 2DL7A 3GBQA 2DL4A 4LNPA 1UFFA 4F17A 4RTVA 3VS1A 1I1JA 2DL3A 1X2KA 2GNCA 4AFQC 1U06A 1G83A 4ORZA 2DL5A 4RTZA 2A28A 1ZUYA 2J06A 2C0OA 2G6FX 1ZLMA 2CSQA 2DM1A 1VYUA 1JEGA 3H0HA 2DA9A 2GGRA 2CT4A 1UECA 1WXUA 3JV3A 5GJVB 2MCNA 3KFVA 1SHFA 3VS0A 3NMZC 1SRMA 1UJ0A 2EYZA 1ZSGA 1RUWA 2EW3A 1X27A 2ROLA 3H0IA 2RQRA 1QWFA 1ABQA 1KIKA 1BU1A 2KYMA 1W1FA 2DRKA 1NLOC 4HVUA 4LUEA 3PVQA 5HCKA 1WXBA 4HXJA 1TG0A 1ZBJA 4HCKA 2CT3A 3LH5A 1N5ZA 1PWTA 2DRMA 1YN8A 2AKKA 2K7AA 4ZNXA 2DX1A 1UDLA 2L3PA 1MUZA 2YT6A 3THKA 3VS5A 3REAB 1AWXA 1UHCA 1GCPA 1QLYA 1I07A 3VRZA 2AZSA 1M30A 2A36A 1ZX6A 2BZ8A 2JTEA 2L3QA 4LN2A 2KEAA 1X2QA 1JO8A 2LJ1A 2FPEA 2LNHB 1QCFA 1JXOA 1IO6A 4J9GA 2JM9A 1MV3A 4Z8AA 3QWXX 2LQWA 2P4RA 1M3AA 1CKAA 3I9QA 5I11A 2DF6A 2YUPA 4Z89A 1JU5C 1ZUUA 3I5SA 5IHIA 2HCKA 1AZEA 2A37A 1UHFA 2LJ3A 4Y92A 2YUQA 2LJ0A 3NGPA 5I22A 1B07A 2D1XA 1V1CA 2K6DA 3PE0A 1SHGA 4JZ3A 5IHKA 2EYWA 1KSWA 4FSSA 1RLQC 4OMOA 2O9VA 2DBKA 2EBPA 4RUGA 1G2BA 3M0QA 2H8HA 2K2MA 2FPFA 1GRIA 4IIMA 3VS2A 2PNIA 1GFDA 1W6XA 2RNAA 2ESWA 1AWOA 2RQWA 4RTTA 1YWPA 5L23A 3TSZA 4GBQA 2HSPA 1H3HA 1FMKA 2KXDA 3UF4A 2L3SA 2OJ2A 3TVTA 2DVJA 1H92A 4LE9A 1E6HA 1CSKA 3VS4A 3U23A 2EGCA 2J6OA 3SEMA 3M0UA 5EC7A 1UE9A 1YP5A 3NHNA 1M8MA 2QDLA 1AOJA 2BZYA 2YDLA 1PKTA 4CC3A 4OMMA 4AFSC 1GCQA 5FWCA 2EYXA 2YUOA 4F14A 1WIEA 3RBBB 2KXCA 2X3WD 1AWWA 1FYNA 4OMPA 4CC7A 2KRNA 4DEYA 1RI9A 1UG1A 2DJQA 2K79A 2KGTA 3EG1A 1SEMA 1EFNA 2KRMA 2RN8A 1NEGA 1UJYA 2DNUA 3VS7A 1KJWA 2PZ1A 1XOVA 2KBTA 2CREA 2O2OA 4D8DA 3SHWA 1OV3A 2V1QA 1GFCA 1CKBA 1M27C 2AKLA 4JZ4A 1GL5A 2LZ6B 4RTWA 3IQLA 1J3TA 2SRCA 2JT4A 4HVVA 2K9GA 2GTOA 1B3QA 4OMQA 1GBQA 1YCSB 2AK5A 4JJBA 2J6KA 3FJ5A 2CSIA 3M0SA 1S1NA 4R0KA 1OOTA 2DYBA 1Y57A 2JXBA 2ED1A 2I0NA 4RTXA 1T3LA 2EVRA 2L2PA 3M0PA 1X6BA 3VS3A 4HVWA 4IIOA 4K11A 2JMAA 2O31A 1JXMA 2V1RA 3O5ZA 2MOXA 1NLPC 1K0SA 5ECAA 4OMNA 2EYYA 3VS6A 1WYXA 2XMFA 1M3BA 1T0HA 1T3SA 2FPDA 1PNJA 2KRSA 2C0IA 1YWOA 3UA6A 2LP5A 2NWMA 1VYTA 1PRLC 2YSQA 1WX6A 3R6NA 1KFZA 1TUDA 1AWJA 2GTJA 2J6FA 2OAWA 2DLPA 2RQUA 1K9AA 2ENMA 1PHTA 4X1VA 2D8JA 2BZXA 1X6GA 1ABOA 4J9DA 1Z9ZA 1WFWA 1PRMC 2RF0A 3EHRA 1SPKA 2AZVA 1UUEA 2CH4A 3TSWA 2KE9A 3C0CA 2ED0A 2FRWA 2LQNA 1GCQC 4A63B 2DL8A 2KT1A 1T0JA 1QKXA 3NPFA 1K0XA 5IXFA 3UATA 2FO0A 1TUCA 1U3OA 1VA7A 2RQVA 3ZL7C 3A98A 2VVKA 4J9FA 1GBRA 1AVZC 2B86A 1HJDA 4LUDA 2CH4W 2DE0X 3RNJA 1ARKA 2M51A 5GJWB 2L0AA 1SSHA 2F2WA 2GBQA 2W10A 3EG3A 1SRLA 1WLPB 1JQQA 1A0NB 3REBB 1NG2A 3I35A 2DBMA 2JMCA 3EGUA 2JW4A 2KNBB 2PTKA 3I5RA 1X69A 4D8KA 1VYVA 2RPNA 2F2XA 2O88A 1K76A 1WA7A 2ROTA 1UTIA 1OEBA 2EPDA 2GQIA 3M0RA 1WI7A 3VRYA 5IH2A 1NM7A 1QKWA 2VWFA 2NUZA 4M4ZA 3QWYA 1HD3A 3H0FA 4AFUC 1W70A 1AD5A 3EG0A 1UGVA 4OMLA 4J9IA 4DEXA 1LCKA 1PKSA 1U5SA 2EKHA 2EQIA 2CUDA 2OI3A 2FRYA 2X3XD 2D8HA 1K1ZA 4J9BA 1K4US 2VKNA 2YUNA 3UA7A 2RQTA 2HEQA 2CUBA 1ZUKA 2FG0A 2ABLA 4JJDA 2F2VA 2D0NA 1E7OA 3EHQA 5IXBA 4QT7A 2EGAA 2LX7A
chains in the Genus database with same CATH superfamily
3X28B 2QTVA 2JN0A 3MPUB 2EQMA 3VU3C 5AT1B 4ZN3A 1YNZA 4KH0B 1UB4A 4QKUA 2KYBA 1KG1A 5FW9A 3CVRA 3KBGA 1OU8A 4E2FB 2HBPA 2DFUA 4WCIA 3EJSA 4EZSA 2QGFB 2HDAA 3CCJQ 2MIOA 1WPYA 4J9EA 4KGXB 4C8QG 3UDCA 3M56A 1PCXA 2DILA 2EFLA 3F7WA 3CCQA 4A4GA 1BIAA 1OPKA 4Z02A 1YIJA 1MHNA 2RT6A 2ND1A 2JS2A 4FM4B 4ESRA 3M0TA 3QBYA 2RHXA 1I49A 1YFNA 4MZMA 1TQSA 1PSEA 2BE7D 2K57A 1TQTA 3HKSA 1M90U 2E3IA 2K3BA 1YJNA 2E12A 5J39A 2DMOA 2HQXA 1Q82C 2CP5A 3RERA 4KIKA 1OPLA 1Y07A 2J7IA 1Q7YR 2KT8A 4Z88A 4QQ6A 1PD0A 2LMJA 4N0AA 4EIKA 2E4HA 1VQKQ 4AZGA 1M3CA 1MNDA 2DL7A 5FU6B 3O3MB 3GBQA 4QVDA 3G6EQ 3BLBA 4LNPA 5GMKl 1UFFA 4HT9A 4M7AF 4R55A 4BNEA 2VXFA 1OX8A 2DL3A 1H3ZA 1X2KA 4A54A 2GNCA 1WHGA 1BI3A 2O4XB 3BUBA 2J06A 2HD0A 2C0OA 2CP6A 3OW2A 1VYUA 3O3NB 3DPPA 2DA9A 1WHHA 5GJVB 3O3OB 1IHVA 2L8DA 4C5GA 1BIBA 3C4SA 1SRMA 1UJ0A 2VV5A 2EYZA 1N9SA 4B6MA 2EW3A 1KQ2A 2RQRA 4DBFA 5HKCA 3PNWC 1XNIA 3PFSA 1BU1A 2CP3A 2E6NA 1W1FA 2R5AA 4JS4A 1M8VA 4LDVA 5GAOm 3T46A 3QNJA 1WXBA 5FU7C 2GFAA 4HCKA 5LL6S 2CT3A 1VQ7Q 4BI3A 3HPWA 1YN8A 2AKKA 4DOWA 1JJ2P 2RAIA 2DX1A 1UDLA 2YT6A 3THKA 2FB7A 3GPLA 3CCLT 1YI2Q 3CCMQ 1GCPA 1QWUA 2QG9B 1I07A 3VRZA 2RB6A 3CCEQ 3CMET 4L6V5 5HY6A 5GMKe 3KXTA 3RMSA 3V7SA 1YJWA 3QDRB 5GAN6 3E1SA 1LNXA 2FPEA 3DX2A 4IWOA 4J9GA 5LJ3e 3RESA 1ZA1B 3M9QA 4Z8AA 3PIOA 2QA4T 4IUTA 3M59A 2CKKA 1OA0A 2RI3A 2FZCB 3NFCA 4FM3A 5I11A 1I4TA 3PMIA 3EFOA 3LYIA 3LWHA 1ZUUA 5IHIA 2HCKA 1Y2OA 4M78C 1AZEA 1VQPQ 1K8AR 3SOGA 4ZTFA 2KMTA 4FSXA 1HTYA 2LJ0A 2YI9A 1B07A 3JSCA 4KBMB 2K6DA 1YIJQ 1WJRA 1SHGA 2IPOB 2EYWA 1KSWA 4FSSA 3OYBA 2EBPA 3DB4A 5CK9A 1JJ2S 2L89A 2NUTB 2H8HA 3V8JA 2K2MA 2QXFA 3VS2A 2JVVA 1GFDA 3J80E 4C0GA 2ESWA 2K4YA 3LLLA 4C8QA 2DJZA 3R6OA 2ZPGB 5L23A 2QKWA 3D2FA 1QVPA 4GBQA 1M2VB 1H3HA 1FMKA 2KXDA 2RJEA 4BE0A 4A53A 3HP9A 2DVJA 2YIBA 3RR6A 4I1QA 3I55Q 5LJ5e 3BE3A 2DERA 1PD1A 3OK8A 1RACB 3G4SQ 5FRMA 4KT0E 2YL6A 4C92B 1X75C 2YDLA 1OX9A 4OMMA 4AFSC 1GCQA 2OTJQ 4BE2A 3SWNA 2YUOA 1FYNA 3TEEA 4OMPA 1LJOA 2KRNA 4LD6A 4M75C 1IZ6A 1OU9A 1G3TA 3RKWA 1NEGA 4MDWA 2DXUA 2VYTA 2DNUA 2HAXA 1D3BA 2ZPEB 1I4DA 1JBMA 1OZ2A 2GQVA 2O2OA 3VEAA 2DAQA 3CMAA 3LVTA 1GFCA 1CKBA 4HR1A 3LGFA 3P8DA 4JZ4A 2LZ6B 3JB9H 4HVVA 2EQJA 4M7AG 2F5KA 1SG5A 2AK5A 5CR2A 4JWCA 2J6KA 1VQ7T 3M0SA 4M78B 1U1SA 1Y57A 4XQ3A 4PJOE 1T3LA 1IB8A 4XTVA 3M0PA 1YI2T 5CIUA 4K11A 4L5GA 3RKXA 5LJ3f 5DLOA 1JXMA 3CCET 1WDZA 4M0MA 1K0SA 3BVTA 3DKMA 4DBRA 4H8SA 2HL5C 5LJ3g 4NL2A 3D4YA 2XICA 2K5IA 2HQEA 5GMKj 4KUIA 2RI5A 2F1LA 1BCOA 2FPDA 2PVOB 2D4CA 1IREB 4NSWA 3OSSC 1IXDA 4C0DC 5GAOl 1YWOA 1I81A 4C92D 2OO2A 2WSEE 1SF9A 5LJ3j 4C5IA 2CGHA 2VASA 4J8OA 1AWJA 1UGRB 1GN9A 1KHIA 3BVUA 1VQPT 2RO0A 3MKDA 2CZ0B 2X4WA 1WFWA 2JOYA 3FB9A 1SPKA 2AZVA 2QQ9A 2CH4A 1Y71A 4WF2A 5GAN8 1YIJT 2Y4YA 5GANe 1X03A 2E10A 2FRWA 3H8ZA 2LQNA 4F7UB 1PG5B 4A63B 1V76A 2DD4A 2KT1A 1R77A 1TXQA 3NPFA 1WNLA 3CC7Q 2MK5A 1K73C 2V26A 3G1JA 2L3RA 5CQYA 1Y96A 2FO0A 1ZBXA 2DO3A 1N8RR 1Q81C 4IW0A 5LJ5f 2Z0WA 1TUCA 1VA7A 2QK0A 4NOYA 1RAFB 3A98A 4JLCA 1WJSA 4IUQA 2VVKA 5KBPA 3CCUQ 2RH2A 4FT2A 4M78D 1HJDA 2F1BA 4LUDA 2CH4W 5A2QE 5LJ5g 1VQ9A 4RKUE 5FIGA 2YRDA 1ARKA 3LWIA 1ZA2B 4JWEA 2M51A 5GANd 3DX4A 1K8AU 3I55T 4PLIA 4D6WA 1WLPB 1TSFA 3B51X 4BY6B 4ZGJB 3REBB 2R5MA 3G4ST 3QG1A 3EGUA 2C08A 2PTKA 5LJ5j 5DLQE 2D6FA 3RKYA 2RPNA 3E2UA 2P0QA 1UTIA 3SYVA 1OEBA 1B7TA 4E3CA 3A8MB 5IH2A 2M0OA 3L2WA 3GP8A 3RDVA 4EMKC 4AZ5A 1HD3A 1W70A 1BKBA 4DOVA 1NJIC 5GMKi 2PQWA 3HAJA 2AIRB 5GAN4 1MMNA 1KD1C 3CMAQ 3CCLA 3P8HA 4OMLA 1RI0A 2OI3A 2CUDA 5D6XA 3E19A 1K1ZA 4HYBA 1HYOA 2DVEA 2K2VA 1YITA 2VKNA 4C0DB 3CMEA 2HZYA 2CUBA 2FG0A 3A8HB 1PSFA 2ABLA 4JJDA 2WYIA 5IXBA 5I21A 4GLKA 2F7OA 1KK7A 4P5NA 3LW5E 4J9CA 2QDYB 3X25B 4EDUA 1SSFA 3A8GB 4M7AA 3OB9A 2HNIA 2Z0OA 4AG1C 5HK3A 3FC3A 1QMCA 1Y0MA 1Z9QA 2RMOA 1YJ9Q 2YIVX 1LPLA 2O9SA 1H8KA 2DK3A 5D6YA 4N4HA 1BB9A 3CCJA 4FT4A 1UGPB 4ZGEB 2HBWA 3WVEB 4R56A 2KROA 2XG8D 1X43A 2K3YA 3OA6A 3CPWA 2LRQA 1I0CA 1NYFA 1OYXA 3ULRB 4FW2A 5GMKh 1OZ3A 4GLMA 2KDSA 1ZSZA 3EG2A 4ATOA 1ACMB 2PVDB 2Z0VA 2EJGA 3S6WA 4OMFB 2ECZA 4HCCA 4E7KA 1NYGA 3KDRA 1R8OB 3V7CA 3I01A 5LJ3h 1QCNA 4YTLA 1NEBA 1WDXA 1YHQQ 2A7YA 4JJCA 3QUIA 4M7AE 2M0YA 2COYA 2RK1A 1RLPC 1QWEA 1VQ6Q 3H41A 4J83A 5IHNA 4JPBW 1HSQA 3DDFA 4OP0A 4RTUA 1VQKA 3J7AF 5GANj 2RHIA 3G6EA 3CC7T 5CKDA 2COWA 4R5GA 2RA2A 5KYXB 2DL4A 4EMKB 4AZCB 4H6IA 4BI8B 1VQ9Q 4JLGA 1PC0A 4F17A 3CCUT 4OB0B 3F70A 1C0MA 3VUZA 4AFQC 2EIFA 1G83A 4RTZA 2A28A 1ZUYA 2RHYA 5GAN2 3CCRA 2G6FX 1ZLMA 4IUPA 2CSQA 4C92F 3CC4A 2CT4A 1WXUA 4BD3A 3T9NA 3TREA 1VIEA 1D0ZA 3JCMe 4Q5WA 5GAOn 2ROLA 1W9MA 3GIBA 4XTZA 2M1HA 5LJ5h 4BE1A 1QWFA 1KIKA 2CS7A 1N8RU 2X4JA 3E9FA 2KYMA 1X01A 4OGEA 1FXXA 2DRKA 2KSSA 4HVUA 3VUBA 2FHDA 3C12A 2OW7A 1TG0A 2P0KA 4AZ6A 2V8JA 4FL6A 1S72A 3JCMQ 3CMAT 2ZXQA 3D52A 1PWTA 2DRMA 1YI2A 3GNFB 3RIRA 3CCMA 3M57A 1K9MR 4M77C 1MUZA 2GA9D 4KIKB 2EJ9A 3JCMd 1VQLQ 3CCEA 3KAVA 4M78F 4G6QA 2LCCA 3FD9A 2RI2A 4R5LA 5IT9E 1ZX6A 2JTEA 4BDZA 3MCAB 4BACA 2L3QA 1RL2A 1JO8A 1N27A 4XU0A 2LJ1A 5CKEA 1MMGA 4NL3A 4AVMA 4KH1B 1Q86U 2JM9A 1MV3A 3CV5A 2MPXC 2CZ7B 3QWXX 2O01E 4M7DB 2LQWA 3DX3A 3DB3A 1IHWA 1YJ9T 1VQPA 2YUPA 2NYSA 3QIIA 1JU5C 4RG2A 3QJ6A 4JWIA 1UHFA 2B8AA 2DD5A 2HL3A 4XTUA 3OYMA 3NGPA 2I2LA 1URUA 2D1XA 2E64A 4E7ZA 4IWQA 1BYMA 4R5JA 2MF2A 5IHKA 4HKEA 2F18A 5IAYA 1FX7A 2ND0A 2DBKA 3RUXA 2QASA 4RCCA 2L5QA 1G2BA 1VUBA 3M3WA 3ERCC 1R34A 3V8LA 4IIMA 1OI1A 1W6XA 3QZ9B 4F7UF 3ER9B 2RNAA 4C0FA 5CCAA 1YHQT 2EKOA 2FZKB 1AWOA 3OSVA 4KUDK 4PJOC 4RTTA 1KQSA 3SWNC 1VQ6T 2M9UA 2OX7A 2P4TA 3DLLA 3VKHA 3MP8A 2D1LA 4OGCA 3I55A 4JNFA 3L2UA 2X51A 3LGLA 4FCYA 2ZPBB 3LX7A 3G4SA 3OQ5A 2LT4A 3VV0A 3JB9I 5GANh 3RV0A 2V8KA 2VXEA 2QEXQ 3L3PA 1VQ9T 3M0UA 5EC7A 1UE9A 1WHMA 2QDLA 1QCOA 2OTJA 3CCRQ 4DA4A 2ATCB 2BZYA 1PKTA 3CC4Q 4E7IA 4M77B 3G71A 3EFOB 4M7DD 2KXCA 2X3WD 3AT1B 3VYGA 1M1KR 4IUUA 1RI9A 1UG1A 3MEUA 2F1AA 3RV1A 2MYSA 2V0OA 3EG1A 2YLBA 3J81E 3D2EA 3ACOA 2KRMA 4QVZA 1KC8U 1UJYA 4EZQA 3VS7A 1QW1A 2X3XA 1H641 2KBTA 2CREA 3C95A 4D8DA 2V1QA 3SD4A 1S72Q 3IQLA 1J3TA 3QYHB 1M1GA 1QX1A 2K9GA 1VQOQ 3M54A 3DPOA 4EMGA 2FVUA 1GBQA 1UGQB 1G3YA 1YCSB 1DKYA 3FEOA 3FJ5A 1YITT 2YIAA 3QWEA 1S1NA 4R0KA 1OOTA 3OMGA 4N4GA 3EFSA 3OYEA 3OYNA 4RTXA 2EVRA 3VS3A 3T4AG 3L2ZA 4C92G 3QA8A 1XTDA 2JMAA 5GAOp 1TUGB 2O31A 2V1RA 3O5ZA 2CP0A 3BUQA 3EH2A 3HRUA 1IGQA 1WYXA 1C1AA 1T0HA 9ATCB 4IM2A 2O4XA 1PNJA 4MMKA 2KRSA 5CVIA 4PJOB 2DZCA 4O6JA 3UA6A 3T47A 2XKOC 2CYZB 2DKGA 3CCJT 3DDGA 3R6NA 1KFZA 1TUDA 4M77D 2GTJA 2XK0A 2OAWA 2DLPA 3TQ7P 2ENMA 3CBPA 1K9MU 4J9DA 1ABOA 1Z9ZA 4EZVA 4AT1B 1PRMC 2E3HA 3GOXA 4IM0A 3AHUA 1TQWA 1UUEA 4M78G 2YWWA 2HKQB 4JRIA 3MEVA 4PFOA 3CC7A 3I2WA 1QKXA 3TU4K 1K0XA 4BI4A 1Q86C 4KGVB 3L1AA 5KYUB 3EG9B 1QP2A 2EAYA 3V8KA 3CCUA 3O8VA 1DKXA 4J6XA 1VQKT 2OAUA 2ZPHB 1UPXA 5CKHA 3CPWS 3G6ET 2B86A 1WHLA 2DXTA 3Q1JA 5FU7B 2QQSA 2GF7A 4LD9K 1B34B 4OB3B 2LM0A 1M9SA 4NPHA 2L0AA 3EG3A 1SRLA 4C0ZA 2X4XA 3LLRA 2PMRA 2EWFA 1WHKA 3SDZA 1NG2A 2KVQG 2QEXT 3CCVA 4AZ7A 1ZHIA 2JW4A 1M90C 2IG0A 2FICA 5KYWB 3MP6A 3CCRT 3JB9J 4C8QE 3G71Q 2ZGWA 5IN1A 5GAMe 1WA7A 4JLIA 2PY6A 3CC4T 2BUDA 4ELYC 2BE9B 2GQIA 4PJOD 3VRYA 5GAOq 1NM7A 4F7UG 1QKWA 2VWFA 1Q7YU 3UPUA 4M4ZA 2DEUA 1Q82R 1U00A 4PJMA 1UGVA 3QZ5B 1N6AA 3BY7A 4J9IA 1PKSA 4FYXB 4OB2B 4FW1A 2NUPB 3BVXA 5TKYA 2RQTA 5GAMd 3T48A 1HWWA 1S72T 3M4YA 3CZSA 2HSEB 3JCMh 1VQ4Q 3CCMT 1VQOT 2ZAEA 5FRNA 2D0NA 2XDDA 4OB1B 2F7QA 1VQ8Q 1M2VA 1HXKA 3KUFA 1ZSZC 3OYJA 5AYFA 3JAME 3G7ZA 2RAJA 2EGEA 2RHZA 5KH6A 2ELBA 2A08A 4MDXA 4PFZA 1YJ9A 3M53A 5L8RE 2F69A 4EZNA 2LCSA 2DXBA 2KR3A 3OS1A 3VKIA 1KC8C 1MV0B 1VQ5A 6AT1B 4M7DF 4UDYX 4C92A 4HT8A 4FYVB 5CKFA 2EX3B 2CDTA 3FLGA 3BUPA 2RAKA 4X9CA 3UWNA 3DYTA 3QDFA 1AZGB 1V29B 3FJPA 3MJXA 2LDMA 3FDRA 3MEAA 2ZPFB 2DTOA 2KY9A 2JM8A 3GLXA 4KULA 1RAIB 1YHQA 3X26B 5FLXE 4F16A 2BIVA 3PVLA 1VQ6A 2SEMA 4AFZC 1DKZA 3HAHA 1AEYA 4JRQA 2RD1A 4J6WA 5FWBA 3E9GA 4M75B 2PUOB 1WXTA 1IRXA 3OW2P 1VQMQ 4OVAA 2IIMA 2H3EB 4C92E 2MWOA 2WSFE 4M78A 2MI7A 2YL5A 2G3RA 3VEBA 1R0CB 3EGXB 3M4GA 2XDPA 4RTVA 4DBHA 2VB6A 5C5BB 3OYHA 1W2BA 1VIFA 1SU8A 1MGQA 2DL5A 2PVGB 3QO3A 3CCVQ 2DM1A 3HTRA 2EJFA 2OTJT 1JEGA 3H0HA 2GGRA 1UECA 2XU8A 4M77F 3VS0A 1NE8A 2D9TA 3NMZC 1KQSS 3G71T 2X4YA 1X27A 1HXDA 3OYLA 4QQDA 3MEWA 4O5VA 1OA1A 3OYCA 3JCMX 4D8JA 3A1PA 1E9VA 1NLOC 4LUEA 2XI9A 4M78E 2MMPA 3PVQA 3HSBA 4AZIA 2OZNB 1ZBJA 4XAXB 1SUFA 2RJCA 2VUBA 3PIPA 3LH5A 3OW2S 1N5ZA 2QQBA 1VQLA 4ZNXA 2Q12A 3GI7A 2L3PA 3VS5A 3OWGA 2R58A 1PS3A 1VQNQ 3REAB 1AWXA 3JB9D 1X6OA 1QLYA 2EWNA 4M75D 1I4LA 4LDXA 4A4KA 2QTXA 4VUBA 1TWBA 3OYDA 1M30A 4HA8A 4MMLA 1JQKA 2RM4A 5KYYA 3QNIA 2KEAA 5C0MA 2YLLA 3OS0A 3JCMW 1M90R 2FYKA 4LDUA 2OTLA 2LNHB 1QCFA 1Q7YC 2QXLA 2K5FA 3S3NA 4C5HA 1Q82U 2GAFD 4E7SA 2P4RA 4FZPA 1M3AA 1VQ5Q 1GNTA 3L3OM 3S3MA 4J7FA 2JTMA 2DF6A 4N0AC 2YLCA 3ME9A 4PJOF 4DYLA 1BI2A 5GANf 2M02A 2A37A 3BFMA 2LJ3A 3PT9A 3L2QA 1D1BA 1M4ZA 4H6HA 1WJQA 5DY9A 1V1CA 1N9RA 5GANg 1RLQC 4A4HA 2O9VA 4A4EA 3EGDB 4UDXX 2LQ8A 2FPFA 4E47A 2PNIA 3BVVA 3NTKA 4JUVA 2RQWA 1YWPA 2ZPIB 3EJRA 2HSPA 2PUKB 3QKJA 4RCBA 2X5CA 1LOJA 2OJ2A 3TVTA 1VQMT 1H92A 4LE9A 1CSKA 2LQKA 4M7DG 3D4ZA 2QEXA 4IWPA 3UT1A 1RAEB 3CCSQ 1RADB 5GAOr 3I56A 3M58A 2DTIA 2J6OA 5KE2A 4PNOA 2NCZA 1SU6A 4XTYA 1M2OA 1U1TA 4PFPA 3L42A 5FWCA 3OYKA 3CCVT 2EYXA 4L59A 1WIEA 3RBBB 3QXEB 3PLTA 2DJQA 2D0QB 4WPEA 4JNEA 3OMCA 2K79A 2KGTA 1D09B 4Y91A 1SEMA 4EMHA 1EFNA 1BI1A 2RN8A 3PGGA 3QHSA 1K73R 1BCMA 1Q81R 2P0PA 5FU6C 2COZA 4CRIA 2RJDA 3SHWA 2E6ZA 1FWZA 1VQOA 1M27C 2AKLA 1K8AC 3NTHA 4HCZA 3P8BB 2SRCA 1SU7A 2JT4A 4EZWA 1QVGA 1B3QA 5GAMh 2JZ2A 2CSIA 3MP1A 2DYBA 5FROA 3QE6A 2ED1A 4B9XA 3B52X 2L2PA 1NZ9A 2K5LA 1VQNT 3OBWA 4HVWA 4IIOA 5D7UA 5J3BA 1UEBA 1TTHB 1D0XA 3ZEDA 2DTHA 5KYXA 4M77G 2E5QA 2MOXA 4EMKA 4AZCA 2OTLQ 4PL6A 3VS6A 2XDBA 4C8QC 2EQKA 2VC8A 2OBLA 4NS5A 2RJFA 2QA4Q 1NJIR 1M1FA 3OYYA 4RMOA 4RG8A 2QAZA 2LP5A 1KD1R 1VQ5T 1VYTA 1PRLC 2BKDN 2YSQA 3OS5A 5C6SA 4EZZA 2J6FA 2RQUA 2WYHA 4E7JA 1HK9A 1K9AA 2X9HA 2F7PA 3CC2A 4JWDA 5KYNA 3D51A 2DIGA 1AHJB 3ABHA 3EHRA 4WTOB 3TSWA 2DPPB 3L2RA 2KE9A 3C0CA 2ED0A 1GCQC 1WHJA 3CXCA 1T0JA 4AKVA 1LVKA 2JTFA 4UC4A 1I8FA 3JB9F 3EJPA 5IXFA 1FMWA 4KGZB 3UATA 4M75F 3OBYA 1W2BP 2FYVA 2YKTA 1G5VA 2EYQA 4J9FA 2XIDA 3META 1C6VX 4LDWA 2DE0X 4R5IA 4PJOG 3RNJA 3I56Q 2EFKA 5GJWB 3JCMf 4JJNK 2GBQA 2LNVA 2W10A 2QI2A 3CCST 1NBEB 1NPRA 1P92A 3DLMA 1OQKA 2DBMA 3EJTA 3BVWA 2KNBB 3I5RA 4D8KA 3B53X 2XHCA 2VGNA 1VYVA 5A0GA 4E7HA 4ATMA 3JCMg 4PJJA 1I5LA 2F2XA 2EFIA 4M7DA 2X3WA 3N5BB 4JDSA 2CZ1B 3DPQA 3JCMP 2EPDA 3GNGA 7AT1B 3M0RA 1I4K1 5CQXA 4PO2A 3C94A 3QWYA 4EZPA 1RAHB 3H0FA 1AD5A 2E1HA 4BDYA 3BUDA 2KI7A 4EZUA 3BDLA 4AZHA 1LCKA 4C8QB 2EKHA 2FRYA 2X3XD 1W2BS 1VQ4A 2QGGA 2E41A 3UA7A 2HEQA 4C92C 5GAN3 1RAAB 4EZYA 1VQLT 1ZWWA 3EAEA 1VQ8A 3EHQA 3NTIA 1QVFA 1MMAA 4M7DE 2CP7A 2MI6A 8ATCB 1NPPA 2C06A 2M16A 3CPWP 1TS9A 4Y28E 2LX7A 3DX0A 4LXCA 3HFOA 3QPHA 1GXIE 4QQGA 2E5KA 4FYYB 3HAIA 3A8LB 1N8RC 4FZSA 2YI8A 2DETA 4FIBA 1R0BG 4J9HA 3D50A 1WQ7A 4AG2C 3Q0KA 2Z8YA 2OTLT 3SWNB 1K73U 4J5YA 2J05A 4CC2A 1Q81U 1E6GA 1O7DC 4B9WA 1JRIA 2JS0A 4IKFA 3OYGA 2W0ZA 3CEYA 4FU6A 4M77A 2H3JA 3H9NA 3HRTA 1XQHA 3VYHB 1D3BB 2Q13A 2FEIA 3CC2Q 3I04A 3HL8A 4FYWB 4HR1B 2HQHA 2BTTA 2KAFA 4N4IA 3CCQQ 1BBZA 8AT1B 3CQTA 2MAMA 2XD0A 4PJLA 3URGA 3X24B 4KRTA 3Q84A 1VOMA 5LJ3d 4RTYA 4XU1A 1BK2A 4E6RA 1VQMA 4C8QD 5D6WA 1YJNQ 2C0TA 3CZNA 2HMAA 1OAOA 4CC4B 4XTXA 3CKDA 2HKNA 4EZTA 2YLAA 4J7IA 1WGSA 1NJIU 3SFMA 3WVDB 2K3XA 3HHTB 2LC4A 4M77E 1KD1U 1O9SA 4MZPA 3VS1A 1I1JA 3CD6A 2RK2A 1U06A 3CBMA 3LH0A 4XU2A 4ORZA 3I56T 3SB2A 3JCMJ 4PK4A 5I2SA 4JRKA 5M9OA 1PM3A 4XU3A 2AT1B 1JB0E 3JV3A 1TQVA 2MCNA 5KE3A 2LVMA 3ZFJA 3KFVA 1SHFA 4PJOA 1ZSGA 4EZXA 1RUWA 3QYGB 3H0IA 1M5Q1 1QVGP 5CO7A 3PTAA 2P84A 4M7AC 3JB9G 1ABQA 4QW2A 4M75G 1EZZB 2YHTA 3LMFA 5LJ5d 5HCKA 2A0FB 3DX1A 1MMDA 2NUTA 4HXJA 5DM7R 2E65A 4E7LA 4HCBA 1Y96B 4XTWA 1VQNA 5A0LA 2QQAA 2K7AA 1O7DB 3I39X 2V8IA 4BY6C 2GFUA 2QYZA 2WACA 4F04B 3RMQA 4E81A 1UHCA 1KHCA 3FIFA 3PMTA 4EZOA 2AZSA 5KYUA 3EG9A 4R5KA 3MHXA 2A36A 3ER8C 4IM3A 1M1KU 2BZ8A 2KK4A 2WINM 4BUGA 4LN2A 1R5EA 1X2QA 3UITA 2IVWA 2LTOA 4XK8E 2KHOA 1JXOA 1IO6A 4JRPA 1YJWQ 1B34A 1R33A 2GF4A 1EX4A 3RPMA 1G3WA 3OY9A 2X35A 3BUIA 4EZRA 1CKAA 3I9QA 4Z89A 3A8OB 1QVGS 4F00A 3I5SA 5KYWA 3BW1A 1YCYA 3QSUA 3EJUA 4Y92A 2YUQA 1KQSP 1D1AA 3CXCP 3OYIA 1OULA 5I22A 1WZOA 1UGSB 4TVRA 5EG2A 3PE0A 2LXYA 4JZ3A 2LT1A 5KCHA 3INZA 4BB7A 3CC2T 4OMOA 3TCJA 1TH7A 4RUGA 3OYAA 1ZQ1A 3M0QA 1GRIA 3CCQT 2E70A 1Y7XA 2QFFA 2GCXA 2NUPA 5CAIA 3TSZA 1BI0A 1LQ7A 4NQIA 1YJNT 3QJYA 3UF4A 2L3SA 2Y4XA 3CCSA 4OF1A 1E6HA 3OS2A 4M7AB 1I5OB 2QQRA 3VS4A 2RHUA 3U23A 3EH1A 2EGCA 4IURA 5GAMf 5KYYB 3CD6Q 1K9MC 1GNLA 3SEMA 3ZBDA 1YP5A 2DEQA 3NHNA 5A0DA 1M8MA 1AOJA 4F01A 1AT1B 5GAMg 3OYFA 3MO8A 4CC3A 2MWPA 3ZEHA 4A4FA 4F14A 3CXCS 1F1BB 1AWWA 3OHXM 4AMCA 1ZSZB 2WSCE 4CC7A 4DEYA 2OW6A 2JJ9A 5GAMj 1X04A 2ZZDA 1Q86R 4PJNA 1KJWA 2PZ1A 2DYIA 3G9GA 1XOVA 2OBMA 1W4SA 3ASKA 1QVFP 1OV3A 4F7UA 1GL5A 2JUFA 4RTWA 4FZOA 4C8QF 2F7RA 2GTOA 4OMQA 4JJBA 2DXCA 1VQ4T 4ANJA 3M55A 4M75A 2JXBA 4HY9A 2I0NA 3BDUA 2PU9B 2AHJB 1X6BA 2YXYA 1VQ8T 5FLEX 2FL7A 1KQ1A 4PKCC 2LX9A 2YL9A 4DBQA 1G8XA 4ME7A 3VJPA 4ZGDB 1JJ2A 4JL9A 3EJQA 1NLPC 4M7AD 3EGXA 3H6ZA 2QA4A 5ECAA 4OMNA 2EYYA 1RABB 1WQWA 1M3BA 2XMFA 2DZ9A 5C5BA 2F5TX 1T3SA 1YJWT 1QQJA 4CI0C 4MZTA 1MJGA 2C0IA 4F7UE 2ZCFB 2NWMA 2EQUA 4X9DA 3S3OA 1WX6A 3EFRA 5GMKm 4JN4A 3M5AA 3WXMB 1G3SA 4X34A 5KCOA 4IUVA 1PHTA 4X1VA 3CBOA 1QVFS 2D8JA 4M75E 2BZXA 1X6GA 2JNSA 2A3LA 2RF0A 4EPCA 3CAZA 1M1KC 3GF5A 2DL8A 2Y90A 1XJWB 4ZTJA 4J6YA 1D0YA 4II1A 5HK0A 2O0I1 2JNGA 4M7DC 1SKUB 3CPFA 1DJ7B 1U3OA 4QVCA 5I2MA 2RQVA 2X3VA 3JRZA 3HFNA 3ZL7C 1KC8R 2LCLA 2VGMA 3JCMc 2Z0NA 1O75A 1GBRA 1AVZC 4V2SA 1TQUA 2YRCA 4AZBA 4ZN1A 1RAGB 3JCMb 2CP2A 3L2VA 1YBYA 2NLUA 1SSHA 2JNKA 2F2WA 4GY5A 1JQQA 3CD6T 1TOVA 1A0NB 1E1DA 4WPCA 3I35A 1D1CA 1QP3A 2JMCA 1X69A 3ER0A 4DCNC 2O88A 1YWMA 2YL8A 1K76A 1IGUA 1FMVA 2ROTA 4PLLA 4ELZC 5GAN5 1WI7A 1MNEA 3JCMV 4B9QA 2NUZA 3C7NA 2DIQA 3KAWA 3D7SB 2FZGB 2ALWA 2CZ6B 4AFUC 4LDYA 3EG0A 3T49A 5E84A 5J26A 4DEXA 2YRVA 1U5SA 1ZYLA 2EQIA 1E2UA 3EGDA 1EIFA 2D8HA 2R57A 1VQ7A 4J9BA 1K4US 3CCLQ 4JS5A 2YUNA 2N3KA 1ZUKA 1Q95G 1YITQ 5CKBA 3CMEQ 2F2VA 1QWNA 1E7OA 3V7RA 2KQWA 3FRNA 1U8RA 1TU0B 3A5ZB 4QT7A 2EGAA 4C5EA 3X20B 5GAN7 3HRSA 4DQ2A
chains in the Genus database with same CATH topology
2EGEA 4J9CA 2A08A 2E5KA 4AG1C 2YI8A 4EZNA 4J9HA 2LCSA 4AG2C 1Y0MA 2Z8YA 1Z9QA 1YNZA 2KR3A 2RMOA 2YIVX 2O9SA 1H8KA 1MV0B 2J05A 1BB9A 2KYBA 4CC2A 1E6GA 5FW9A 4UDYX 2EX3B 2HBWA 2JS0A 4WCIA 2KROA 2W0ZA 4EZSA 2CDTA 2HDAA 1X43A 2MIOA 1I0CA 1NYFA 3ULRB 4J9EA 1AZGB 4GLMA 3EG2A 2DILA 2FEIA 3F7WA 3I04A 2JM8A 1OPKA 2ECZA 2RT6A 2ND1A 2JS2A 1NYGA 3KDRA 4HR1B 2BTTA 3I01A 4F16A 4ESRA 3M0TA 3PVLA 1NEBA 1WDXA 1BBZA 3CQTA 4JJCA 2SEMA 4AFZC 1DKZA 2K3BA 4KRTA 2M0YA 1AEYA 5FWBA 4RTYA 1RLPC 1QWEA 1BK2A 2DMOA 3H41A 5IHNA 4E6RA 1WXTA 4JPBW 2C0TA 4KIKA 1OPLA 1HSQA 4RTUA 2J7IA 1OAOA 4CC4B 2KT8A 4Z88A 2LMJA 2IIMA 4EIKA 1M3CA 4EZTA 4R5GA 2DL7A 3O3MB 3GBQA 3VEBA 2DL4A 4H6IA 4LNPA 1UFFA 4F17A 4RTVA 3VS1A 1I1JA 2DL3A 1X2KA 2GNCA 4AFQC 1U06A 1G83A 1SU8A 4ORZA 2DL5A 4RTZA 2A28A 1ZUYA 2J06A 2C0OA 2G6FX 1ZLMA 2CSQA 2DM1A 1VYUA 3O3NB 3DPPA 1JEGA 3H0HA 2DA9A 2GGRA 2CT4A 1UECA 1WXUA 3JV3A 5GJVB 3O3OB 2MCNA 3KFVA 1SHFA 3VS0A 3NMZC 1SRMA 1UJ0A 2EYZA 1ZSGA 4EZXA 1RUWA 2EW3A 1X27A 1W9MA 2ROLA 3H0IA 2RQRA 1QWFA 1ABQA 1KIKA 1BU1A 1OA1A 3LMFA 2KYMA 1W1FA 4D8JA 2DRKA 1E9VA 1NLOC 4HVUA 4LUEA 3PVQA 5HCKA 3T46A 3QNJA 1WXBA 4HXJA 1TG0A 1ZBJA 4HCKA 1SUFA 2CT3A 3LH5A 1N5ZA 1PWTA 2DRMA 1YN8A 2AKKA 2K7AA 4ZNXA 3I39X 2DX1A 3GI7A 1UDLA 2L3PA 1MUZA 2YT6A 2GA9D 3THKA 3OWGA 3VS5A 4KIKB 3REAB 1AWXA 4E81A 1UHCA 1GCPA 1QLYA 3KAVA 1I07A 4EZOA 3VRZA 2AZSA 4G6QA 1M30A 4R5KA 3FD9A 3ER8C 4IM3A 4R5LA 2A36A 1JQKA 1ZX6A 2BZ8A 2JTEA 2WINM 2L3QA 4LN2A 2KEAA 1X2QA 3UITA 1JO8A 2LJ1A 2FPEA 2LNHB 1QCFA 4IWOA 2KHOA 1JXOA 1IO6A 4J9GA 2QXLA 2JM9A 1MV3A 4Z8AA 3QWXX 2LQWA 2GAFD 1OA0A 2P4RA 1M3AA 3L3OM 1GNTA 4EZRA 1CKAA 4FM3A 3I9QA 5I11A 2DF6A 2YUPA 4Z89A 1JU5C 4F00A 1ZUUA 3I5SA 2HCKA 5IHIA 1AZEA 2A37A 4JWIA 1UHFA 2LJ3A 4Y92A 2YUQA 2LJ0A 3NGPA 5I22A 4H6HA 2YI9A 1B07A 2D1XA 4IWQA 1V1CA 2K6DA 3PE0A 1SHGA 4R5JA 4JZ3A 5IHKA 2EYWA 1KSWA 4FSSA 1RLQC 4OMOA 2O9VA 2ND0A 2DBKA 4UDXX 2EBPA 4RUGA 1G2BA 3M0QA 2H8HA 3ERCC 2K2MA 2FPFA 1GRIA 4IIMA 3VS2A 2PNIA 1GFDA 1W6XA 3ER9B 2RNAA 2ESWA 2QFFA 1AWOA 2RQWA 4RTTA 1YWPA 5L23A 3TSZA 3D2FA 2HSPA 4GBQA 1H3HA 1FMKA 2KXDA 3VKHA 2X5CA 3UF4A 4JNFA 2L3SA 2OJ2A 3TVTA 2DVJA 1H92A 4LE9A 2YIBA 1E6HA 1CSKA 4IWPA 3VS4A 3U23A 2EGCA 3RV0A 1GNLA 2J6OA 3SEMA 3M0UA 5EC7A 1UE9A 1YP5A 3NHNA 1M8MA 2QDLA 2NCZA 1SU6A 1AOJA 2BZYA 2YDLA 4F01A 1PKTA 4CC3A 4OMMA 4AFSC 1GCQA 5FWCA 2EYXA 2YUOA 4F14A 1WIEA 3RBBB 2KXCA 2X3WD 1AWWA 1FYNA 3OHXM 4OMPA 4CC7A 2KRNA 4DEYA 1RI9A 1UG1A 2DJQA 3RV1A 4JNEA 2K79A 2KGTA 3EG1A 1SEMA 3D2EA 1EFNA 2KRMA 2RN8A 1NEGA 1UJYA 2DNUA 4EZQA 3VS7A 1KJWA 2PZ1A 1XOVA 2KBTA 2OBMA 2CREA 2O2OA 4D8DA 3SHWA 3VEAA 1OV3A 2V1QA 1GFCA 1CKBA 4HR1A 1M27C 2AKLA 4JZ4A 1GL5A 2LZ6B 4RTWA 3IQLA 1J3TA 2SRCA 1SU7A 2JT4A 4EZWA 4HVVA 2K9GA 2GTOA 1B3QA 3DPOA 4OMQA 1GBQA 1YCSB 2AK5A 4JJBA 4JWCA 2J6KA 1DKYA 3FJ5A 2CSIA 2YIAA 3M0SA 1S1NA 4R0KA 1OOTA 2DYBA 1Y57A 2JXBA 4HY9A 2ED1A 2I0NA 4RTXA 1T3LA 2EVRA 3B52X 2L2PA 3M0PA 1X6BA 3VS3A 3T4AG 5FLEX 4HVWA 4IIOA 4K11A 3QA8A 2JMAA 2O31A 1JXMA 2V1RA 3O5ZA 3ZEDA 4JL9A 4M0MA 2MOXA 1NLPC 1K0SA 5ECAA 4OMNA 2EYYA 3VS6A 1WYXA 2XMFA 1M3BA 1T0HA 2OBLA 4IM2A 1T3SA 2FPDA 1PNJA 2KRSA 1MJGA 1YWOA 2C0IA 3UA6A 3T47A 2LP5A 2NWMA 1VYTA 1PRLC 2YSQA 1WX6A 3R6NA 4JN4A 1KFZA 1TUDA 1AWJA 2GTJA 4EZZA 2J6FA 1GN9A 2OAWA 2DLPA 2RQUA 1K9AA 2ENMA 1PHTA 4X1VA 2D8JA 2BZXA 1X6GA 1ABOA 4J9DA 1Z9ZA 4JWDA 4EZVA 2JNSA 1PRMC 1WFWA 4IM0A 2RF0A 3EHRA 1SPKA 2AZVA 1UUEA 2CH4A 3TSWA 2KE9A 3C0CA 2ED0A 2FRWA 2LQNA 1GCQC 4A63B 2DL8A 2KT1A 1T0JA 1QKXA 3NPFA 1K0XA 5IXFA 3UATA 2FO0A 4IW0A 1TUCA 1U3OA 1VA7A 1DKXA 2RQVA 3ZL7C 3A98A 1UPXA 4JLCA 2VVKA 4J9FA 1GBRA 1AVZC 2B86A 1HJDA 4LUDA 2CH4W 2DE0X 4R5IA 3RNJA 5FIGA 1ARKA 4JWEA 2M51A 2LM0A 5GJWB 4NPHA 1SSHA 2F2WA 2GBQA 2L0AA 2W10A 3EG3A 1SRLA 1WLPB 1JQQA 3B51X 1A0NB 1E1DA 2EWFA 3REBB 1NG2A 3I35A 2DBMA 2JMCA 3EGUA 2JW4A 2KNBB 2PTKA 3I5RA 1X69A 4D8KA 3B53X 1VYVA 2RPNA 2F2XA 2O88A 1K76A 1WA7A 2PY6A 2ROTA 3DPQA 1UTIA 1OEBA 2EPDA 2GQIA 4E3CA 3M0RA 1WI7A 3VRYA 5IH2A 1NM7A 1QKWA 4PO2A 2VWFA 4B9QA 2NUZA 4M4ZA 3C7NA 3QWYA 3KAWA 1HD3A 4EZPA 3H0FA 4AFUC 1U00A 1W70A 1AD5A 3EG0A 3T49A 5E84A 1UGVA 4EZUA 4OMLA 4J9IA 4DEXA 1LCKA 1PKSA 1U5SA 1ZYLA 2EKHA 2CUDA 1E2UA 2EQIA 2OI3A 2FRYA 2X3XD 2D8HA 1K1ZA 4J9BA 4HYBA 1K4US 5TKYA 2VKNA 2YUNA 3UA7A 2RQTA 2HEQA 3T48A 2CUBA 2N3KA 1ZUKA 2FG0A 4EZYA 2ABLA 4JJDA 2F2VA 2D0NA 1E7OA 3EHQA 5IXBA 4QT7A 2EGAA 2LX7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EGE A;  4J9C A;  2A08 A;  2E5K A;  4AG1 C;  4J9H A;  2LCS A;  4AG2 C;  1Y0M A;  1Z9Q A;  2KR3 A;  1YNZ A;  2RMO A;  2O9S A;  1H8K A;  1MV0 B;  2J05 A;  1BB9 A;  2KYB A;  4CC2 A;  1E6G A;  5FW9 A;  2HBW A;  2JS0 A;  4WCI A;  2KRO A;  2W0Z A;  2CDT A;  2HDA A;  1X43 A;  2MIO A;  1I0C A;  1NYF A;  3ULR B;  4J9E A;  1AZG B;  4GLM A;  3EG2 A;  2DIL A;  2FEI A;  2JM8 A;  1OPK A;  2ECZ A;  2JS2 A;  1NYG A;  2BTT A;  4F16 A;  4ESR A;  3M0T A;  3PVL A;  1NEB A;  1WDX A;  1BBZ A;  3CQT A;  4JJC A;  2SEM A;  4AFZ C;  2K3B A;  4KRT A;  2M0Y A;  1AEY A;  5FWB A;  4RTY A;  1RLP C;  1QWE A;  1BK2 A;  2DMO A;  3H41 A;  5IHN A;  4E6R A;  1WXT A;  4JPB W;  2C0T A;  1OPL A;  1HSQ A;  4RTU A;  2J7I A;  4CC4 B;  2KT8 A;  4Z88 A;  2LMJ A;  2IIM A;  4EIK A;  1M3C A;  2DL7 A;  3GBQ A;  2DL4 A;  4LNP A;  1UFF A;  4F17 A;  4RTV A;  3VS1 A;  1I1J A;  2DL3 A;  1X2K A;  2GNC A;  4AFQ C;  1U06 A;  1G83 A;  4ORZ A;  2DL5 A;  4RTZ A;  2A28 A;  1ZUY A;  2J06 A;  2C0O A;  2G6F X;  1ZLM A;  2CSQ A;  2DM1 A;  1VYU A;  1JEG A;  3H0H A;  2DA9 A;  2GGR A;  2CT4 A;  1UEC A;  1WXU A;  3JV3 A;  5GJV B;  2MCN A;  3KFV A;  1SHF A;  3VS0 A;  3NMZ C;  1SRM A;  1UJ0 A;  2EYZ A;  1ZSG A;  1RUW A;  2EW3 A;  1X27 A;  2ROL A;  3H0I A;  2RQR A;  1QWF A;  1ABQ A;  1KIK A;  1BU1 A;  2KYM A;  1W1F A;  2DRK A;  1NLO C;  4HVU A;  4LUE A;  3PVQ A;  5HCK A;  1WXB A;  4HXJ A;  1TG0 A;  1ZBJ A;  4HCK A;  2CT3 A;  3LH5 A;  1N5Z A;  1PWT A;  2DRM A;  1YN8 A;  2AKK A;  2K7A A;  4ZNX A;  2DX1 A;  1UDL A;  2L3P A;  1MUZ A;  2YT6 A;  3THK A;  3VS5 A;  3REA B;  1AWX A;  1UHC A;  1GCP A;  1QLY A;  1I07 A;  3VRZ A;  2AZS A;  1M30 A;  2A36 A;  1ZX6 A;  2BZ8 A;  2JTE A;  2L3Q A;  4LN2 A;  2KEA A;  1X2Q A;  1JO8 A;  2LJ1 A;  2FPE A;  2LNH B;  1QCF A;  1JXO A;  1IO6 A;  4J9G A;  2JM9 A;  1MV3 A;  4Z8A A;  3QWX X;  2LQW A;  2P4R A;  1M3A A;  1CKA A;  3I9Q A;  5I11 A;  2DF6 A;  2YUP A;  4Z89 A;  1JU5 C;  1ZUU A;  3I5S A;  5IHI A;  2HCK A;  1AZE A;  2A37 A;  1UHF A;  2LJ3 A;  4Y92 A;  2YUQ A;  2LJ0 A;  3NGP A;  5I22 A;  1B07 A;  2D1X A;  1V1C A;  2K6D A;  3PE0 A;  1SHG A;  4JZ3 A;  5IHK A;  2EYW A;  1KSW A;  4FSS A;  1RLQ C;  4OMO A;  2O9V A;  2DBK A;  2EBP A;  4RUG A;  1G2B A;  3M0Q A;  2H8H A;  2K2M A;  2FPF A;  1GRI A;  4IIM A;  3VS2 A;  2PNI A;  1GFD A;  1W6X A;  2RNA A;  2ESW A;  1AWO A;  2RQW A;  4RTT A;  1YWP A;  5L23 A;  3TSZ A;  4GBQ A;  2HSP A;  1H3H A;  1FMK A;  2KXD A;  3UF4 A;  2L3S A;  2OJ2 A;  3TVT A;  2DVJ A;  1H92 A;  4LE9 A;  1E6H A;  1CSK A;  3VS4 A;  3U23 A;  2EGC A;  2J6O A;  3SEM A;  3M0U A;  5EC7 A;  1UE9 A;  1YP5 A;  3NHN A;  1M8M A;  2QDL A;  1AOJ A;  2BZY A;  2YDL A;  1PKT A;  4CC3 A;  4OMM A;  4AFS C;  1GCQ A;  5FWC A;  2EYX A;  2YUO A;  4F14 A;  1WIE A;  3RBB B;  2KXC A;  2X3W D;  1AWW A;  1FYN A;  4OMP A;  4CC7 A;  2KRN A;  4DEY A;  1RI9 A;  1UG1 A;  2DJQ A;  2K79 A;  2KGT A;  3EG1 A;  1SEM A;  1EFN A;  2KRM A;  2RN8 A;  1NEG A;  1UJY A;  2DNU A;  3VS7 A;  1KJW A;  2PZ1 A;  1XOV A;  2KBT A;  2CRE A;  2O2O A;  4D8D A;  3SHW A;  1OV3 A;  2V1Q A;  1GFC A;  1CKB A;  1M27 C;  2AKL A;  4JZ4 A;  1GL5 A;  2LZ6 B;  4RTW A;  3IQL A;  1J3T A;  2SRC A;  2JT4 A;  4HVV A;  2K9G A;  2GTO A;  1B3Q A;  4OMQ A;  1GBQ A;  1YCS B;  2AK5 A;  4JJB A;  2J6K A;  3FJ5 A;  2CSI A;  3M0S A;  1S1N A;  4R0K A;  1OOT A;  2DYB A;  1Y57 A;  2JXB A;  2ED1 A;  2I0N A;  4RTX A;  1T3L A;  2EVR A;  2L2P A;  3M0P A;  1X6B A;  3VS3 A;  4HVW A;  4IIO A;  4K11 A;  2JMA A;  2O31 A;  1JXM A;  2V1R A;  3O5Z A;  2MOX A;  1NLP C;  1K0S A;  5ECA A;  4OMN A;  2EYY A;  3VS6 A;  1WYX A;  2XMF A;  1M3B A;  1T0H A;  1T3S A;  2FPD A;  1PNJ A;  2KRS A;  2C0I A;  1YWO A;  3UA6 A;  2LP5 A;  2NWM A;  1VYT A;  1PRL C;  2YSQ A;  1WX6 A;  3R6N A;  1KFZ A;  1TUD A;  1AWJ A;  2GTJ A;  2J6F A;  2OAW A;  2DLP A;  2RQU A;  1K9A A;  2ENM A;  1PHT A;  4X1V A;  2D8J A;  2BZX A;  1X6G A;  1ABO A;  4J9D A;  1Z9Z A;  1WFW A;  1PRM C;  2RF0 A;  3EHR A;  1SPK A;  2AZV A;  1UUE A;  2CH4 A;  3TSW A;  2KE9 A;  3C0C A;  2ED0 A;  2FRW A;  2LQN A;  1GCQ C;  4A63 B;  2DL8 A;  2KT1 A;  1T0J A;  1QKX A;  3NPF A;  1K0X A;  5IXF A;  3UAT A;  2FO0 A;  1TUC A;  1U3O A;  1VA7 A;  2RQV A;  3ZL7 C;  3A98 A;  2VVK A;  4J9F A;  1GBR A;  1AVZ C;  2B86 A;  1HJD A;  4LUD A;  2CH4 W;  2DE0 X;  3RNJ A;  1ARK A;  2M51 A;  5GJW B;  2L0A A;  1SSH A;  2F2W A;  2GBQ A;  2W10 A;  3EG3 A;  1SRL A;  1WLP B;  1JQQ A;  1A0N B;  3REB B;  1NG2 A;  3I35 A;  2DBM A;  2JMC A;  3EGU A;  2JW4 A;  2KNB B;  2PTK A;  3I5R A;  1X69 A;  4D8K A;  1VYV A;  2RPN A;  2F2X A;  2O88 A;  1K76 A;  1WA7 A;  2ROT A;  1UTI A;  1OEB A;  2EPD A;  2GQI A;  3M0R A;  1WI7 A;  3VRY A;  5IH2 A;  1NM7 A;  1QKW A;  2VWF A;  2NUZ A;  4M4Z A;  3QWY A;  1HD3 A;  3H0F A;  4AFU C;  1W70 A;  1AD5 A;  3EG0 A;  1UGV A;  4OML A;  4J9I A;  4DEX A;  1LCK A;  1PKS A;  1U5S A;  2EKH A;  2EQI A;  2CUD A;  2OI3 A;  2FRY A;  2X3X D;  2D8H A;  1K1Z A;  4J9B A;  1K4U S;  2VKN A;  2YUN A;  3UA7 A;  2RQT A;  2HEQ A;  2CUB A;  1ZUK A;  2FG0 A;  2ABL A;  4JJD A;  2F2V A;  2D0N A;  1E7O A;  3EHQ A;  5IXB A;  4QT7 A;  2EGA A;  2LX7 A; 
#chains in the Genus database with same CATH topology
 3X28 B;  2QTV A;  2JN0 A;  3MPU B;  2EQM A;  3VU3 C;  5AT1 B;  4ZN3 A;  1YNZ A;  4KH0 B;  1UB4 A;  4QKU A;  2KYB A;  1KG1 A;  5FW9 A;  3CVR A;  3KBG A;  1OU8 A;  4E2F B;  2HBP A;  2DFU A;  4WCI A;  3EJS A;  4EZS A;  2QGF B;  2HDA A;  3CCJ Q;  2MIO A;  1WPY A;  4J9E A;  4KGX B;  4C8Q G;  3UDC A;  3M56 A;  1PCX A;  2DIL A;  2EFL A;  3F7W A;  3CCQ A;  4A4G A;  1BIA A;  1OPK A;  4Z02 A;  1YIJ A;  1MHN A;  2RT6 A;  2ND1 A;  2JS2 A;  4FM4 B;  4ESR A;  3M0T A;  3QBY A;  2RHX A;  1I49 A;  1YFN A;  4MZM A;  1TQS A;  1PSE A;  2BE7 D;  2K57 A;  1TQT A;  3HKS A;  1M90 U;  2E3I A;  2K3B A;  1YJN A;  2E12 A;  5J39 A;  2DMO A;  2HQX A;  1Q82 C;  2CP5 A;  3RER A;  4KIK A;  1OPL A;  1Y07 A;  2J7I A;  1Q7Y R;  2KT8 A;  4Z88 A;  4QQ6 A;  1PD0 A;  2LMJ A;  4N0A A;  4EIK A;  2E4H A;  1VQK Q;  4AZG A;  1M3C A;  1MND A;  2DL7 A;  5FU6 B;  3O3M B;  3GBQ A;  4QVD A;  3G6E Q;  3BLB A;  4LNP A;  5GMK l;  1UFF A;  4HT9 A;  4M7A F;  4R55 A;  4BNE A;  2VXF A;  1OX8 A;  2DL3 A;  1H3Z A;  1X2K A;  4A54 A;  2GNC A;  1WHG A;  1BI3 A;  2O4X B;  3BUB A;  2J06 A;  2HD0 A;  2C0O A;  2CP6 A;  3OW2 A;  1VYU A;  3O3N B;  3DPP A;  2DA9 A;  1WHH A;  5GJV B;  3O3O B;  1IHV A;  2L8D A;  4C5G A;  1BIB A;  3C4S A;  1SRM A;  1UJ0 A;  2VV5 A;  2EYZ A;  1N9S A;  4B6M A;  2EW3 A;  1KQ2 A;  2RQR A;  4DBF A;  5HKC A;  3PNW C;  1XNI A;  3PFS A;  1BU1 A;  2CP3 A;  2E6N A;  1W1F A;  2R5A A;  4JS4 A;  1M8V A;  4LDV A;  5GAO m;  3T46 A;  3QNJ A;  1WXB A;  5FU7 C;  2GFA A;  4HCK A;  5LL6 S;  2CT3 A;  1VQ7 Q;  4BI3 A;  3HPW A;  1YN8 A;  2AKK A;  4DOW A;  1JJ2 P;  2RAI A;  2DX1 A;  1UDL A;  2YT6 A;  3THK A;  2FB7 A;  3GPL A;  3CCL T;  1YI2 Q;  3CCM Q;  1GCP A;  1QWU A;  2QG9 B;  1I07 A;  3VRZ A;  2RB6 A;  3CCE Q;  3CME T;  4L6V 5;  5HY6 A;  5GMK e;  3KXT A;  3RMS A;  3V7S A;  1YJW A;  3QDR B;  5GAN 6;  3E1S A;  1LNX A;  2FPE A;  3DX2 A;  4IWO A;  4J9G A;  5LJ3 e;  3RES A;  1ZA1 B;  3M9Q A;  4Z8A A;  3PIO A;  2QA4 T;  4IUT A;  3M59 A;  2CKK A;  1OA0 A;  2RI3 A;  2FZC B;  3NFC A;  4FM3 A;  5I11 A;  1I4T A;  3PMI A;  3EFO A;  3LYI A;  3LWH A;  1ZUU A;  5IHI A;  2HCK A;  1Y2O A;  4M78 C;  1AZE A;  1VQP Q;  1K8A R;  3SOG A;  4ZTF A;  2KMT A;  4FSX A;  1HTY A;  2LJ0 A;  2YI9 A;  1B07 A;  3JSC A;  4KBM B;  2K6D A;  1YIJ Q;  1WJR A;  1SHG A;  2IPO B;  2EYW A;  1KSW A;  4FSS A;  3OYB A;  2EBP A;  3DB4 A;  5CK9 A;  1JJ2 S;  2L89 A;  2NUT B;  2H8H A;  3V8J A;  2K2M A;  2QXF A;  3VS2 A;  2JVV A;  1GFD A;  3J80 E;  4C0G A;  2ESW A;  2K4Y A;  3LLL A;  4C8Q A;  2DJZ A;  3R6O A;  2ZPG B;  5L23 A;  2QKW A;  3D2F A;  1QVP A;  4GBQ A;  1M2V B;  1H3H A;  1FMK A;  2KXD A;  2RJE A;  4BE0 A;  4A53 A;  3HP9 A;  2DVJ A;  2YIB A;  3RR6 A;  4I1Q A;  3I55 Q;  5LJ5 e;  3BE3 A;  2DER A;  1PD1 A;  3OK8 A;  1RAC B;  3G4S Q;  5FRM A;  4KT0 E;  2YL6 A;  4C92 B;  1X75 C;  2YDL A;  1OX9 A;  4OMM A;  4AFS C;  1GCQ A;  2OTJ Q;  4BE2 A;  3SWN A;  2YUO A;  1FYN A;  3TEE A;  4OMP A;  1LJO A;  2KRN A;  4LD6 A;  4M75 C;  1IZ6 A;  1OU9 A;  1G3T A;  3RKW A;  1NEG A;  4MDW A;  2DXU A;  2VYT A;  2DNU A;  2HAX A;  1D3B A;  2ZPE B;  1I4D A;  1JBM A;  1OZ2 A;  2GQV A;  2O2O A;  3VEA A;  2DAQ A;  3CMA A;  3LVT A;  1GFC A;  1CKB A;  4HR1 A;  3LGF A;  3P8D A;  4JZ4 A;  2LZ6 B;  3JB9 H;  4HVV A;  2EQJ A;  4M7A G;  2F5K A;  1SG5 A;  2AK5 A;  5CR2 A;  4JWC A;  2J6K A;  1VQ7 T;  3M0S A;  4M78 B;  1U1S A;  1Y57 A;  4XQ3 A;  4PJO E;  1T3L A;  1IB8 A;  4XTV A;  3M0P A;  1YI2 T;  5CIU A;  4K11 A;  4L5G A;  3RKX A;  5LJ3 f;  5DLO A;  1JXM A;  3CCE T;  1WDZ A;  4M0M A;  1K0S A;  3BVT A;  3DKM A;  4DBR A;  4H8S A;  2HL5 C;  5LJ3 g;  4NL2 A;  3D4Y A;  2XIC A;  2K5I A;  2HQE A;  5GMK j;  4KUI A;  2RI5 A;  2F1L A;  1BCO A;  2FPD A;  2PVO B;  2D4C A;  1IRE B;  4NSW A;  3OSS C;  1IXD A;  4C0D C;  5GAO l;  1YWO A;  1I81 A;  4C92 D;  2OO2 A;  2WSE E;  1SF9 A;  5LJ3 j;  4C5I A;  2CGH A;  2VAS A;  4J8O A;  1AWJ A;  1UGR B;  1GN9 A;  1KHI A;  3BVU A;  1VQP T;  2RO0 A;  3MKD A;  2CZ0 B;  2X4W A;  1WFW A;  2JOY A;  3FB9 A;  1SPK A;  2AZV A;  2QQ9 A;  2CH4 A;  1Y71 A;  4WF2 A;  5GAN 8;  1YIJ T;  2Y4Y A;  5GAN e;  1X03 A;  2E10 A;  2FRW A;  3H8Z A;  2LQN A;  4F7U B;  1PG5 B;  4A63 B;  1V76 A;  2DD4 A;  2KT1 A;  1R77 A;  1TXQ A;  3NPF A;  1WNL A;  3CC7 Q;  2MK5 A;  1K73 C;  2V26 A;  3G1J A;  2L3R A;  5CQY A;  1Y96 A;  2FO0 A;  1ZBX A;  2DO3 A;  1N8R R;  1Q81 C;  4IW0 A;  5LJ5 f;  2Z0W A;  1TUC A;  1VA7 A;  2QK0 A;  4NOY A;  1RAF B;  3A98 A;  4JLC A;  1WJS A;  4IUQ A;  2VVK A;  5KBP A;  3CCU Q;  2RH2 A;  4FT2 A;  4M78 D;  1HJD A;  2F1B A;  4LUD A;  2CH4 W;  5A2Q E;  5LJ5 g;  1VQ9 A;  4RKU E;  5FIG A;  2YRD A;  1ARK A;  3LWI A;  1ZA2 B;  4JWE A;  2M51 A;  5GAN d;  3DX4 A;  1K8A U;  3I55 T;  4PLI A;  4D6W A;  1WLP B;  1TSF A;  3B51 X;  4BY6 B;  4ZGJ B;  3REB B;  2R5M A;  3G4S T;  3QG1 A;  3EGU A;  2C08 A;  2PTK A;  5LJ5 j;  5DLQ E;  2D6F A;  3RKY A;  2RPN A;  3E2U A;  2P0Q A;  1UTI A;  3SYV A;  1OEB A;  1B7T A;  4E3C A;  3A8M B;  5IH2 A;  2M0O A;  3L2W A;  3GP8 A;  3RDV A;  4EMK C;  4AZ5 A;  1HD3 A;  1W70 A;  1BKB A;  4DOV A;  1NJI C;  5GMK i;  2PQW A;  3HAJ A;  2AIR B;  5GAN 4;  1MMN A;  1KD1 C;  3CMA Q;  3CCL A;  3P8H A;  4OML A;  1RI0 A;  2OI3 A;  2CUD A;  5D6X A;  3E19 A;  1K1Z A;  4HYB A;  1HYO A;  2DVE A;  2K2V A;  1YIT A;  2VKN A;  4C0D B;  3CME A;  2HZY A;  2CUB A;  2FG0 A;  3A8H B;  1PSF A;  2ABL A;  4JJD A;  2WYI A;  5IXB A;  5I21 A;  4GLK A;  2F7O A;  1KK7 A;  4P5N A;  3LW5 E;  4J9C A;  2QDY B;  3X25 B;  4EDU A;  1SSF A;  3A8G B;  4M7A A;  3OB9 A;  2HNI A;  2Z0O A;  4AG1 C;  5HK3 A;  3FC3 A;  1QMC A;  1Y0M A;  1Z9Q A;  2RMO A;  1YJ9 Q;  2YIV X;  1LPL A;  2O9S A;  1H8K A;  2DK3 A;  5D6Y A;  4N4H A;  1BB9 A;  3CCJ A;  4FT4 A;  1UGP B;  4ZGE B;  2HBW A;  3WVE B;  4R56 A;  2KRO A;  2XG8 D;  1X43 A;  2K3Y A;  3OA6 A;  3CPW A;  2LRQ A;  1I0C A;  1NYF A;  1OYX A;  3ULR B;  4FW2 A;  5GMK h;  1OZ3 A;  4GLM A;  2KDS A;  1ZSZ A;  3EG2 A;  4ATO A;  1ACM B;  2PVD B;  2Z0V A;  2EJG A;  3S6W A;  4OMF B;  2ECZ A;  4HCC A;  4E7K A;  1NYG A;  3KDR A;  1R8O B;  3V7C A;  3I01 A;  5LJ3 h;  1QCN A;  4YTL A;  1NEB A;  1WDX A;  1YHQ Q;  2A7Y A;  4JJC A;  3QUI A;  4M7A E;  2M0Y A;  2COY A;  2RK1 A;  1RLP C;  1QWE A;  1VQ6 Q;  3H41 A;  4J83 A;  5IHN A;  4JPB W;  1HSQ A;  3DDF A;  4OP0 A;  4RTU A;  1VQK A;  3J7A F;  5GAN j;  2RHI A;  3G6E A;  3CC7 T;  5CKD A;  2COW A;  4R5G A;  2RA2 A;  5KYX B;  2DL4 A;  4EMK B;  4AZC B;  4H6I A;  4BI8 B;  1VQ9 Q;  4JLG A;  1PC0 A;  4F17 A;  3CCU T;  4OB0 B;  3F70 A;  1C0M A;  3VUZ A;  4AFQ C;  2EIF A;  1G83 A;  4RTZ A;  2A28 A;  1ZUY A;  2RHY A;  5GAN 2;  3CCR A;  2G6F X;  1ZLM A;  4IUP A;  2CSQ A;  4C92 F;  3CC4 A;  2CT4 A;  1WXU A;  4BD3 A;  3T9N A;  3TRE A;  1VIE A;  1D0Z A;  3JCM e;  4Q5W A;  5GAO n;  2ROL A;  1W9M A;  3GIB A;  4XTZ A;  2M1H A;  5LJ5 h;  4BE1 A;  1QWF A;  1KIK A;  2CS7 A;  1N8R U;  2X4J A;  3E9F A;  2KYM A;  1X01 A;  4OGE A;  1FXX A;  2DRK A;  2KSS A;  4HVU A;  3VUB A;  2FHD A;  3C12 A;  2OW7 A;  1TG0 A;  2P0K A;  4AZ6 A;  2V8J A;  4FL6 A;  1S72 A;  3JCM Q;  3CMA T;  2ZXQ A;  3D52 A;  1PWT A;  2DRM A;  1YI2 A;  3GNF B;  3RIR A;  3CCM A;  3M57 A;  1K9M R;  4M77 C;  1MUZ A;  2GA9 D;  4KIK B;  2EJ9 A;  3JCM d;  1VQL Q;  3CCE A;  3KAV A;  4M78 F;  4G6Q A;  2LCC A;  3FD9 A;  2RI2 A;  4R5L A;  5IT9 E;  1ZX6 A;  2JTE A;  4BDZ A;  3MCA B;  4BAC A;  2L3Q A;  1RL2 A;  1JO8 A;  1N27 A;  4XU0 A;  2LJ1 A;  5CKE A;  1MMG A;  4NL3 A;  4AVM A;  4KH1 B;  1Q86 U;  2JM9 A;  1MV3 A;  3CV5 A;  2MPX C;  2CZ7 B;  3QWX X;  2O01 E;  4M7D B;  2LQW A;  3DX3 A;  3DB3 A;  1IHW A;  1YJ9 T;  1VQP A;  2YUP A;  2NYS A;  3QII A;  1JU5 C;  4RG2 A;  3QJ6 A;  4JWI A;  1UHF A;  2B8A A;  2DD5 A;  2HL3 A;  4XTU A;  3OYM A;  3NGP A;  2I2L A;  1URU A;  2D1X A;  2E64 A;  4E7Z A;  4IWQ A;  1BYM A;  4R5J A;  2MF2 A;  5IHK A;  4HKE A;  2F18 A;  5IAY A;  1FX7 A;  2ND0 A;  2DBK A;  3RUX A;  2QAS A;  4RCC A;  2L5Q A;  1G2B A;  1VUB A;  3M3W A;  3ERC C;  1R34 A;  3V8L A;  4IIM A;  1OI1 A;  1W6X A;  3QZ9 B;  4F7U F;  3ER9 B;  2RNA A;  4C0F A;  5CCA A;  1YHQ T;  2EKO A;  2FZK B;  1AWO A;  3OSV A;  4KUD K;  4PJO C;  4RTT A;  1KQS A;  3SWN C;  1VQ6 T;  2M9U A;  2OX7 A;  2P4T A;  3DLL A;  3VKH A;  3MP8 A;  2D1L A;  4OGC A;  3I55 A;  4JNF A;  3L2U A;  2X51 A;  3LGL A;  4FCY A;  2ZPB B;  3LX7 A;  3G4S A;  3OQ5 A;  2LT4 A;  3VV0 A;  3JB9 I;  5GAN h;  3RV0 A;  2V8K A;  2VXE A;  2QEX Q;  3L3P A;  1VQ9 T;  3M0U A;  5EC7 A;  1UE9 A;  1WHM A;  2QDL A;  1QCO A;  2OTJ A;  3CCR Q;  4DA4 A;  2ATC B;  2BZY A;  1PKT A;  3CC4 Q;  4E7I A;  4M77 B;  3G71 A;  3EFO B;  4M7D D;  2KXC A;  2X3W D;  3AT1 B;  3VYG A;  1M1K R;  4IUU A;  1RI9 A;  1UG1 A;  3MEU A;  2F1A A;  3RV1 A;  2MYS A;  2V0O A;  3EG1 A;  2YLB A;  3J81 E;  3D2E A;  3ACO A;  2KRM A;  4QVZ A;  1KC8 U;  1UJY A;  4EZQ A;  3VS7 A;  1QW1 A;  2X3X A;  1H64 1;  2KBT A;  2CRE A;  3C95 A;  4D8D A;  2V1Q A;  3SD4 A;  1S72 Q;  3IQL A;  1J3T A;  3QYH B;  1M1G A;  1QX1 A;  2K9G A;  1VQO Q;  3M54 A;  3DPO A;  4EMG A;  2FVU A;  1GBQ A;  1UGQ B;  1G3Y A;  1YCS B;  1DKY A;  3FEO A;  3FJ5 A;  1YIT T;  2YIA A;  3QWE A;  1S1N A;  4R0K A;  1OOT A;  3OMG A;  4N4G A;  3EFS A;  3OYE A;  3OYN A;  4RTX A;  2EVR A;  3VS3 A;  3T4A G;  3L2Z A;  4C92 G;  3QA8 A;  1XTD A;  2JMA A;  5GAO p;  1TUG B;  2O31 A;  2V1R A;  3O5Z A;  2CP0 A;  3BUQ A;  3EH2 A;  3HRU A;  1IGQ A;  1WYX A;  1C1A A;  1T0H A;  9ATC B;  4IM2 A;  2O4X A;  1PNJ A;  4MMK A;  2KRS A;  5CVI A;  4PJO B;  2DZC A;  4O6J A;  3UA6 A;  3T47 A;  2XKO C;  2CYZ B;  2DKG A;  3CCJ T;  3DDG A;  3R6N A;  1KFZ A;  1TUD A;  4M77 D;  2GTJ A;  2XK0 A;  2OAW A;  2DLP A;  3TQ7 P;  2ENM A;  3CBP A;  1K9M U;  4J9D A;  1ABO A;  1Z9Z A;  4EZV A;  4AT1 B;  1PRM C;  2E3H A;  3GOX A;  4IM0 A;  3AHU A;  1TQW A;  1UUE A;  4M78 G;  2YWW A;  2HKQ B;  4JRI A;  3MEV A;  4PFO A;  3CC7 A;  3I2W A;  1QKX A;  3TU4 K;  1K0X A;  4BI4 A;  1Q86 C;  4KGV B;  3L1A A;  5KYU B;  3EG9 B;  1QP2 A;  2EAY A;  3V8K A;  3CCU A;  3O8V A;  1DKX A;  4J6X A;  1VQK T;  2OAU A;  2ZPH B;  1UPX A;  5CKH A;  3CPW S;  3G6E T;  2B86 A;  1WHL A;  2DXT A;  3Q1J A;  5FU7 B;  2QQS A;  2GF7 A;  4LD9 K;  1B34 B;  4OB3 B;  2LM0 A;  1M9S A;  4NPH A;  2L0A A;  3EG3 A;  1SRL A;  4C0Z A;  2X4X A;  3LLR A;  2PMR A;  2EWF A;  1WHK A;  3SDZ A;  1NG2 A;  2KVQ G;  2QEX T;  3CCV A;  4AZ7 A;  1ZHI A;  2JW4 A;  1M90 C;  2IG0 A;  2FIC A;  5KYW B;  3MP6 A;  3CCR T;  3JB9 J;  4C8Q E;  3G71 Q;  2ZGW A;  5IN1 A;  5GAM e;  1WA7 A;  4JLI A;  2PY6 A;  3CC4 T;  2BUD A;  4ELY C;  2BE9 B;  2GQI A;  4PJO D;  3VRY A;  5GAO q;  1NM7 A;  4F7U G;  1QKW A;  2VWF A;  1Q7Y U;  3UPU A;  4M4Z A;  2DEU A;  1Q82 R;  1U00 A;  4PJM A;  1UGV A;  3QZ5 B;  1N6A A;  3BY7 A;  4J9I A;  1PKS A;  4FYX B;  4OB2 B;  4FW1 A;  2NUP B;  3BVX A;  5TKY A;  2RQT A;  5GAM d;  3T48 A;  1HWW A;  1S72 T;  3M4Y A;  3CZS A;  2HSE B;  3JCM h;  1VQ4 Q;  3CCM T;  1VQO T;  2ZAE A;  5FRN A;  2D0N A;  2XDD A;  4OB1 B;  2F7Q A;  1VQ8 Q;  1M2V A;  1HXK A;  3KUF A;  1ZSZ C;  3OYJ A;  5AYF A;  3JAM E;  3G7Z A;  2RAJ A;  2EGE A;  2RHZ A;  5KH6 A;  2ELB A;  2A08 A;  4MDX A;  4PFZ A;  1YJ9 A;  3M53 A;  5L8R E;  2F69 A;  4EZN A;  2LCS A;  2DXB A;  2KR3 A;  3OS1 A;  3VKI A;  1KC8 C;  1MV0 B;  1VQ5 A;  6AT1 B;  4M7D F;  4UDY X;  4C92 A;  4HT8 A;  4FYV B;  5CKF A;  2EX3 B;  2CDT A;  3FLG A;  3BUP A;  2RAK A;  4X9C A;  3UWN A;  3DYT A;  3QDF A;  1AZG B;  1V29 B;  3FJP A;  3MJX A;  2LDM A;  3FDR A;  3MEA A;  2ZPF B;  2DTO A;  2KY9 A;  2JM8 A;  3GLX A;  4KUL A;  1RAI B;  1YHQ A;  3X26 B;  5FLX E;  4F16 A;  2BIV A;  3PVL A;  1VQ6 A;  2SEM A;  4AFZ C;  1DKZ A;  3HAH A;  1AEY A;  4JRQ A;  2RD1 A;  4J6W A;  5FWB A;  3E9G A;  4M75 B;  2PUO B;  1WXT A;  1IRX A;  3OW2 P;  1VQM Q;  4OVA A;  2IIM A;  2H3E B;  4C92 E;  2MWO A;  2WSF E;  4M78 A;  2MI7 A;  2YL5 A;  2G3R A;  3VEB A;  1R0C B;  3EGX B;  3M4G A;  2XDP A;  4RTV A;  4DBH A;  2VB6 A;  5C5B B;  3OYH A;  1W2B A;  1VIF A;  1SU8 A;  1MGQ A;  2DL5 A;  2PVG B;  3QO3 A;  3CCV Q;  2DM1 A;  3HTR A;  2EJF A;  2OTJ T;  1JEG A;  3H0H A;  2GGR A;  1UEC A;  2XU8 A;  4M77 F;  3VS0 A;  1NE8 A;  2D9T A;  3NMZ C;  1KQS S;  3G71 T;  2X4Y A;  1X27 A;  1HXD A;  3OYL A;  4QQD A;  3MEW A;  4O5V A;  1OA1 A;  3OYC A;  3JCM X;  4D8J A;  3A1P A;  1E9V A;  1NLO C;  4LUE A;  2XI9 A;  4M78 E;  2MMP A;  3PVQ A;  3HSB A;  4AZI A;  2OZN B;  1ZBJ A;  4XAX B;  1SUF A;  2RJC A;  2VUB A;  3PIP A;  3LH5 A;  3OW2 S;  1N5Z A;  2QQB A;  1VQL A;  4ZNX A;  2Q12 A;  3GI7 A;  2L3P A;  3VS5 A;  3OWG A;  2R58 A;  1PS3 A;  1VQN Q;  3REA B;  1AWX A;  3JB9 D;  1X6O A;  1QLY A;  2EWN A;  4M75 D;  1I4L A;  4LDX A;  4A4K A;  2QTX A;  4VUB A;  1TWB A;  3OYD A;  1M30 A;  4HA8 A;  4MML A;  1JQK A;  2RM4 A;  5KYY A;  3QNI A;  2KEA A;  5C0M A;  2YLL A;  3OS0 A;  3JCM W;  1M90 R;  2FYK A;  4LDU A;  2OTL A;  2LNH B;  1QCF A;  1Q7Y C;  2QXL A;  2K5F A;  3S3N A;  4C5H A;  1Q82 U;  2GAF D;  4E7S A;  2P4R A;  4FZP A;  1M3A A;  1VQ5 Q;  1GNT A;  3L3O M;  3S3M A;  4J7F A;  2JTM A;  2DF6 A;  4N0A C;  2YLC A;  3ME9 A;  4PJO F;  4DYL A;  1BI2 A;  5GAN f;  2M02 A;  2A37 A;  3BFM A;  2LJ3 A;  3PT9 A;  3L2Q A;  1D1B A;  1M4Z A;  4H6H A;  1WJQ A;  5DY9 A;  1V1C A;  1N9R A;  5GAN g;  1RLQ C;  4A4H A;  2O9V A;  4A4E A;  3EGD B;  4UDX X;  2LQ8 A;  2FPF A;  4E47 A;  2PNI A;  3BVV A;  3NTK A;  4JUV A;  2RQW A;  1YWP A;  2ZPI B;  3EJR A;  2HSP A;  2PUK B;  3QKJ A;  4RCB A;  2X5C A;  1LOJ A;  2OJ2 A;  3TVT A;  1VQM T;  1H92 A;  4LE9 A;  1CSK A;  2LQK A;  4M7D G;  3D4Z A;  2QEX A;  4IWP A;  3UT1 A;  1RAE B;  3CCS Q;  1RAD B;  5GAO r;  3I56 A;  3M58 A;  2DTI A;  2J6O A;  5KE2 A;  4PNO A;  2NCZ A;  1SU6 A;  4XTY A;  1M2O A;  1U1T A;  4PFP A;  3L42 A;  5FWC A;  3OYK A;  3CCV T;  2EYX A;  4L59 A;  1WIE A;  3RBB B;  3QXE B;  3PLT A;  2DJQ A;  2D0Q B;  4WPE A;  4JNE A;  3OMC A;  2K79 A;  2KGT A;  1D09 B;  4Y91 A;  1SEM A;  4EMH A;  1EFN A;  1BI1 A;  2RN8 A;  3PGG A;  3QHS A;  1K73 R;  1BCM A;  1Q81 R;  2P0P A;  5FU6 C;  2COZ A;  4CRI A;  2RJD A;  3SHW A;  2E6Z A;  1FWZ A;  1VQO A;  1M27 C;  2AKL A;  1K8A C;  3NTH A;  4HCZ A;  3P8B B;  2SRC A;  1SU7 A;  2JT4 A;  4EZW A;  1QVG A;  1B3Q A;  5GAM h;  2JZ2 A;  2CSI A;  3MP1 A;  2DYB A;  5FRO A;  3QE6 A;  2ED1 A;  4B9X A;  3B52 X;  2L2P A;  1NZ9 A;  2K5L A;  1VQN T;  3OBW A;  4HVW A;  4IIO A;  5D7U A;  5J3B A;  1UEB A;  1TTH B;  1D0X A;  3ZED A;  2DTH A;  5KYX A;  4M77 G;  2E5Q A;  2MOX A;  4EMK A;  4AZC A;  2OTL Q;  4PL6 A;  3VS6 A;  2XDB A;  4C8Q C;  2EQK A;  2VC8 A;  2OBL A;  4NS5 A;  2RJF A;  2QA4 Q;  1NJI R;  1M1F A;  3OYY A;  4RMO A;  4RG8 A;  2QAZ A;  2LP5 A;  1KD1 R;  1VQ5 T;  1VYT A;  1PRL C;  2BKD N;  2YSQ A;  3OS5 A;  5C6S A;  4EZZ A;  2J6F A;  2RQU A;  2WYH A;  4E7J A;  1HK9 A;  1K9A A;  2X9H A;  2F7P A;  3CC2 A;  4JWD A;  5KYN A;  3D51 A;  2DIG A;  1AHJ B;  3ABH A;  3EHR A;  4WTO B;  3TSW A;  2DPP B;  3L2R A;  2KE9 A;  3C0C A;  2ED0 A;  1GCQ C;  1WHJ A;  3CXC A;  1T0J A;  4AKV A;  1LVK A;  2JTF A;  4UC4 A;  1I8F A;  3JB9 F;  3EJP A;  5IXF A;  1FMW A;  4KGZ B;  3UAT A;  4M75 F;  3OBY A;  1W2B P;  2FYV A;  2YKT A;  1G5V A;  2EYQ A;  4J9F A;  2XID A;  3MET A;  1C6V X;  4LDW A;  2DE0 X;  4R5I A;  4PJO G;  3RNJ A;  3I56 Q;  2EFK A;  5GJW B;  3JCM f;  4JJN K;  2GBQ A;  2LNV A;  2W10 A;  2QI2 A;  3CCS T;  1NBE B;  1NPR A;  1P92 A;  3DLM A;  1OQK A;  2DBM A;  3EJT A;  3BVW A;  2KNB B;  3I5R A;  4D8K A;  3B53 X;  2XHC A;  2VGN A;  1VYV A;  5A0G A;  4E7H A;  4ATM A;  3JCM g;  4PJJ A;  1I5L A;  2F2X A;  2EFI A;  4M7D A;  2X3W A;  3N5B B;  4JDS A;  2CZ1 B;  3DPQ A;  3JCM P;  2EPD A;  3GNG A;  7AT1 B;  3M0R A;  1I4K 1;  5CQX A;  4PO2 A;  3C94 A;  3QWY A;  4EZP A;  1RAH B;  3H0F A;  1AD5 A;  2E1H A;  4BDY A;  3BUD A;  2KI7 A;  4EZU A;  3BDL A;  4AZH A;  1LCK A;  4C8Q B;  2EKH A;  2FRY A;  2X3X D;  1W2B S;  1VQ4 A;  2QGG A;  2E41 A;  3UA7 A;  2HEQ A;  4C92 C;  5GAN 3;  1RAA B;  4EZY A;  1VQL T;  1ZWW A;  3EAE A;  1VQ8 A;  3EHQ A;  3NTI A;  1QVF A;  1MMA A;  4M7D E;  2CP7 A;  2MI6 A;  8ATC B;  1NPP A;  2C06 A;  2M16 A;  3CPW P;  1TS9 A;  4Y28 E;  2LX7 A;  3DX0 A;  4LXC A;  3HFO A;  3QPH A;  1GXI E;  4QQG A;  2E5K A;  4FYY B;  3HAI A;  3A8L B;  1N8R C;  4FZS A;  2YI8 A;  2DET A;  4FIB A;  1R0B G;  4J9H A;  3D50 A;  1WQ7 A;  4AG2 C;  3Q0K A;  2Z8Y A;  2OTL T;  3SWN B;  1K73 U;  4J5Y A;  2J05 A;  4CC2 A;  1Q81 U;  1E6G A;  1O7D C;  4B9W A;  1JRI A;  2JS0 A;  4IKF A;  3OYG A;  2W0Z A;  3CEY A;  4FU6 A;  4M77 A;  2H3J A;  3H9N A;  3HRT A;  1XQH A;  3VYH B;  1D3B B;  2Q13 A;  2FEI A;  3CC2 Q;  3I04 A;  3HL8 A;  4FYW B;  4HR1 B;  2HQH A;  2BTT A;  2KAF A;  4N4I A;  3CCQ Q;  1BBZ A;  8AT1 B;  3CQT A;  2MAM A;  2XD0 A;  4PJL A;  3URG A;  3X24 B;  4KRT A;  3Q84 A;  1VOM A;  5LJ3 d;  4RTY A;  4XU1 A;  1BK2 A;  4E6R A;  1VQM A;  4C8Q D;  5D6W A;  1YJN Q;  2C0T A;  3CZN A;  2HMA A;  1OAO A;  4CC4 B;  4XTX A;  3CKD A;  2HKN A;  4EZT A;  2YLA A;  4J7I A;  1WGS A;  1NJI U;  3SFM A;  3WVD B;  2K3X A;  3HHT B;  2LC4 A;  4M77 E;  1KD1 U;  1O9S A;  4MZP A;  3VS1 A;  1I1J A;  3CD6 A;  2RK2 A;  1U06 A;  3CBM A;  3LH0 A;  4XU2 A;  4ORZ A;  3I56 T;  3SB2 A;  3JCM J;  4PK4 A;  5I2S A;  4JRK A;  5M9O A;  1PM3 A;  4XU3 A;  2AT1 B;  1JB0 E;  3JV3 A;  1TQV A;  2MCN A;  5KE3 A;  2LVM A;  3ZFJ A;  3KFV A;  1SHF A;  4PJO A;  1ZSG A;  4EZX A;  1RUW A;  3QYG B;  3H0I A;  1M5Q 1;  1QVG P;  5CO7 A;  3PTA A;  2P84 A;  4M7A C;  3JB9 G;  1ABQ A;  4QW2 A;  4M75 G;  1EZZ B;  2YHT A;  3LMF A;  5LJ5 d;  5HCK A;  2A0F B;  3DX1 A;  1MMD A;  2NUT A;  4HXJ A;  5DM7 R;  2E65 A;  4E7L A;  4HCB A;  1Y96 B;  4XTW A;  1VQN A;  5A0L A;  2QQA A;  2K7A A;  1O7D B;  3I39 X;  2V8I A;  4BY6 C;  2GFU A;  2QYZ A;  2WAC A;  4F04 B;  3RMQ A;  4E81 A;  1UHC A;  1KHC A;  3FIF A;  3PMT A;  4EZO A;  2AZS A;  5KYU A;  3EG9 A;  4R5K A;  3MHX A;  2A36 A;  3ER8 C;  4IM3 A;  1M1K U;  2BZ8 A;  2KK4 A;  2WIN M;  4BUG A;  4LN2 A;  1R5E A;  1X2Q A;  3UIT A;  2IVW A;  2LTO A;  4XK8 E;  2KHO A;  1JXO A;  1IO6 A;  4JRP A;  1YJW Q;  1B34 A;  1R33 A;  2GF4 A;  1EX4 A;  3RPM A;  1G3W A;  3OY9 A;  2X35 A;  3BUI A;  4EZR A;  1CKA A;  3I9Q A;  4Z89 A;  3A8O B;  1QVG S;  4F00 A;  3I5S A;  5KYW A;  3BW1 A;  1YCY A;  3QSU A;  3EJU A;  4Y92 A;  2YUQ A;  1KQS P;  1D1A A;  3CXC P;  3OYI A;  1OUL A;  5I22 A;  1WZO A;  1UGS B;  4TVR A;  5EG2 A;  3PE0 A;  2LXY A;  4JZ3 A;  2LT1 A;  5KCH A;  3INZ A;  4BB7 A;  3CC2 T;  4OMO A;  3TCJ A;  1TH7 A;  4RUG A;  3OYA A;  1ZQ1 A;  3M0Q A;  1GRI A;  3CCQ T;  2E70 A;  1Y7X A;  2QFF A;  2GCX A;  2NUP A;  5CAI A;  3TSZ A;  1BI0 A;  1LQ7 A;  4NQI A;  1YJN T;  3QJY A;  3UF4 A;  2L3S A;  2Y4X A;  3CCS A;  4OF1 A;  1E6H A;  3OS2 A;  4M7A B;  1I5O B;  2QQR A;  3VS4 A;  2RHU A;  3U23 A;  3EH1 A;  2EGC A;  4IUR A;  5GAM f;  5KYY B;  3CD6 Q;  1K9M C;  1GNL A;  3SEM A;  3ZBD A;  1YP5 A;  2DEQ A;  3NHN A;  5A0D A;  1M8M A;  1AOJ A;  4F01 A;  1AT1 B;  5GAM g;  3OYF A;  3MO8 A;  4CC3 A;  2MWP A;  3ZEH A;  4A4F A;  4F14 A;  3CXC S;  1F1B B;  1AWW A;  3OHX M;  4AMC A;  1ZSZ B;  2WSC E;  4CC7 A;  4DEY A;  2OW6 A;  2JJ9 A;  5GAM j;  1X04 A;  2ZZD A;  1Q86 R;  4PJN A;  1KJW A;  2PZ1 A;  2DYI A;  3G9G A;  1XOV A;  2OBM A;  1W4S A;  3ASK A;  1QVF P;  1OV3 A;  4F7U A;  1GL5 A;  2JUF A;  4RTW A;  4FZO A;  4C8Q F;  2F7R A;  2GTO A;  4OMQ A;  4JJB A;  2DXC A;  1VQ4 T;  4ANJ A;  3M55 A;  4M75 A;  2JXB A;  4HY9 A;  2I0N A;  3BDU A;  2PU9 B;  2AHJ B;  1X6B A;  2YXY A;  1VQ8 T;  5FLE X;  2FL7 A;  1KQ1 A;  4PKC C;  2LX9 A;  2YL9 A;  4DBQ A;  1G8X A;  4ME7 A;  3VJP A;  4ZGD B;  1JJ2 A;  4JL9 A;  3EJQ A;  1NLP C;  4M7A D;  3EGX A;  3H6Z A;  2QA4 A;  5ECA A;  4OMN A;  2EYY A;  1RAB B;  1WQW A;  1M3B A;  2XMF A;  2DZ9 A;  5C5B A;  2F5T X;  1T3S A;  1YJW T;  1QQJ A;  4CI0 C;  4MZT A;  1MJG A;  2C0I A;  4F7U E;  2ZCF B;  2NWM A;  2EQU A;  4X9D A;  3S3O A;  1WX6 A;  3EFR A;  5GMK m;  4JN4 A;  3M5A A;  3WXM B;  1G3S A;  4X34 A;  5KCO A;  4IUV A;  1PHT A;  4X1V A;  3CBO A;  1QVF S;  2D8J A;  4M75 E;  2BZX A;  1X6G A;  2JNS A;  2A3L A;  2RF0 A;  4EPC A;  3CAZ A;  1M1K C;  3GF5 A;  2DL8 A;  2Y90 A;  1XJW B;  4ZTJ A;  4J6Y A;  1D0Y A;  4II1 A;  5HK0 A;  2O0I 1;  2JNG A;  4M7D C;  1SKU B;  3CPF A;  1DJ7 B;  1U3O A;  4QVC A;  5I2M A;  2RQV A;  2X3V A;  3JRZ A;  3HFN A;  3ZL7 C;  1KC8 R;  2LCL A;  2VGM A;  3JCM c;  2Z0N A;  1O75 A;  1GBR A;  1AVZ C;  4V2S A;  1TQU A;  2YRC A;  4AZB A;  4ZN1 A;  1RAG B;  3JCM b;  2CP2 A;  3L2V A;  1YBY A;  2NLU A;  1SSH A;  2JNK A;  2F2W A;  4GY5 A;  1JQQ A;  3CD6 T;  1TOV A;  1A0N B;  1E1D A;  4WPC A;  3I35 A;  1D1C A;  1QP3 A;  2JMC A;  1X69 A;  3ER0 A;  4DCN C;  2O88 A;  1YWM A;  2YL8 A;  1K76 A;  1IGU A;  1FMV A;  2ROT A;  4PLL A;  4ELZ C;  5GAN 5;  1WI7 A;  1MNE A;  3JCM V;  4B9Q A;  2NUZ A;  3C7N A;  2DIQ A;  3KAW A;  3D7S B;  2FZG B;  2ALW A;  2CZ6 B;  4AFU C;  4LDY A;  3EG0 A;  3T49 A;  5E84 A;  5J26 A;  4DEX A;  2YRV A;  1U5S A;  1ZYL A;  2EQI A;  1E2U A;  3EGD A;  1EIF A;  2D8H A;  2R57 A;  1VQ7 A;  4J9B A;  1K4U S;  3CCL Q;  4JS5 A;  2YUN A;  2N3K A;  1ZUK A;  1Q95 G;  1YIT Q;  5CKB A;  3CME Q;  2F2V A;  1QWN A;  1E7O A;  3V7R A;  2KQW A;  3FRN A;  1U8R A;  1TU0 B;  3A5Z B;  4QT7 A;  2EGA A;  4C5E A;  3X20 B;  5GAN 7;  3HRS A;  4DQ2 A; 
#chains in the Genus database with same CATH homology
 2EGE A;  4J9C A;  2A08 A;  2E5K A;  4AG1 C;  2YI8 A;  4EZN A;  4J9H A;  2LCS A;  4AG2 C;  1Y0M A;  2Z8Y A;  1Z9Q A;  1YNZ A;  2KR3 A;  2RMO A;  2YIV X;  2O9S A;  1H8K A;  1MV0 B;  2J05 A;  1BB9 A;  2KYB A;  4CC2 A;  1E6G A;  5FW9 A;  4UDY X;  2EX3 B;  2HBW A;  2JS0 A;  4WCI A;  2KRO A;  2W0Z A;  4EZS A;  2CDT A;  2HDA A;  1X43 A;  2MIO A;  1I0C A;  1NYF A;  3ULR B;  4J9E A;  1AZG B;  4GLM A;  3EG2 A;  2DIL A;  2FEI A;  3F7W A;  3I04 A;  2JM8 A;  1OPK A;  2ECZ A;  2RT6 A;  2ND1 A;  2JS2 A;  1NYG A;  3KDR A;  4HR1 B;  2BTT A;  3I01 A;  4F16 A;  4ESR A;  3M0T A;  3PVL A;  1NEB A;  1WDX A;  1BBZ A;  3CQT A;  4JJC A;  2SEM A;  4AFZ C;  1DKZ A;  2K3B A;  4KRT A;  2M0Y A;  1AEY A;  5FWB A;  4RTY A;  1RLP C;  1QWE A;  1BK2 A;  2DMO A;  3H41 A;  5IHN A;  4E6R A;  1WXT A;  4JPB W;  2C0T A;  4KIK A;  1OPL A;  1HSQ A;  4RTU A;  2J7I A;  1OAO A;  4CC4 B;  2KT8 A;  4Z88 A;  2LMJ A;  2IIM A;  4EIK A;  1M3C A;  4EZT A;  4R5G A;  2DL7 A;  3O3M B;  3GBQ A;  3VEB A;  2DL4 A;  4H6I A;  4LNP A;  1UFF A;  4F17 A;  4RTV A;  3VS1 A;  1I1J A;  2DL3 A;  1X2K A;  2GNC A;  4AFQ C;  1U06 A;  1G83 A;  1SU8 A;  4ORZ A;  2DL5 A;  4RTZ A;  2A28 A;  1ZUY A;  2J06 A;  2C0O A;  2G6F X;  1ZLM A;  2CSQ A;  2DM1 A;  1VYU A;  3O3N B;  3DPP A;  1JEG A;  3H0H A;  2DA9 A;  2GGR A;  2CT4 A;  1UEC A;  1WXU A;  3JV3 A;  5GJV B;  3O3O B;  2MCN A;  3KFV A;  1SHF A;  3VS0 A;  3NMZ C;  1SRM A;  1UJ0 A;  2EYZ A;  1ZSG A;  4EZX A;  1RUW A;  2EW3 A;  1X27 A;  1W9M A;  2ROL A;  3H0I A;  2RQR A;  1QWF A;  1ABQ A;  1KIK A;  1BU1 A;  1OA1 A;  3LMF A;  2KYM A;  1W1F A;  4D8J A;  2DRK A;  1E9V A;  1NLO C;  4HVU A;  4LUE A;  3PVQ A;  5HCK A;  3T46 A;  3QNJ A;  1WXB A;  4HXJ A;  1TG0 A;  1ZBJ A;  4HCK A;  1SUF A;  2CT3 A;  3LH5 A;  1N5Z A;  1PWT A;  2DRM A;  1YN8 A;  2AKK A;  2K7A A;  4ZNX A;  3I39 X;  2DX1 A;  3GI7 A;  1UDL A;  2L3P A;  1MUZ A;  2YT6 A;  2GA9 D;  3THK A;  3OWG A;  3VS5 A;  4KIK B;  3REA B;  1AWX A;  4E81 A;  1UHC A;  1GCP A;  1QLY A;  3KAV A;  1I07 A;  4EZO A;  3VRZ A;  2AZS A;  4G6Q A;  1M30 A;  4R5K A;  3FD9 A;  3ER8 C;  4IM3 A;  4R5L A;  2A36 A;  1JQK A;  1ZX6 A;  2BZ8 A;  2JTE A;  2WIN M;  2L3Q A;  4LN2 A;  2KEA A;  1X2Q A;  3UIT A;  1JO8 A;  2LJ1 A;  2FPE A;  2LNH B;  1QCF A;  4IWO A;  2KHO A;  1JXO A;  1IO6 A;  4J9G A;  2QXL A;  2JM9 A;  1MV3 A;  4Z8A A;  3QWX X;  2LQW A;  2GAF D;  1OA0 A;  2P4R A;  1M3A A;  3L3O M;  1GNT A;  4EZR A;  1CKA A;  4FM3 A;  3I9Q A;  5I11 A;  2DF6 A;  2YUP A;  4Z89 A;  1JU5 C;  4F00 A;  1ZUU A;  3I5S A;  2HCK A;  5IHI A;  1AZE A;  2A37 A;  4JWI A;  1UHF A;  2LJ3 A;  4Y92 A;  2YUQ A;  2LJ0 A;  3NGP A;  5I22 A;  4H6H A;  2YI9 A;  1B07 A;  2D1X A;  4IWQ A;  1V1C A;  2K6D A;  3PE0 A;  1SHG A;  4R5J A;  4JZ3 A;  5IHK A;  2EYW A;  1KSW A;  4FSS A;  1RLQ C;  4OMO A;  2O9V A;  2ND0 A;  2DBK A;  4UDX X;  2EBP A;  4RUG A;  1G2B A;  3M0Q A;  2H8H A;  3ERC C;  2K2M A;  2FPF A;  1GRI A;  4IIM A;  3VS2 A;  2PNI A;  1GFD A;  1W6X A;  3ER9 B;  2RNA A;  2ESW A;  2QFF A;  1AWO A;  2RQW A;  4RTT A;  1YWP A;  5L23 A;  3TSZ A;  3D2F A;  2HSP A;  4GBQ A;  1H3H A;  1FMK A;  2KXD A;  3VKH A;  2X5C A;  3UF4 A;  4JNF A;  2L3S A;  2OJ2 A;  3TVT A;  2DVJ A;  1H92 A;  4LE9 A;  2YIB A;  1E6H A;  1CSK A;  4IWP A;  3VS4 A;  3U23 A;  2EGC A;  3RV0 A;  1GNL A;  2J6O A;  3SEM A;  3M0U A;  5EC7 A;  1UE9 A;  1YP5 A;  3NHN A;  1M8M A;  2QDL A;  2NCZ A;  1SU6 A;  1AOJ A;  2BZY A;  2YDL A;  4F01 A;  1PKT A;  4CC3 A;  4OMM A;  4AFS C;  1GCQ A;  5FWC A;  2EYX A;  2YUO A;  4F14 A;  1WIE A;  3RBB B;  2KXC A;  2X3W D;  1AWW A;  1FYN A;  3OHX M;  4OMP A;  4CC7 A;  2KRN A;  4DEY A;  1RI9 A;  1UG1 A;  2DJQ A;  3RV1 A;  4JNE A;  2K79 A;  2KGT A;  3EG1 A;  1SEM A;  3D2E A;  1EFN A;  2KRM A;  2RN8 A;  1NEG A;  1UJY A;  2DNU A;  4EZQ A;  3VS7 A;  1KJW A;  2PZ1 A;  1XOV A;  2KBT A;  2OBM A;  2CRE A;  2O2O A;  4D8D A;  3SHW A;  3VEA A;  1OV3 A;  2V1Q A;  1GFC A;  1CKB A;  4HR1 A;  1M27 C;  2AKL A;  4JZ4 A;  1GL5 A;  2LZ6 B;  4RTW A;  3IQL A;  1J3T A;  2SRC A;  1SU7 A;  2JT4 A;  4EZW A;  4HVV A;  2K9G A;  2GTO A;  1B3Q A;  3DPO A;  4OMQ A;  1GBQ A;  1YCS B;  2AK5 A;  4JJB A;  4JWC A;  2J6K A;  1DKY A;  3FJ5 A;  2CSI A;  2YIA A;  3M0S A;  1S1N A;  4R0K A;  1OOT A;  2DYB A;  1Y57 A;  2JXB A;  4HY9 A;  2ED1 A;  2I0N A;  4RTX A;  1T3L A;  2EVR A;  3B52 X;  2L2P A;  3M0P A;  1X6B A;  3VS3 A;  3T4A G;  5FLE X;  4HVW A;  4IIO A;  4K11 A;  3QA8 A;  2JMA A;  2O31 A;  1JXM A;  2V1R A;  3O5Z A;  3ZED A;  4JL9 A;  4M0M A;  2MOX A;  1NLP C;  1K0S A;  5ECA A;  4OMN A;  2EYY A;  3VS6 A;  1WYX A;  2XMF A;  1M3B A;  1T0H A;  2OBL A;  4IM2 A;  1T3S A;  2FPD A;  1PNJ A;  2KRS A;  1MJG A;  1YWO A;  2C0I A;  3UA6 A;  3T47 A;  2LP5 A;  2NWM A;  1VYT A;  1PRL C;  2YSQ A;  1WX6 A;  3R6N A;  4JN4 A;  1KFZ A;  1TUD A;  1AWJ A;  2GTJ A;  4EZZ A;  2J6F A;  1GN9 A;  2OAW A;  2DLP A;  2RQU A;  1K9A A;  2ENM A;  1PHT A;  4X1V A;  2D8J A;  2BZX A;  1X6G A;  1ABO A;  4J9D A;  1Z9Z A;  4JWD A;  4EZV A;  2JNS A;  1PRM C;  1WFW A;  4IM0 A;  2RF0 A;  3EHR A;  1SPK A;  2AZV A;  1UUE A;  2CH4 A;  3TSW A;  2KE9 A;  3C0C A;  2ED0 A;  2FRW A;  2LQN A;  1GCQ C;  4A63 B;  2DL8 A;  2KT1 A;  1T0J A;  1QKX A;  3NPF A;  1K0X A;  5IXF A;  3UAT A;  2FO0 A;  4IW0 A;  1TUC A;  1U3O A;  1VA7 A;  1DKX A;  2RQV A;  3ZL7 C;  3A98 A;  1UPX A;  4JLC A;  2VVK A;  4J9F A;  1GBR A;  1AVZ C;  2B86 A;  1HJD A;  4LUD A;  2CH4 W;  2DE0 X;  4R5I A;  3RNJ A;  5FIG A;  1ARK A;  4JWE A;  2M51 A;  2LM0 A;  5GJW B;  4NPH A;  1SSH A;  2F2W A;  2GBQ A;  2L0A A;  2W10 A;  3EG3 A;  1SRL A;  1WLP B;  1JQQ A;  3B51 X;  1A0N B;  1E1D A;  2EWF A;  3REB B;  1NG2 A;  3I35 A;  2DBM A;  2JMC A;  3EGU A;  2JW4 A;  2KNB B;  2PTK A;  3I5R A;  1X69 A;  4D8K A;  3B53 X;  1VYV A;  2RPN A;  2F2X A;  2O88 A;  1K76 A;  1WA7 A;  2PY6 A;  2ROT A;  3DPQ A;  1UTI A;  1OEB A;  2EPD A;  2GQI A;  4E3C A;  3M0R A;  1WI7 A;  3VRY A;  5IH2 A;  1NM7 A;  1QKW A;  4PO2 A;  2VWF A;  4B9Q A;  2NUZ A;  4M4Z A;  3C7N A;  3QWY A;  3KAW A;  1HD3 A;  4EZP A;  3H0F A;  4AFU C;  1U00 A;  1W70 A;  1AD5 A;  3EG0 A;  3T49 A;  5E84 A;  1UGV A;  4EZU A;  4OML A;  4J9I A;  4DEX A;  1LCK A;  1PKS A;  1U5S A;  1ZYL A;  2EKH A;  2CUD A;  1E2U A;  2EQI A;  2OI3 A;  2FRY A;  2X3X D;  2D8H A;  1K1Z A;  4J9B A;  4HYB A;  1K4U S;  5TKY A;  2VKN A;  2YUN A;  3UA7 A;  2RQT A;  2HEQ A;  3T48 A;  2CUB A;  2N3K A;  1ZUK A;  2FG0 A;  4EZY A;  2ABL A;  4JJD A;  2F2V A;  2D0N A;  1E7O A;  3EHQ A;  5IXB A;  4QT7 A;  2EGA A;  2LX7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...