3A98A

Crystal structure of the complex of the interacting regions of dock2 and elmo1
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
168
structure length
157
Chain Sequence
GMAPWRKADKERHGVAIYNFQGSGAPQLSLQIGDVVRIQETCGDWYRGYLIKHKMLQGIFPKSFIHIKEVIPAEIPLAQEVTTTLWEWGSIWKQLYVASKKERFLQVQSMMYDLMEWRSQLLSGTLPKDELKELKQKVTSKIDYGNKILELDLIVRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dedicator of cytokinesis protein 2
publication title Structural basis of functional complex formation between DOCK2 and ELMO1 for Rac activation in lymphocyte chemotaxis
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 45
structure length 157
sequence length 168
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-10-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.350 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3a98A02
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3a98A01
1K1ZA 3H0HA 3UA6A 4GBQA 3I35A 2J7IA 1NEGA 5EC7A 1MUZA 3M0RA 4LUDA 1SPKA 1H3HA 4J9FA 1VYTA 1RUWA 2BTTA 2KRNA 1K9AA 1NLOC 1BBZA 2FO0A 5FWBA 4CC2A 4Z89A 5L23A 1PKTA 1WLPB 2FRYA 1NEBA 2B86A 3EGUA 1RLQC 1K76A 2JXBA 1UJYA 2CT4A 2AK5A 2C0OA 5FWCA 3M0QA 3PVLA 1QWEA 1VYUA 1UG1A 1YNZA 2DLPA 2F2XA 5FW9A 1H8KA 2K79A 1Z9QA 2LQWA 1CKAA 3KFVA 5IXBA 2BZYA 2KXDA 2K2MA 4J9EA 2C0TA 1N5ZA 1OV3A 1YN8A 1E6GA 2DMOA 1CKBA 1KFZA 4M4ZA 1XOVA 1PKSA 1PWTA 2AZSA 2LMJA 2KEAA 4OMMA 4JJBA 2D8JA 2W0ZA 4AFUC 3THKA 2K9GA 1NG2A 5IHIA 1AOJA 4OMPA 3REBB 1FYNA 3TVTA 2OAWA 2V1RA 3EG2A 2KGTA 2W10A 4D8KA 4JZ4A 1W1FA 1AZEA 1V1CA 3PE0A 3PVQA 4D8DA 1AD5A 2OI3A 2JS2A 2EGAA 1WXUA 4Z8AA 1UGVA 4HVUA 2ED0A 3EHQA 1JXOA 1YWOA 4AG2C 1GFCA 2DBKA 4JJDA 5GJVB 2YT6A 2G6FX 2LCSA 1JU5C 4RTYA 2GBQA 2EGEA 2L3SA 2CDTA 2ED1A 2EPDA 4RTXA 2RNAA 2DM1A 2KXCA 2RQUA 1Y57A 4LN2A 1YP5A 2YUOA 5IHNA 2EBPA 4EIKA 1K0XA 1UFFA 1UHCA 1U3OA 2EGCA 2DL3A 2ENMA 4HVWA 2GQIA 2JTEA 2DNUA 1AWOA 2SRCA 2RQWA 2GTJA 2CUBA 3VS2A 1H92A 4AFSC 1K4US 1VA7A 3LH5A 2CSIA 2J06A 2MOXA 4F14A 1RI9A 4AFZC 2KR3A 4ESRA 1S1NA 1X27A 2L3PA 1T3SA 1UTIA 3C0CA 4J9IA 3M0PA 4R0KA 2C0IA 4GLMA 2EVRA 4J9GA 1SRMA 4RTVA 1ABQA 1PRLC 1QCFA 1A0NB 2FEIA 2LX7A 4QT7A 1GCQA 3FJ5A 2RF0A 2DRKA 2L0AA 2DL5A 1M3AA 1B07A 3TSWA 3IQLA 3NPFA 2DYBA 3NMZC 2KRMA 4F17A 1UECA 3VS3A 1FMKA 4X1VA 3M0TA 4RTTA 3EG1A 4DEXA 3SEMA 3EG0A 1AVZC 2RMOA 1NYGA 4ORZA 2DJQA 2JM9A 2O88A 2GGRA 3VS5A 2D8HA 2YSQA 1M30A 3H0FA 2LJ1A 3H0IA 4JPBW 1M8MA 1KSWA 1PNJA 2EYXA 2JT4A 3SHWA 1JO8A 3VS4A 1OPKA 3NGPA 1B3QA 2D1XA 1SSHA 2CH4W 2EYZA 2PNIA 2K7AA 4J9HA 2DF6A 1NM7A 1GBQA 2LJ3A 4LUEA 2SEMA 3R6NA 4OMNA 1E6HA 1PHTA 1UDLA 1HSQA 4FSSA 4LNPA 1QLYA 1LCKA 4DEYA 2A28A 2L2PA 4CC4B 2KNBB 2FRWA 2KROA 2X3XD 1UE9A 1WFWA 4E6RA 2YDLA 2CSQA 1W6XA 1TG0A 2NWMA 1JEGA 1G83A 3M0SA 4CC7A 2KBTA 5IXFA 2DL8A 2EQIA 1SHFA 4RTWA 4KRTA 2DVJA 2HBWA 1OPLA 4LE9A 1YCSB 1OEBA 4J9CA 5ECAA 4OMOA 1YWPA 1ZUYA 1VYVA 2YUPA 2K3BA 3UF4A 4RUGA 2E5KA 5I22A 2JW4A 3EHRA 4IIOA 4Y92A 1PRMC 3GBQA 2HEQA 2LP5A 1X6GA 4OMLA 2P4RA 2J6FA 2KE9A 1NLPC 4J9BA 2FPFA 2J6OA 4J9DA 1I0CA 2EYWA 4JZ3A 1Y0MA 2DBMA 1I07A 1WDXA 1X6BA 4OMQA 4ZNXA 2HCKA 1GRIA 2DRMA 3I9QA 1T3LA 2V1QA 1M3BA 2FG0A 2RQRA 2JM8A 1WA7A 2M51A 2BZXA 2BZ8A 1BK2A 1IO6A 2DE0X 1GL5A 2PTKA 2CH4A 2O2OA 2RQTA 3TSZA 1J3TA 2GNCA 4F16A 1Z9ZA 1AZGB 1QKXA 1X69A 1HJDA 1AWJA 3H41A 1U5SA 4HCKA 5I11A 1MV0B 1BU1A 2ECZA 3I5SA 2K6DA 3CQTA 1T0HA 5GJWB 2IIMA 4Z88A 1X2KA 1QKWA 3JV3A 3RNJA 1QWFA 4RTZA 1AWXA 1I1JA 2JS0A 4K11A 4IIMA 1W70A 3O5ZA 1X43A 2ESWA 3A98A 5IHKA 4CC3A 2CT3A 2KT1A 2I0NA 1CSKA 4JJCA 3U23A 1HD3A 2QDLA 2A36A 2DA9A 1SRLA 2HSPA 2LJ0A 4HVVA 3EG3A 1WI7A 2F2WA 5IH2A 1TUCA 2H8HA 1AWWA 3ZL7C 2KRSA 2J05A 2J6KA 2XMFA 2A08A 1WXBA 1TUDA 2O9VA 2LNHB 2VKNA 2ABLA 3REAB 2FPEA 3VS0A 2VVKA 3QWYA 2O9SA 1WIEA 1GBRA 2KYBA 1JXMA 1ABOA 2DL7A 2O31A 3VS7A 2RPNA 2ROTA 2YUNA 1MV3A 3NHNA 1SEMA 3RBBB 2EW3A 2MCNA 1UUEA 1K0SA 2YUQA 3VRYA 1M27C 2EKHA 3ULRB 1ARKA 4AFQC 1GCPA 1RLPC 1ZBJA 2A37A 4AG1C 4RTUA 1ZSGA 2D0NA 2RQVA 5HCKA 1OOTA 4WCIA 3VRZA 2CREA 1JQQA 1ZLMA 1ZUKA 1BB9A 2DX1A 2ROLA 1ZX6A 2AKKA 1G2BA 3UATA 1T0JA 4A63B 2EYYA 2AKLA 2KT8A 1WYXA 1M3CA 1GCQC 2RN8A 2L3QA 1EFNA 2HDAA 1WXTA 1NYFA 2MIOA 2M0YA 1AEYA 2GTOA 2JMCA 2CUDA 2FPDA 2NUZA 4HXJA 1ZUUA 1SHGA 2LZ6B 1KIKA 3I5RA 1E7OA 1KJWA 2KYMA 3VS1A 1UHFA 2VWFA 3QWXX 1X2QA 3VS6A 2LQNA 2AZVA 2F2VA 2DILA 3M0UA 1UJ0A 1WX6A 1GFDA 2X3WD 2DL4A 2OJ2A 1U06A 2JMAA 2PZ1A 3UA7A
chains in the Genus database with same CATH superfamily
2JNSA 3H0HA 2MWOA 3M3WA 4M7DE 1UGQB 3HAHA 2YIBA 3SWNC 4JJNK 4LUDA 1H3HA 2DERA 1RUWA 5C6SA 1IZ6A 4R5IA 3S6WA 5L23A 4X9CA 2EQKA 1WNLA 1VQOT 3E19A 1NPPA 4F7UB 1RLQC 1K76A 2K5FA 3D4YA 4A4EA 2JXBA 3GOXA 4H6IA 4BDYA 2CT4A 2PVOB 3I55T 2AK5A 2EWFA 1M1GA 1YI2Q 3PVLA 3DYTA 1YNZA 2ELBA 1H8KA 3P8DA 3CC7T 3S3OA 2EQUA 1YN8A 3P8HA 3LMFA 3HP9A 3CXCP 1O9SA 1KFZA 3CCLT 3QNJA 3I56T 1PWTA 1VQMQ 1KC8C 4A53A 4RG8A 4JJBA 2ZXQA 3A8MB 3THKA 5A0GA 4PJOD 1NG2A 1N8RU 2YL5A 2EJ9A 5IHIA 3B52X 2PU9B 3TVTA 2OAWA 3QSUA 4QW2A 2RA2A 3CPWS 2KGTA 1PSEA 4JZ4A 2CP2A 4NPHA 2OI3A 2JS2A 3DLMA 1YBYA 4Z8AA 4HVUA 3LX7A 1HXKA 4PNOA 4QVZA 4M7AB 2YL9A 5GAN3 5GJVB 2Z8YA 2KHOA 1OU9A 4NS5A 2EPDA 3EGDB 5CKBA 1Y57A 1YHQT 2LNVA 1C0MA 2K5IA 2YUOA 2ZAEA 4A54A 4ZGJB 4EIKA 1UHCA 3M59A 2HKNA 4BE2A 1U3OA 1Q86C 2EGCA 2DL3A 4HVWA 1M4ZA 3DB3A 2KY9A 2E10A 4QQDA 1N6AA 4XU0A 1RI0A 1LVKA 1OU8A 3OYKA 2XD0A 2CUBA 2DZCA 5CKDA 2ZPHB 4DA4A 2DK3A 3UT1A 2J06A 3OYFA 1RI9A 5GANf 2KR3A 3T4AG 4ESRA 1X27A 4JRKA 3C0CA 4EZPA 4R0KA 4J9GA 2ALWA 4JRPA 1ABQA 3CMAT 1UGRB 2R57A 3I2WA 1D0ZA 2V0OA 2ND0A 2L0AA 2RHZA 3L2RA 5GAN6 2FICA 1G5VA 2DL5A 1S72Q 1B07A 2F7QA 4IURA 3NPFA 1ZA2B 4GY5A 4F17A 2GF7A 3VS3A 3SOGA 2QTXA 1YJ9A 3META 4WF2A 4C92B 3M0TA 3DLLA 3X28B 4LDXA 4FM4B 2Z0WA 1VQ5T 1YHQQ 4HCBA 2GGRA 1LOJA 1X75C 4M75D 1YIJT 5GMKl 1ZSZB 2LJ1A 3VV0A 3WVEB 4JPBW 1KSWA 2BE7D 2JT4A 2LQKA 3BUDA 1SUFA 3D2FA 3VS4A 2QQBA 4C92F 1PM3A 4O5VA 3KAVA 1VIEA 2D1XA 2NUTA 3OYGA 1SSHA 4LD6A 5GANg 4LXCA 3O3OB 3F70A 4MDXA 3QG1A 2RD1A 4ME7A 4OF1A 4HR1A 1VQ4T 1VQLT 2DF6A 1M5Q1 2HQEA 4ZGEB 2SEMA 4C0FA 1PD0A 1H641 3M55A 1U1TA 3CCUT 4M77G 4J6YA 1KQSP 2GQVA 4FSSA 1YI2A 3A5ZB 2L2PA 4CC4B 4PJOG 3L2QA 1YWMA 1UE9A 1WFWA 3GNFB 4E6RA 3ZEDA 4PJNA 3LWIA 4WPEA 2EWNA 1TG0A 3QDRB 4DOWA 3CPWA 1G83A 1EZZB 1I5LA 2F18A 3NFCA 1QMCA 4HCZA 2YL8A 2DTHA 1SHFA 2DVJA 4C92A 1YCSB 4J9CA 1Q81U 1VQMA 1SU7A 3Q84A 3CEYA 3OYBA 4JWEA 1ZSZA 2N3KA 4OB0B 2BIVA 2JNKA 2X5CA 2HBPA 3EFRA 4IIOA 3GBQA 2LP5A 1X6GA 3GF5A 2P4RA 2KE9A 1NLPC 1KD1R 2F1LA 3OYJA 2OBLA 3OS5A 4J9DA 4OGCA 2E6NA 5GMKi 1I0CA 3MEWA 3EG9B 1JB0E 1X01A 2XDBA 3L3OM 3ER9B 1HYOA 1ZYLA 1WDXA 3HRSA 5KYUB 3CCUQ 4ZNXA 4E7LA 3VKIA 3CVRA 2CP3A 1BI0A 2V1QA 1M3BA 1OULA 4E7ZA 3CC4A 1WJRA 1G3YA 4JRQA 2MI6A 5A0LA 1GL5A 3LLLA 2D1LA 1X6OA 2O2OA 2RQTA 1IXDA 2M02A 2DETA 1Z9ZA 2GAFD 4PFOA 3H8ZA 2E41A 1VQ7Q 1U5SA 1M9SA 3VYGA 4C0ZA 3CQTA 2Y90A 2FHDA 4MMKA 2HL3A 2XK0A 1K8AU 4PLLA 5I2MA 2IIMA 4BI4A 1QKWA 2E12A 2RO0A 4JLGA 2LDMA 1WDZA 3CXCA 4WTOB 3OYDA 1HWWA 2C08A 1DKXA 1RABB 3B53X 1WJSA 4CC3A 2CT3A 3E9GA 4OB2B 2K57A 4M78F 3J80E 1Q82U 2A36A 4M75G 4D8JA 1VQ6Q 1LPLA 1WI7A 2DIQA 3MP1A 1AWWA 2XHCA 4FU6A 4AZ5A 2KRSA 2J6KA 2X3WA 3MP8A 4JWIA 4M7DF 5CR2A 1MMGA 2KDSA 3EG9A 4IWOA 2XDPA 1W4SA 3QBYA 2LNHB 2FPEA 3EJUA 3CCJA 3EJTA 1JJ2P 4EZWA 4FW1A 2LVMA 5GAN5 3H6ZA 1BI1A 4C8QB 2YRCA 4C92C 2ZPBB 2EX3B 3VS7A 3D4ZA 3T49A 2ROTA 1O75A 2QYZA 1GXIE 1MV3A 5IT9E 1ZSZC 1D3BB 1MNEA 2OTJQ 3GI7A 2QA4T 4M78A 3OWGA 4FT4A 4BACA 3OA6A 2Z0VA 2QFFA 3JB9D 3CCRQ 4EPCA 4M7DA 3PMIA 4FYXB 2GA9D 3VRZA 2MYSA 1JQQA 3CBMA 2DX1A 2ROLA 1IHVA 1K9MC 4N4HA 4HA8A 4J7FA 3UATA 3L2ZA 4C0GA 2KT8A 3DPQA 1XTDA 2V8IA 2L3QA 1P92A 3CCMA 5FROA 1WXTA 1NYFA 2M0YA 1AEYA 4JLIA 2QQRA 2JMCA 4XTUA 2CUDA 2E1HA 2V8KA 2FPDA 5GMKj 3BW1A 3X25B 2LZ6B 2E5QA 2IPOB 4NSWA 5I21A 1E7OA 3LWHA 3BLBA 3V8LA 1UHFA 1WQ7A 2BE9B 2Z0OA 2MF2A 3VS6A 4AZCB 2RH2A 2VC8A 1XNIA 2DXBA 1ACMB 2QEXT 4XU3A 1SKUB 5LJ3j 3UA7A 2EYQA 5CK9A 3OYMA 2QKWA 1BKBA 3I35A 2J7IA 5CCAA 3JCMW 1TS9A 5FU7B 5EC7A 1MUZA 3M0RA 1I5OB 4M77E 2OAUA 1SPKA 1VYTA 4BD3A 4AZHA 5IAYA 5FRMA 3TU4K 3CCVA 3RPMA 1BBZA 4Z89A 2HQHA 2VGNA 3G6EA 2O01E 1WLPB 5KYWA 4II1A 3FC3A 2B86A 1I4DA 2O0I1 2ZPFB 2WINM 1Q7YU 1KQSA 4KIKB 1QWEA 2RAIA 1VYUA 2DLPA 2F2XA 2X4WA 1VQ7A 2HD0A 3JCMf 2BZYA 2XG8D 5GAMe 2KXDA 2K2MA 1WHLA 1FX7A 2HKQB 4QKUA 2F5TX 1E6GA 4PJMA 4Q5WA 2DMOA 1C1AA 1YJ9T 1N27A 4M4ZA 3CV5A 3FLGA 3GP8A 1M1KC 2AHJB 2LMJA 1N8RR 2JTFA 3PTAA 2D8JA 1MMDA 2W0ZA 2CZ0B 1O7DC 3PMTA 3HSBA 2P0PA 5HK3A 1VQ6A 1KG1A 2YI9A 3QYHB 3CCEA 4FYVB 1RL2A 3PE0A 2DVEA 3MEVA 4D8DA 5FLEX 2HQXA 4IUTA 4ZTFA 1WXUA 5KYXA 2FVUA 3I01A 2ED0A 2P0KA 1JXOA 1YWOA 2QQSA 1GFCA 4JJDA 2L8DA 4KUIA 2YT6A 4AZGA 4PK4A 2H3JA 2EGEA 4Y91A 3D50A 3RESA 2ED1A 1SU6A 4IKFA 1D1CA 4BE1A 1KQ2A 2GFUA 2RQUA 2KXCA 4JNEA 2ZPIB 3CPWP 3JB9G 1WGSA 3JCMg 1TQUA 2L3RA 1UFFA 2EIFA 4ATOA 3BUIA 4BUGA 1YI2T 4R55A 2DAQA 2DNUA 1AWOA 2OTJA 1Y7XA 3C94A 2RQWA 4KH0B 4IUPA 3VS2A 3ME9A 4AFSC 5KCOA 1K4US 3LH5A 3CCRA 1IREB 3KBGA 1BIAA 3G1JA 2P0QA 2EFIA 4J7IA 1VQKQ 1VQMT 1T3SA 5GAN2 4M75E 4GLMA 4LDYA 1SRMA 1YITQ 3QZ9B 1WQWA 4XAXB 2KK4A 1R0BG 2F69A 4X34A 1PRLC 1KC8U 1H3ZA 3CD6A 2LX7A 1GCQA 3FJ5A 2RF0A 1V76A 4QQ6A 5CQXA 4PJJA 3J81E 1M3AA 4N4IA 3TSWA 5D6XA 2DYBA 3CZNA 3JCMJ 2KRMA 3QE6A 4OMFB 2WSCE 5HY6A 2QXFA 2FL7A 3INZA 3A1PA 3BVTA 3JCMV 4HT8A 1K73C 4ELZC 4RTTA 1TQTA 3ZFJA 4DEXA 3PT9A 1NYGA 2EQMA 4ORZA 2DJQA 2JM9A 2V8JA 2KVQG 3FEOA 5AYFA 5GAMh 4PFZA 2CP7A 1IB8A 1JJ2A 1M8MA 2EYXA 3SHWA 2QDYB 2D0QB 3JCMX 4A4FA 2KQWA 1M90C 1VQ9Q 1B3QA 1GN9A 3L2UA 2LXYA 2PNIA 1Q86U 2OZNB 3DX4A 5GMKm 4XTXA 3CKDA 4C92D 1QVPA 3J7AF 3M4YA 5GAMd 1R5EA 1QP2A 3MO8A 3M58A 1V29B 1ZA1B 1VUBA 4OMNA 5FU7C 2XIDA 4JL9A 1PHTA 1HSQA 2DIGA 5FLXE 2Z0NA 1YCYA 2E6ZA 3QO3A 4KGXB 1KHIA 1Y96A 4DEYA 2A28A 3E2UA 2KNBB 3KAWA 4F7UG 1S72T 2CSQA 1QVFA 1W6XA 2NWMA 4CC7A 1I81A 1Q81R 3R6OA 1RAFB 2DL8A 4HYBA 4RTWA 2DXCA 1MGQA 2RT6A 1Q95G 3DB4A 2RI2A 1YWPA 2Y4YA 1VYVA 1QVGS 2K3BA 1R8OB 3HL8A 1M2VA 1I8FA 2E5KA 4RCCA 3CC4Q 5LJ3f 3OBWA 2NYSA 2NUTB 3LYIA 3B51X 4BDZA 2E65A 2X3XA 1I49A 2CP6A 4HR1B 4J9BA 2K4YA 4AZIA 2FPFA 3LLRA 1TOVA 2ZZDA 1Y0MA 1I07A 3NTKA 3KUFA 5D7UA 4M7AG 1IRXA 1QWUA 4XK8E 4C5GA 3CCSQ 3CMEA 2I2LA 4DOVA 2EFLA 3D2EA 1WA7A 2RHIA 2M51A 2BZ8A 3E9FA 2DXUA 2F1AA 1IO6A 3T48A 4LDUA 1NJIC 3QJYA 2GNCA 5HKCA 3FD9A 4F16A 5CQYA 1K8AR 4HCKA 2AT1B 1BU1A 1X03A 2ECZA 1MNDA 4N4GA 4B9QA 3WVDB 5LJ3g 1XQHA 3CCJQ 4OVAA 3DX1A 4AZ7A 2VB6A 1VQKA 4RTZA 3E1SA 1AWXA 2V26A 1YITA 5GAOl 4IIMA 4R5GA 1Q82R 2KI7A 3O5ZA 1X43A 5E84A 4F04B 3JB9J 2EAYA 4B9XA 1CSKA 2E3HA 2HSEB 3UITA 4HY9A 3OHXM 4XTWA 3EFOB 3ER8C 3V7CA 3JCMb 2DYIA 3HAIA 3MP6A 3C7NA 2A0FB 2MI7A 4M77F 3VUBA 3DX2A 3FRNA 3RERA 2K5LA 1SF9A 2JZ2A 3C95A 7AT1B 2A7YA 2ABLA 2FYVA 2X3VA 1LNXA 2JVVA 4PJOF 2FZGB 4B6MA 4EZTA 3HAJA 1SG5A 2O9SA 1GBRA 1BI3A 4WPCA 3G71Q 3M9QA 4L59A 1ABOA 1OQKA 2O31A 2RPNA 1VQ9A 3CC2Q 4JWDA 2YUNA 1OA1A 3T47A 5CAIA 3HTRA 3CCMQ 2WYIA 1MHNA 2YLBA 1OZ2A 1VQ7T 2M16A 3OW2S 4EZRA 1JQKA 5GAN4 2QG9B 4AFQC 4FYYB 4AZBA 1GCPA 2DZ9A 2PVGB 4MMLA 2R5MA 1ZBJA 2A37A 1AHJB 2RQVA 1OOTA 3SDZA 4M77A 1UGPB 4KGVB 4C8QD 2NUPA 3QKJA 4R5LA 4R56A 4EMKA 2AKKA 5KBPA 3D52A 3L3PA 3EFOA 1T0JA 3RDVA 1VQ6T 4A63B 4PJOA 2CP0A 2QQAA 1PC0A 2VYTA 3O3MB 2LCCA 3RUXA 2NCZA 2MMPA 2HDAA 1R33A 2IG0A 1DJ7B 4OB1B 4AT1B 5DY9A 2NUZA 4HXJA 5AT1B 1TWBA 2P4TA 5L8RE 1ZUUA 3CCVQ 1SHGA 4UDYX 2X35A 2F7RA 2BUDA 3PGGA 4PLIA 3X20B 3G6EQ 4R5KA 3VS1A 2VWFA 2RK2A 2COYA 3O8VA 5HK0A 2DILA 3M0UA 1M1KR 1GFDA 1VQOA 3AHUA 1JRIA 3CAZA 5A0DA 1M8VA 3JB9H 5GAMf 1U06A 4M78B 1O7DB 2RM4A 3UA6A 2OTJT 3CC7A 4BE0A 2JUFA 3M57A 4A4GA 1TXQA 4M7DB 4M75F 3CCSA 4J9FA 3ZBDA 3CCRT 2KRNA 2FYKA 4CC2A 3I56A 1Q7YR 4O6JA 4F7UE 2FRYA 1NEBA 1B34B 3PFSA 3BUQA 2C06A 4FW2A 1R34A 2OW6A 3CCEQ 2C0OA 3CD6T 1TUGB 1K9MU 4OP0A 3M0QA 5CKHA 3KFVA 2K79A 1Z9QA 4N0AA 1QX1A 1UPXA 4PO2A 1KQ1A 5CKEA 4AVMA 2YRVA 1FXXA 3JRZA 4D6WA 1KK7A 1JBMA 4BY6B 1CKBA 5A2QE 1XOVA 1PKSA 3TREA 4XTZA 4EDUA 5GAMg 1VQPQ 2K9GA 3EAEA 3QUIA 1AOJA 4OMPA 4EZUA 3REBB 4V2SA 4JS5A 2RJDA 3EG2A 4M75A 2ZPGB 2W10A 2YHTA 4D8KA 4M77C 1AZEA 1V1CA 3C4SA 5LJ5e 4M7AE 4EMKC 2DJZA 4XTVA 3EHQA 4VUBA 4AG2C 5FIGA 2DBKA 3CCQQ 1F1BB 2QTVA 1UGSB 3BVWA 4QVCA 2LCSA 3BDLA 4RTYA 2DKGA 1U00A 5KYWB 1W2BS 3RKXA 1QVFP 1KHCA 3G7ZA 1B34A 3G71A 4RTXA 4PFPA 4MDWA 3CD6Q 4LN2A 1YP5A 2DD4A 2EBPA 3CC2A 1TQSA 3CMAA 4YTLA 2ENMA 4C8QG 2RJEA 1R77A 2GFAA 3QNIA 2NLUA 2SRCA 2GTJA 1G3TA 3CPFA 1HTYA 1VIFA 9ATCB 3QHSA 1H92A 2RHUA 1DKYA 1VA7A 2L5QA 1WHMA 3M54A 3EJRA 2MOXA 4F14A 4NQIA 3L2VA 1Y07A 2VGMA 1UTIA 2ZPEB 4J9IA 3M0PA 2WYHA 2XDDA 1KC8R 2C0IA 2EVRA 5LL6S 1RADB 1M1KU 2YIAA 1RAGB 1D0XA 1RAIB 1A0NB 4JNFA 2QI2A 2FEIA 4C5EA 2DRKA 2LTOA 1OYXA 1GNLA 5KYXB 4J6WA 1WJQA 3IQLA 3QJ6A 1PS3A 2PY6A 3Q1JA 1FMKA 2CZ6B 4EMGA 4RCBA 5GANh 4X1VA 4PJOE 3EG1A 1OZ3A 3SEMA 3EG0A 2KAFA 2YXYA 2RMOA 2Y4XA 3VS5A 4EZQA 2EKOA 2YSQA 4FYWB 1M30A 3H0FA 5CKFA 1IGUA 1WZOA 3H0IA 3JB9I 1PNJA 2E64A 2R5AA 1JO8A 4DBRA 4F00A 1Q86R 3QA8A 1KD1C 2RI5A 4JRIA 2CH4W 2GF4A 2VXFA 1QW1A 3GLXA 3D7SB 4BI8B 5KYYA 2JJ9A 3OB9A 3DPPA 2K7AA 4J9HA 3V8JA 3HKSA 1NM7A 3JAME 1GBQA 4RG2A 2LJ3A 4M78C 5C5BA 4XU1A 1WHKA 1VQKT 1YITT 2X51A 4RMOA 5LJ5h 4E47A 3EH1A 4M7DC 3NTIA 4LNPA 1QLYA 1LCKA 2KROA 2X3XD 2YDLA 3MJXA 3PLTA 5GAOp 3VJPA 2QASA 1JEGA 4XU2A 3M0SA 2KBTA 3SB2A 4OGEA 1OAOA 4H8SA 3JB9F 2COZA 2EQIA 1OX9A 4KRTA 4LE9A 1OPLA 3VKHA 3EGXA 1WHHA 3M56A 1YJWQ 5ECAA 4OMOA 2YWWA 2E4HA 3CMEQ 5LJ5d 2YUPA 1YJNQ 1VQPA 3BVXA 1K73U 1PD1A 1IHWA 4PJLA 3FB9A 5GAN8 5IN1A 3EHRA 4BY6C 4Y92A 2LT1A 4ZGDB 4OMLA 4IWPA 3RMSA 3BDUA 2F7OA 2J6FA 2DTIA 3UWNA 1EIFA 1VQ9T 1Y2OA 4BI3A 4NL2A 2E3IA 2RAKA 3H9NA 4LDWA 3UDCA 2D9TA 2J6OA 3PIPA 5I2SA 1M90U 3CCQA 2EYWA 4JZ3A 3T46A 1I4LA 3V7RA 4BNEA 4EZOA 1GRIA 3OMCA 2DRMA 3I9QA 5KYNA 4L6V5 3RV1A 2RQRA 4NOYA 4HCCA 1Y96B 2BZXA 1PG5B 5KCHA 3OS2A 1RACB 3EJPA 3MEAA 3QIIA 2PTKA 2JNGA 1MMNA 2FB7A 3P8BB 1E9VA 1X04A 2M1HA 5EG2A 1AZGB 1ZQ1A 1X69A 4JS4A 5I11A 3G4SQ 3F7WA 1MV0B 3I5SA 4FL6A 2K6DA 1PSFA 2X4JA 3TEEA 3N5BB 1WPYA 1M2VB 3HFOA 1X2KA 4A4HA 3JV3A 3OY9A 3RNJA 1QWFA 2WACA 3CC4T 3OSSC 1W70A 2ESWA 3VU3C 1M1FA 1N9SA 2DEQA 4KGZB 2KT1A 3U23A 4JJCA 2VXEA 1WHGA 3DX3A 3BVVA 2DD5A 3M53A 2HSPA 2O4XB 4MZMA 5CVIA 3EG3A 2F2WA 3ERCC 4C5IA 1VQ8Q 2ZGWA 3ZL7C 5GAMj 1D1BA 2A08A 4ZTJA 5GAOm 1WXBA 1QCNA 2DXTA 3OYNA 2K3XA 2O9VA 3AT1B 2QA4A 4AKVA 4TVRA 2LT4A 4J6XA 1VQNQ 3VS0A 3QWYA 4F7UF 2ZCFB 2OTLQ 3CCST 2RK1A 4M77D 4C8QE 3KDRA 4KH1B 3BE3A 5CIUA 3CZSA 1JXMA 2F5KA 4P5NA 2XI9A 3A8LB 2PUOB 1VOMA 4C0DB 1E2UA 2QXLA 4JUVA 2OW7A 3QYGB 3A8OB 1SEMA 3FDRA 1BIBA 2MCNA 2LC4A 2QGGA 1NJIU 5CO7A 3VYHB 2YUQA 3OS1A 3BUBA 4QQGA 2EJFA 4FIBA 2EKHA 3ULRB 3CCJT 4A4KA 1ZWWA 3JCMe 4RTUA 1QQJA 5KE3A 2COWA 3ZEHA 1VQOQ 2AIRB 1ZLMA 1BB9A 3SYVA 2QEXA 3I55Q 2O4XA 3OW2P 2EYYA 4F7UA 3OYLA 4M7AF 1BYMA 1I4TA 2PMRA 1GCQC 3CC7Q 2RN8A 1G3SA 1EFNA 2RI3A 3GNGA 2MIOA 3JCMc 4DBFA 1I4K1 4MZPA 1YJWA 3MCAB 1YJNA 1ZHIA 3CCLQ 1IGQA 4KT0E 3I56Q 1N8RC 4E2FB 1KJWA 2KYMA 2MK5A 2DFUA 1X2QA 1FWZA 4E7KA 3OYEA 3M5AA 2LQNA 3JCMP 4B9WA 5DLQE 2F2VA 3NTHA 2EQJA 1UJ0A 1WX6A 3G71T 1D0YA 2X3WD 3CC2T 2OJ2A 6AT1B 3OQ5A 1NZ9A 2JMAA 1TQWA 1WHJA 3CCMT 4ATMA 1K1ZA 3OK8A 4GBQA 3X24B 4LDVA 1NEGA 3MHXA 2HMAA 3EFSA 3HPWA 4Y28E 3URGA 2PVDB 1W9MA 4DCNC 4LD9K 4M77B 1BI2A 2CP5A 4EZVA 4M7AA 2NUPB 2BTTA 1K9AA 1NLOC 3CXCS 4EZNA 2FO0A 5FWBA 4EMKB 1PKTA 5J39A 4ZN3A 2QQ9A 3ACOA 1BCOA 4PJOB 3EGUA 4Z02A 1K9MR 3EGDA 4UDXX 1UJYA 5FWCA 4M78D 5LJ5f 2EJGA 2YI8A 1UG1A 5FW9A 5IXBA 2LQWA 1CKAA 3G4SA 4E81A 4RKUE 2ND1A 4IW0A 3ABHA 4J9EA 2C0TA 1N5ZA 1OV3A 4IM2A 4M7DD 4JDSA 4C92G 3DDGA 4EZSA 3KXTA 1N9RA 3CCVT 4FT2A 3LGLA 3T9NA 2AZSA 4OMMA 2KEAA 3G6ET 4AFUC 2RHXA 1G3WA 1LJOA 5GAOq 1AT1B 3SFMA 3CMAQ 2LQ8A 1FYNA 4R5JA 2V1RA 2GCXA 1UB4A 4EZYA 1VQ8A 3JCMQ 3JCMh 3DDFA 1W1FA 3PVQA 3HFNA 1AD5A 4AMCA 2EGAA 4HKEA 2RAJA 1UGVA 2M9UA 2VASA 1TU0B 2LRQA 1VQNA 2RB6A 4NL3A 2OX7A 2G6FX 4C5HA 1JU5C 2OTLA 1QVGA 1VQ5Q 1B7TA 2GBQA 4X9DA 4IM0A 3RR6A 2L3SA 5KE2A 2CDTA 2JOYA 1YIJQ 5LJ5g 2RNAA 2DM1A 2KMTA 5IHNA 3CCET 1K0XA 3JCMd 2PQWA 3PNWC 3JSCA 2GQIA 4E7JA 2XICA 2JTEA 2DPPB 4FZPA 4IUUA 8AT1B 3ER0A 4XTYA 2B8AA 1VQLQ 1VQ4Q 2R58A 4C0DC 4IUQA 1QWNA 2D4CA 1W2BP 1MMAA 3A8GB 2CSIA 5GMKe 4AFZC 1HK9A 3L2WA 1S1NA 2YLAA 2L3PA 3OBYA 1R0CB 2D6FA 2G3RA 2XKOC 2HZYA 1VQPT 4RTVA 1LQ7A 4M75B 4FZSA 1QCFA 3I55A 3LGFA 4QT7A 1C6VX 4UC4A 2WSEE 4M7AC 2JN0A 2K2VA 5D6WA 1RAHB 2CS7A 4E7HA 1FMWA 5LJ3e 1BCMA 3NMZC 2RHYA 5GAOn 4KBMB 1Y71A 2LX9A 1UECA 1Q81C 3OMGA 3V8KA 5GAN7 3CCQT 1UEBA 3CCLA 4L5GA 1AVZC 2O88A 2D8HA 3CBPA 2CGHA 5GANe 5C0MA 2H3EB 3MKDA 1OA0A 3EH2A 2QGFB 2L89A 4F01A 4EZXA 4CRIA 3D51A 1OPKA 3EJQA 3NGPA 2PUKB 1KQSS 3OS0A 2Q13A 2EYZA 4QVDA 1S72A 5KH6A 5J3BA 4J5YA 4M78G 2IVWA 3OYCA 2HL5C 5M9OA 4ELYC 2LCLA 4BB7A 4KUDK 4LUEA 1G8XA 2CYZB 5KYUA 4M7DG 3R6NA 1YHQA 1E6HA 1UDLA 3RKWA 2YIVX 1FMVA 2MAMA 1NE8A 3DPOA 4CI0C 5DM7R 2FRWA 4PKCC 1K8AC 2CZ1B 3OW2A 4PJOC 2P84A 5IXFA 1PCXA 2X4YA 3OSVA 3GIBA 2HBWA 3BY7A 5J26A 1OEBA 1K73R 4C8QF 2VV5A 1ZUYA 4FSXA 4EZZA 2RJFA 3C12A 4RUGA 3UF4A 1Q82C 3RV0A 5I22A 3QPHA 2F1BA 1NBEB 5FU6B 1ZBXA 3VEBA 2JW4A 3VEAA 1TH7A 1MJGA 2VUBA 1PRMC 2K3YA 2HEQA 4EMHA 4E3CA 2QK0A 3HHTB 5GMKh 3SWNB 2DEUA 5KYYB 1M90R 3FIFA 1M2OA 3V7SA 2YLLA 1YFNA 1KD1U 3RIRA 4IWQA 5C5BB 2KSSA 3MEUA 3ASKA 2DBMA 4ANJA 2YRDA 1VQ5A 1X6BA 4OMQA 4DBQA 3OYYA 2MPXC 2JTMA 1YIJA 2HCKA 5LJ3h 2X9HA 1T3LA 3I39X 3QWEA 2DO3A 2FG0A 2JM8A 3M4GA 1SU8A 4FZOA 1NPRA 3RKYA 4JWCA 1BK2A 2DE0X 2CH4A 4ZN1A 3TSZA 4C8QA 1J3TA 1URUA 5TKYA 1SSFA 3L42A 4C92E 4FM3A 4G6QA 1QKXA 4E7SA 1HJDA 4DBHA 1AWJA 3H41A 1VQLA 1VQ4A 3EGXB 2QA4Q 4JN4A 3LVTA 3MPUB 4N0AC 1QCOA 1OX8A 3HRUA 1QP3A 1D3BA 1T0HA 5GJWB 4Z88A 5LJ3d 5GAOr 1U1SA 4I1QA 1YJWT 1XJWB 4JLCA 1I1JA 3CMET 3VUZA 2JS0A 3X26B 1YJNT 1HXDA 4K11A 3CCUA 2X4XA 3A8HB 3BFMA 3A98A 1GNTA 1DKZA 1D09B 5IHKA 2I0NA 1JJ2S 1HD3A 5GANj 3QZ5B 2QDLA 3CBOA 2FZKB 3TQ7P 2DA9A 3SWNA 2YL6A 1SRLA 5GANd 2LJ0A 4HVVA 3G9GA 5IH2A 3HRTA 1TUCA 2H8HA 4HT9A 4M75C 2J05A 3OYAA 2XMFA 4IUVA 4J8OA 3TCJA 3S3NA 1TUDA 3I04A 4J83A 4H6HA 2VKNA 2YLCA 3REAB 3WXMB 4AZ6A 3EJSA 5FRNA 2E70A 4M0MA 2A3LA 1D1AA 3PIOA 2VVKA 3FJPA 2BKDN 1TQVA 2EFKA 1E1DA 1WIEA 4XQ3A 2ATCB 2M0OA 2KYBA 2QEXQ 2DL7A 4AZCA 2CKKA 1EX4A 2Q12A 3O3NB 4IM3A 1NJIR 2OO2A 3NHNA 1RAEB 2LM0A 3Q0KA 1QVFS 3RBBB 2EW3A 5LJ5j 1UUEA 1K0SA 3DKMA 3G4ST 3VRYA 2HAXA 1M27C 4KULA 4FCYA 1ARKA 3LH0A 2F7PA 2HNIA 1RLPC 3SD4A 4AG1C 1W2BA 2WSFE 1ZSGA 2D0NA 1Q7YC 5HCKA 4WCIA 2CREA 3L1AA 3QDFA 8ATCB 1ZUKA 2OBMA 1ZX6A 3GPLA 4OB3B 1G2BA 2XU8A 3S3MA 1TTHB 2MWPA 4MZTA 3OYIA 2AKLA 3OYHA 1WYXA 2FZCB 1M3CA 3RMQA 1VQ8T 2YKTA 3BUPA 1QVGP 1U8RA 3LW5E 4KIKA 2CZ7B 2RJCA 3DX0A 1OI1A 2GTOA 4C8QC 4DQ2A 1YJ9Q 1RAAB 3UPUA 4M7AD 1VQNT 4E7IA 5DLOA 4DYLA 3I5RA 1KIKA 2OTLT 3QWXX 1TSFA 3BVUA 4PL6A 5D6YA 2AZVA 3QXEB 4GLKA 2DL4A 2DTOA 4M78E 2QAZA 2PZ1A 5FU6C
chains in the Genus database with same CATH topology
1K1ZA 2JNSA 3H0HA 3UA6A 4GBQA 3I35A 2J7IA 1NEGA 5EC7A 1MUZA 3M0RA 2YIBA 1W9MA 4LUDA 1SPKA 1H3HA 4J9FA 4EZVA 1VYTA 1RUWA 2BTTA 2KRNA 1K9AA 1NLOC 4R5IA 1BBZA 4EZNA 2FO0A 5FWBA 4CC2A 4Z89A 5L23A 1PKTA 1WLPB 2FRYA 1NEBA 2B86A 3EGUA 1RLQC 1K76A 2WINM 4UDXX 2JXBA 4H6IA 1UJYA 2CT4A 2AK5A 2C0OA 5FWCA 2EWFA 4KIKB 3M0QA 2YI8A 1QWEA 1VYUA 1UG1A 1YNZA 2DLPA 2F2XA 3PVLA 5FW9A 1H8KA 2K79A 1Z9QA 2LQWA 1CKAA 3KFVA 4E81A 5IXBA 1UPXA 2BZYA 4PO2A 2KXDA 2ND1A 4IW0A 2K2MA 4J9EA 2C0TA 1N5ZA 1OV3A 1YN8A 1E6GA 4IM2A 3LMFA 2DMOA 1CKBA 4EZSA 1KFZA 4M4ZA 3QNJA 1XOVA 1PKSA 1PWTA 2AZSA 2LMJA 2KEAA 4OMMA 4JJBA 2D8JA 2W0ZA 4AFUC 3THKA 2K9GA 1NG2A 5IHIA 3B52X 1AOJA 4OMPA 4EZUA 3REBB 1FYNA 3TVTA 2OAWA 4R5JA 2V1RA 2YI9A 3EG2A 4EZYA 2KGTA 2W10A 4D8KA 4JZ4A 1W1FA 1AZEA 1V1CA 3PE0A 3PVQA 4D8DA 4NPHA 5FLEX 1AD5A 2JS2A 2OI3A 2EGAA 1WXUA 3I01A 4Z8AA 1UGVA 4HVUA 2ED0A 3EHQA 1JXOA 1YWOA 4AG2C 5FIGA 1GFCA 2DBKA 4JJDA 5GJVB 2YT6A 2G6FX 2LCSA 2Z8YA 1JU5C 4RTYA 2KHOA 1U00A 2GBQA 4IM0A 2EGEA 2L3SA 2CDTA 2ED1A 1SU6A 2EPDA 4RTXA 2RNAA 2DM1A 2KXCA 2RQUA 4JNEA 1Y57A 4LN2A 1YP5A 2YUOA 5IHNA 2EBPA 4EIKA 1K0XA 1UFFA 1UHCA 1U3OA 2EGCA 2DL3A 2ENMA 4HVWA 2GQIA 2JTEA 2DNUA 1AWOA 2SRCA 2RQWA 2GTJA 2CUBA 3VS2A 1H92A 4AFSC 1K4US 1DKYA 1VA7A 3LH5A 2CSIA 2J06A 2MOXA 4F14A 1RI9A 4AFZC 2KR3A 3T4AG 4ESRA 1S1NA 1X27A 2L3PA 1T3SA 1UTIA 3C0CA 4J9IA 3M0PA 4EZPA 4R0KA 2C0IA 4GLMA 2EVRA 4J9GA 1SRMA 4RTVA 1ABQA 2YIAA 1PRLC 1QCFA 1A0NB 4JNFA 2FEIA 2LX7A 4QT7A 1GCQA 3FJ5A 2RF0A 2ND0A 2DRKA 2L0AA 1GNLA 2DL5A 1M3AA 1B07A 3TSWA 3IQLA 3NPFA 2DYBA 3NMZC 2KRMA 4F17A 2PY6A 1UECA 3VS3A 1FMKA 4X1VA 3M0TA 4RTTA 3EG1A 4DEXA 3SEMA 3EG0A 1AVZC 2RMOA 1NYGA 4ORZA 2DJQA 2JM9A 2O88A 2GGRA 3VS5A 4EZQA 2D8HA 2YSQA 1M30A 3H0FA 2LJ1A 3H0IA 4JPBW 1OA0A 1M8MA 1KSWA 1PNJA 2EYXA 2JT4A 3SHWA 1SUFA 1JO8A 4F01A 3D2FA 4EZXA 3VS4A 4F00A 1OPKA 3QA8A 3KAVA 3NGPA 1B3QA 2D1XA 1GN9A 1SSHA 2CH4W 2EYZA 2PNIA 3O3OB 3DPPA 2K7AA 4J9HA 4HR1A 2DF6A 1NM7A 1GBQA 2LJ3A 4LUEA 2SEMA 3R6NA 4OMNA 1E6HA 4JL9A 1PHTA 1UDLA 1HSQA 2YIVX 4FSSA 4LNPA 3DPOA 1QLYA 1LCKA 4DEYA 2A28A 2L2PA 4CC4B 2KNBB 2FRWA 2KROA 2X3XD 3KAWA 1UE9A 1WFWA 2YDLA 4E6RA 3ZEDA 2CSQA 1W6XA 1TG0A 2NWMA 1JEGA 1G83A 3M0SA 4CC7A 2KBTA 1OAOA 5IXFA 2DL8A 4HYBA 2EQIA 1SHFA 4RTWA 4KRTA 2DVJA 2HBWA 1OPLA 4LE9A 3VKHA 1YCSB 1OEBA 2RT6A 4J9CA 5ECAA 4OMOA 1YWPA 1ZUYA 1VYVA 2YUPA 2K3BA 4EZZA 3UF4A 1SU7A 4RUGA 2E5KA 4JWEA 3RV0A 5I22A 2N3KA 3VEBA 2JW4A 3VEAA 1MJGA 3EHRA 2X5CA 4IIOA 4Y92A 1PRMC 3GBQA 2HEQA 2LP5A 1X6GA 3B51X 4OMLA 2P4RA 4IWPA 4E3CA 2J6FA 2KE9A 1NLPC 4J9BA 4HR1B 2FPFA 2OBLA 2J6OA 4J9DA 1I0CA 4IWQA 2EYWA 4JZ3A 3T46A 1Y0MA 3L3OM 2DBMA 1I07A 3ER9B 1ZYLA 1WDXA 1X6BA 4OMQA 4ZNXA 2HCKA 4EZOA 1GRIA 2DRMA 3I9QA 1T3LA 3I39X 2V1QA 1M3BA 3RV1A 2FG0A 2RQRA 3D2EA 1WA7A 2JM8A 2M51A 1SU8A 2BZXA 2BZ8A 4JWCA 1BK2A 1IO6A 2DE0X 1GL5A 3T48A 2PTKA 2CH4A 2O2OA 2RQTA 3TSZA 1E9VA 1J3TA 2GNCA 3FD9A 5TKYA 4FM3A 1Z9ZA 1AZGB 4F16A 4G6QA 2GAFD 1QKXA 1X69A 1HJDA 1AWJA 3H41A 1U5SA 4HCKA 5I11A 3F7WA 4JN4A 1BU1A 1MV0B 2ECZA 3I5SA 4B9QA 2K6DA 3CQTA 1T0HA 5GJWB 2IIMA 4Z88A 1X2KA 1QKWA 3JV3A 3RNJA 1QWFA 4RTZA 4JLCA 1AWXA 1I1JA 2JS0A 4K11A 4IIMA 4R5GA 1W70A 3O5ZA 1DKXA 1X43A 2ESWA 5E84A 3B53X 3A98A 1GNTA 1DKZA 5IHKA 4CC3A 2CT3A 2KT1A 2I0NA 1CSKA 4JJCA 3U23A 1HD3A 2QDLA 3UITA 4HY9A 2A36A 3OHXM 2DA9A 4D8JA 1SRLA 3ER8C 2HSPA 2LJ0A 4HVVA 3EG3A 1WI7A 3ERCC 2F2WA 5IH2A 1TUCA 2H8HA 1AWWA 3ZL7C 2KRSA 2J05A 2J6KA 4JWIA 2XMFA 2A08A 3C7NA 1WXBA 4IWOA 1TUDA 2O9VA 3I04A 4H6HA 2LNHB 2VKNA 2ABLA 3REAB 4M0MA 2FPEA 3VS0A 4EZTA 2VVKA 3QWYA 4EZWA 2O9SA 3KDRA 1E1DA 1WIEA 1GBRA 2KYBA 1JXMA 1ABOA 2DL7A 2O31A 2EX3B 3VS7A 2RPNA 4JWDA 1E2UA 3T49A 2ROTA 2YUNA 1OA1A 3T47A 2QXLA 3O3NB 4IM3A 1MV3A 3NHNA 2LM0A 1SEMA 3RBBB 2EW3A 2MCNA 1UUEA 1K0SA 4EZRA 3GI7A 2YUQA 3VRYA 1JQKA 3OWGA 1M27C 2EKHA 3ULRB 1ARKA 4AFQC 2QFFA 1GCPA 1RLPC 1ZBJA 2A37A 4AG1C 4RTUA 1ZSGA 2D0NA 2RQVA 5HCKA 1OOTA 4WCIA 3VRZA 2GA9D 2CREA 1JQQA 1ZLMA 1ZUKA 4R5LA 2OBMA 1BB9A 2DX1A 2ROLA 1ZX6A 2AKKA 1G2BA 3UATA 1T0JA 4A63B 2EYYA 2AKLA 3O3MB 2KT8A 3DPQA 1WYXA 1M3CA 2NCZA 1GCQC 2RN8A 2L3QA 1EFNA 2HDAA 1WXTA 1NYFA 4KIKA 2MIOA 2M0YA 1AEYA 2GTOA 2JMCA 2CUDA 2FPDA 2NUZA 4HXJA 1ZUUA 1SHGA 4UDYX 2LZ6B 1KIKA 3I5RA 4R5KA 1E7OA 1KJWA 2KYMA 3VS1A 1UHFA 2VWFA 3QWXX 1X2QA 3VS6A 2LQNA 2AZVA 2F2VA 2DILA 3M0UA 1UJ0A 1WX6A 1GFDA 2X3WD 2DL4A 2OJ2A 1U06A 2JMAA 2PZ1A 3UA7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K1Z A;  3H0H A;  3UA6 A;  4GBQ A;  3I35 A;  2J7I A;  1NEG A;  5EC7 A;  1MUZ A;  3M0R A;  4LUD A;  1SPK A;  1H3H A;  4J9F A;  1VYT A;  1RUW A;  2BTT A;  2KRN A;  1K9A A;  1NLO C;  1BBZ A;  2FO0 A;  5FWB A;  4CC2 A;  4Z89 A;  5L23 A;  1PKT A;  1WLP B;  2FRY A;  1NEB A;  2B86 A;  3EGU A;  1RLQ C;  1K76 A;  2JXB A;  1UJY A;  2CT4 A;  2AK5 A;  2C0O A;  5FWC A;  3M0Q A;  3PVL A;  1QWE A;  1VYU A;  1UG1 A;  1YNZ A;  2DLP A;  2F2X A;  5FW9 A;  1H8K A;  2K79 A;  1Z9Q A;  2LQW A;  1CKA A;  3KFV A;  5IXB A;  2BZY A;  2KXD A;  2K2M A;  4J9E A;  2C0T A;  1N5Z A;  1OV3 A;  1YN8 A;  1E6G A;  2DMO A;  1CKB A;  1KFZ A;  4M4Z A;  1XOV A;  1PKS A;  1PWT A;  2AZS A;  2LMJ A;  2KEA A;  4OMM A;  4JJB A;  2D8J A;  2W0Z A;  4AFU C;  3THK A;  2K9G A;  1NG2 A;  5IHI A;  1AOJ A;  4OMP A;  3REB B;  1FYN A;  3TVT A;  2OAW A;  2V1R A;  3EG2 A;  2KGT A;  2W10 A;  4D8K A;  4JZ4 A;  1W1F A;  1AZE A;  1V1C A;  3PE0 A;  3PVQ A;  4D8D A;  1AD5 A;  2OI3 A;  2JS2 A;  2EGA A;  1WXU A;  4Z8A A;  1UGV A;  4HVU A;  2ED0 A;  3EHQ A;  1JXO A;  1YWO A;  4AG2 C;  1GFC A;  2DBK A;  4JJD A;  5GJV B;  2YT6 A;  2G6F X;  2LCS A;  1JU5 C;  4RTY A;  2GBQ A;  2EGE A;  2L3S A;  2CDT A;  2ED1 A;  2EPD A;  4RTX A;  2RNA A;  2DM1 A;  2KXC A;  2RQU A;  1Y57 A;  4LN2 A;  1YP5 A;  2YUO A;  5IHN A;  2EBP A;  4EIK A;  1K0X A;  1UFF A;  1UHC A;  1U3O A;  2EGC A;  2DL3 A;  2ENM A;  4HVW A;  2GQI A;  2JTE A;  2DNU A;  1AWO A;  2SRC A;  2RQW A;  2GTJ A;  2CUB A;  3VS2 A;  1H92 A;  4AFS C;  1K4U S;  1VA7 A;  3LH5 A;  2CSI A;  2J06 A;  2MOX A;  4F14 A;  1RI9 A;  4AFZ C;  2KR3 A;  4ESR A;  1S1N A;  1X27 A;  2L3P A;  1T3S A;  1UTI A;  3C0C A;  4J9I A;  3M0P A;  4R0K A;  2C0I A;  4GLM A;  2EVR A;  4J9G A;  1SRM A;  4RTV A;  1ABQ A;  1PRL C;  1QCF A;  1A0N B;  2FEI A;  2LX7 A;  4QT7 A;  1GCQ A;  3FJ5 A;  2RF0 A;  2DRK A;  2L0A A;  2DL5 A;  1M3A A;  1B07 A;  3TSW A;  3IQL A;  3NPF A;  2DYB A;  3NMZ C;  2KRM A;  4F17 A;  1UEC A;  3VS3 A;  1FMK A;  4X1V A;  3M0T A;  4RTT A;  3EG1 A;  4DEX A;  3SEM A;  3EG0 A;  1AVZ C;  2RMO A;  1NYG A;  4ORZ A;  2DJQ A;  2JM9 A;  2O88 A;  2GGR A;  3VS5 A;  2D8H A;  2YSQ A;  1M30 A;  3H0F A;  2LJ1 A;  3H0I A;  4JPB W;  1M8M A;  1KSW A;  1PNJ A;  2EYX A;  2JT4 A;  3SHW A;  1JO8 A;  3VS4 A;  1OPK A;  3NGP A;  1B3Q A;  2D1X A;  1SSH A;  2CH4 W;  2EYZ A;  2PNI A;  2K7A A;  4J9H A;  2DF6 A;  1NM7 A;  1GBQ A;  2LJ3 A;  4LUE A;  2SEM A;  3R6N A;  4OMN A;  1E6H A;  1PHT A;  1UDL A;  1HSQ A;  4FSS A;  4LNP A;  1QLY A;  1LCK A;  4DEY A;  2A28 A;  2L2P A;  4CC4 B;  2KNB B;  2FRW A;  2KRO A;  2X3X D;  1UE9 A;  1WFW A;  4E6R A;  2YDL A;  2CSQ A;  1W6X A;  1TG0 A;  2NWM A;  1JEG A;  1G83 A;  3M0S A;  4CC7 A;  2KBT A;  5IXF A;  2DL8 A;  2EQI A;  1SHF A;  4RTW A;  4KRT A;  2DVJ A;  2HBW A;  1OPL A;  4LE9 A;  1YCS B;  1OEB A;  4J9C A;  5ECA A;  4OMO A;  1YWP A;  1ZUY A;  1VYV A;  2YUP A;  2K3B A;  3UF4 A;  4RUG A;  2E5K A;  5I22 A;  2JW4 A;  3EHR A;  4IIO A;  4Y92 A;  1PRM C;  3GBQ A;  2HEQ A;  2LP5 A;  1X6G A;  4OML A;  2P4R A;  2J6F A;  2KE9 A;  1NLP C;  4J9B A;  2FPF A;  2J6O A;  4J9D A;  1I0C A;  2EYW A;  4JZ3 A;  1Y0M A;  2DBM A;  1I07 A;  1WDX A;  1X6B A;  4OMQ A;  4ZNX A;  2HCK A;  1GRI A;  2DRM A;  3I9Q A;  1T3L A;  2V1Q A;  1M3B A;  2FG0 A;  2RQR A;  2JM8 A;  1WA7 A;  2M51 A;  2BZX A;  2BZ8 A;  1BK2 A;  1IO6 A;  2DE0 X;  1GL5 A;  2PTK A;  2CH4 A;  2O2O A;  2RQT A;  3TSZ A;  1J3T A;  2GNC A;  4F16 A;  1Z9Z A;  1AZG B;  1QKX A;  1X69 A;  1HJD A;  1AWJ A;  3H41 A;  1U5S A;  4HCK A;  5I11 A;  1MV0 B;  1BU1 A;  2ECZ A;  3I5S A;  2K6D A;  3CQT A;  1T0H A;  5GJW B;  2IIM A;  4Z88 A;  1X2K A;  1QKW A;  3JV3 A;  3RNJ A;  1QWF A;  4RTZ A;  1AWX A;  1I1J A;  2JS0 A;  4K11 A;  4IIM A;  1W70 A;  3O5Z A;  1X43 A;  2ESW A;  3A98 A;  5IHK A;  4CC3 A;  2CT3 A;  2KT1 A;  2I0N A;  1CSK A;  4JJC A;  3U23 A;  1HD3 A;  2QDL A;  2A36 A;  2DA9 A;  1SRL A;  2HSP A;  2LJ0 A;  4HVV A;  3EG3 A;  1WI7 A;  2F2W A;  5IH2 A;  1TUC A;  2H8H A;  1AWW A;  3ZL7 C;  2KRS A;  2J05 A;  2J6K A;  2XMF A;  2A08 A;  1WXB A;  1TUD A;  2O9V A;  2LNH B;  2VKN A;  2ABL A;  3REA B;  2FPE A;  3VS0 A;  2VVK A;  3QWY A;  2O9S A;  1WIE A;  1GBR A;  2KYB A;  1JXM A;  1ABO A;  2DL7 A;  2O31 A;  3VS7 A;  2RPN A;  2ROT A;  2YUN A;  1MV3 A;  3NHN A;  1SEM A;  3RBB B;  2EW3 A;  2MCN A;  1UUE A;  1K0S A;  2YUQ A;  3VRY A;  1M27 C;  2EKH A;  3ULR B;  1ARK A;  4AFQ C;  1GCP A;  1RLP C;  1ZBJ A;  2A37 A;  4AG1 C;  4RTU A;  1ZSG A;  2D0N A;  2RQV A;  5HCK A;  1OOT A;  4WCI A;  3VRZ A;  2CRE A;  1JQQ A;  1ZLM A;  1ZUK A;  1BB9 A;  2DX1 A;  2ROL A;  1ZX6 A;  2AKK A;  1G2B A;  3UAT A;  1T0J A;  4A63 B;  2EYY A;  2AKL A;  2KT8 A;  1WYX A;  1M3C A;  1GCQ C;  2RN8 A;  2L3Q A;  1EFN A;  2HDA A;  1WXT A;  1NYF A;  2MIO A;  2M0Y A;  1AEY A;  2GTO A;  2JMC A;  2CUD A;  2FPD A;  2NUZ A;  4HXJ A;  1ZUU A;  1SHG A;  2LZ6 B;  1KIK A;  3I5R A;  1E7O A;  1KJW A;  2KYM A;  3VS1 A;  1UHF A;  2VWF A;  3QWX X;  1X2Q A;  3VS6 A;  2LQN A;  2AZV A;  2F2V A;  2DIL A;  3M0U A;  1UJ0 A;  1WX6 A;  1GFD A;  2X3W D;  2DL4 A;  2OJ2 A;  1U06 A;  2JMA A;  2PZ1 A;  3UA7 A; 
#chains in the Genus database with same CATH topology
 2JNS A;  3H0H A;  2MWO A;  3M3W A;  4M7D E;  1UGQ B;  3HAH A;  2YIB A;  3SWN C;  4JJN K;  4LUD A;  1H3H A;  2DER A;  1RUW A;  5C6S A;  1IZ6 A;  4R5I A;  3S6W A;  5L23 A;  4X9C A;  2EQK A;  1WNL A;  1VQO T;  3E19 A;  1NPP A;  4F7U B;  1RLQ C;  1K76 A;  2K5F A;  3D4Y A;  4A4E A;  2JXB A;  3GOX A;  4H6I A;  4BDY A;  2CT4 A;  2PVO B;  3I55 T;  2AK5 A;  2EWF A;  1M1G A;  1YI2 Q;  3PVL A;  3DYT A;  1YNZ A;  2ELB A;  1H8K A;  3P8D A;  3CC7 T;  3S3O A;  2EQU A;  1YN8 A;  3P8H A;  3LMF A;  3HP9 A;  3CXC P;  1O9S A;  1KFZ A;  3CCL T;  3QNJ A;  3I56 T;  1PWT A;  1VQM Q;  1KC8 C;  4A53 A;  4RG8 A;  4JJB A;  2ZXQ A;  3A8M B;  3THK A;  5A0G A;  4PJO D;  1NG2 A;  1N8R U;  2YL5 A;  2EJ9 A;  5IHI A;  3B52 X;  2PU9 B;  3TVT A;  2OAW A;  3QSU A;  4QW2 A;  2RA2 A;  3CPW S;  2KGT A;  1PSE A;  4JZ4 A;  2CP2 A;  4NPH A;  2OI3 A;  2JS2 A;  3DLM A;  1YBY A;  4Z8A A;  4HVU A;  3LX7 A;  1HXK A;  4PNO A;  4QVZ A;  4M7A B;  2YL9 A;  5GAN 3;  5GJV B;  2Z8Y A;  2KHO A;  1OU9 A;  4NS5 A;  2EPD A;  3EGD B;  5CKB A;  1Y57 A;  1YHQ T;  2LNV A;  1C0M A;  2K5I A;  2YUO A;  2ZAE A;  4A54 A;  4ZGJ B;  4EIK A;  1UHC A;  3M59 A;  2HKN A;  4BE2 A;  1U3O A;  1Q86 C;  2EGC A;  2DL3 A;  4HVW A;  1M4Z A;  3DB3 A;  2KY9 A;  2E10 A;  4QQD A;  1N6A A;  4XU0 A;  1RI0 A;  1LVK A;  1OU8 A;  3OYK A;  2XD0 A;  2CUB A;  2DZC A;  5CKD A;  2ZPH B;  4DA4 A;  2DK3 A;  3UT1 A;  2J06 A;  3OYF A;  1RI9 A;  5GAN f;  2KR3 A;  3T4A G;  4ESR A;  1X27 A;  4JRK A;  3C0C A;  4EZP A;  4R0K A;  4J9G A;  2ALW A;  4JRP A;  1ABQ A;  3CMA T;  1UGR B;  2R57 A;  3I2W A;  1D0Z A;  2V0O A;  2ND0 A;  2L0A A;  2RHZ A;  3L2R A;  5GAN 6;  2FIC A;  1G5V A;  2DL5 A;  1S72 Q;  1B07 A;  2F7Q A;  4IUR A;  3NPF A;  1ZA2 B;  4GY5 A;  4F17 A;  2GF7 A;  3VS3 A;  3SOG A;  2QTX A;  1YJ9 A;  3MET A;  4WF2 A;  4C92 B;  3M0T A;  3DLL A;  3X28 B;  4LDX A;  4FM4 B;  2Z0W A;  1VQ5 T;  1YHQ Q;  4HCB A;  2GGR A;  1LOJ A;  1X75 C;  4M75 D;  1YIJ T;  5GMK l;  1ZSZ B;  2LJ1 A;  3VV0 A;  3WVE B;  4JPB W;  1KSW A;  2BE7 D;  2JT4 A;  2LQK A;  3BUD A;  1SUF A;  3D2F A;  3VS4 A;  2QQB A;  4C92 F;  1PM3 A;  4O5V A;  3KAV A;  1VIE A;  2D1X A;  2NUT A;  3OYG A;  1SSH A;  4LD6 A;  5GAN g;  4LXC A;  3O3O B;  3F70 A;  4MDX A;  3QG1 A;  2RD1 A;  4ME7 A;  4OF1 A;  4HR1 A;  1VQ4 T;  1VQL T;  2DF6 A;  1M5Q 1;  2HQE A;  4ZGE B;  2SEM A;  4C0F A;  1PD0 A;  1H64 1;  3M55 A;  1U1T A;  3CCU T;  4M77 G;  4J6Y A;  1KQS P;  2GQV A;  4FSS A;  1YI2 A;  3A5Z B;  2L2P A;  4CC4 B;  4PJO G;  3L2Q A;  1YWM A;  1UE9 A;  1WFW A;  3GNF B;  4E6R A;  3ZED A;  4PJN A;  3LWI A;  4WPE A;  2EWN A;  1TG0 A;  3QDR B;  4DOW A;  3CPW A;  1G83 A;  1EZZ B;  1I5L A;  2F18 A;  3NFC A;  1QMC A;  4HCZ A;  2YL8 A;  2DTH A;  1SHF A;  2DVJ A;  4C92 A;  1YCS B;  4J9C A;  1Q81 U;  1VQM A;  1SU7 A;  3Q84 A;  3CEY A;  3OYB A;  4JWE A;  1ZSZ A;  2N3K A;  4OB0 B;  2BIV A;  2JNK A;  2X5C A;  2HBP A;  3EFR A;  4IIO A;  3GBQ A;  2LP5 A;  1X6G A;  3GF5 A;  2P4R A;  2KE9 A;  1NLP C;  1KD1 R;  2F1L A;  3OYJ A;  2OBL A;  3OS5 A;  4J9D A;  4OGC A;  2E6N A;  5GMK i;  1I0C A;  3MEW A;  3EG9 B;  1JB0 E;  1X01 A;  2XDB A;  3L3O M;  3ER9 B;  1HYO A;  1ZYL A;  1WDX A;  3HRS A;  5KYU B;  3CCU Q;  4ZNX A;  4E7L A;  3VKI A;  3CVR A;  2CP3 A;  1BI0 A;  2V1Q A;  1M3B A;  1OUL A;  4E7Z A;  3CC4 A;  1WJR A;  1G3Y A;  4JRQ A;  2MI6 A;  5A0L A;  1GL5 A;  3LLL A;  2D1L A;  1X6O A;  2O2O A;  2RQT A;  1IXD A;  2M02 A;  2DET A;  1Z9Z A;  2GAF D;  4PFO A;  3H8Z A;  2E41 A;  1VQ7 Q;  1U5S A;  1M9S A;  3VYG A;  4C0Z A;  3CQT A;  2Y90 A;  2FHD A;  4MMK A;  2HL3 A;  2XK0 A;  1K8A U;  4PLL A;  5I2M A;  2IIM A;  4BI4 A;  1QKW A;  2E12 A;  2RO0 A;  4JLG A;  2LDM A;  1WDZ A;  3CXC A;  4WTO B;  3OYD A;  1HWW A;  2C08 A;  1DKX A;  1RAB B;  3B53 X;  1WJS A;  4CC3 A;  2CT3 A;  3E9G A;  4OB2 B;  2K57 A;  4M78 F;  3J80 E;  1Q82 U;  2A36 A;  4M75 G;  4D8J A;  1VQ6 Q;  1LPL A;  1WI7 A;  2DIQ A;  3MP1 A;  1AWW A;  2XHC A;  4FU6 A;  4AZ5 A;  2KRS A;  2J6K A;  2X3W A;  3MP8 A;  4JWI A;  4M7D F;  5CR2 A;  1MMG A;  2KDS A;  3EG9 A;  4IWO A;  2XDP A;  1W4S A;  3QBY A;  2LNH B;  2FPE A;  3EJU A;  3CCJ A;  3EJT A;  1JJ2 P;  4EZW A;  4FW1 A;  2LVM A;  5GAN 5;  3H6Z A;  1BI1 A;  4C8Q B;  2YRC A;  4C92 C;  2ZPB B;  2EX3 B;  3VS7 A;  3D4Z A;  3T49 A;  2ROT A;  1O75 A;  2QYZ A;  1GXI E;  1MV3 A;  5IT9 E;  1ZSZ C;  1D3B B;  1MNE A;  2OTJ Q;  3GI7 A;  2QA4 T;  4M78 A;  3OWG A;  4FT4 A;  4BAC A;  3OA6 A;  2Z0V A;  2QFF A;  3JB9 D;  3CCR Q;  4EPC A;  4M7D A;  3PMI A;  4FYX B;  2GA9 D;  3VRZ A;  2MYS A;  1JQQ A;  3CBM A;  2DX1 A;  2ROL A;  1IHV A;  1K9M C;  4N4H A;  4HA8 A;  4J7F A;  3UAT A;  3L2Z A;  4C0G A;  2KT8 A;  3DPQ A;  1XTD A;  2V8I A;  2L3Q A;  1P92 A;  3CCM A;  5FRO A;  1WXT A;  1NYF A;  2M0Y A;  1AEY A;  4JLI A;  2QQR A;  2JMC A;  4XTU A;  2CUD A;  2E1H A;  2V8K A;  2FPD A;  5GMK j;  3BW1 A;  3X25 B;  2LZ6 B;  2E5Q A;  2IPO B;  4NSW A;  5I21 A;  1E7O A;  3LWH A;  3BLB A;  3V8L A;  1UHF A;  1WQ7 A;  2BE9 B;  2Z0O A;  2MF2 A;  3VS6 A;  4AZC B;  2RH2 A;  2VC8 A;  1XNI A;  2DXB A;  1ACM B;  2QEX T;  4XU3 A;  1SKU B;  5LJ3 j;  3UA7 A;  2EYQ A;  5CK9 A;  3OYM A;  2QKW A;  1BKB A;  3I35 A;  2J7I A;  5CCA A;  3JCM W;  1TS9 A;  5FU7 B;  5EC7 A;  1MUZ A;  3M0R A;  1I5O B;  4M77 E;  2OAU A;  1SPK A;  1VYT A;  4BD3 A;  4AZH A;  5IAY A;  5FRM A;  3TU4 K;  3CCV A;  3RPM A;  1BBZ A;  4Z89 A;  2HQH A;  2VGN A;  3G6E A;  2O01 E;  1WLP B;  5KYW A;  4II1 A;  3FC3 A;  2B86 A;  1I4D A;  2O0I 1;  2ZPF B;  2WIN M;  1Q7Y U;  1KQS A;  4KIK B;  1QWE A;  2RAI A;  1VYU A;  2DLP A;  2F2X A;  2X4W A;  1VQ7 A;  2HD0 A;  3JCM f;  2BZY A;  2XG8 D;  5GAM e;  2KXD A;  2K2M A;  1WHL A;  1FX7 A;  2HKQ B;  4QKU A;  2F5T X;  1E6G A;  4PJM A;  4Q5W A;  2DMO A;  1C1A A;  1YJ9 T;  1N27 A;  4M4Z A;  3CV5 A;  3FLG A;  3GP8 A;  1M1K C;  2AHJ B;  2LMJ A;  1N8R R;  2JTF A;  3PTA A;  2D8J A;  1MMD A;  2W0Z A;  2CZ0 B;  1O7D C;  3PMT A;  3HSB A;  2P0P A;  5HK3 A;  1VQ6 A;  1KG1 A;  2YI9 A;  3QYH B;  3CCE A;  4FYV B;  1RL2 A;  3PE0 A;  2DVE A;  3MEV A;  4D8D A;  5FLE X;  2HQX A;  4IUT A;  4ZTF A;  1WXU A;  5KYX A;  2FVU A;  3I01 A;  2ED0 A;  2P0K A;  1JXO A;  1YWO A;  2QQS A;  1GFC A;  4JJD A;  2L8D A;  4KUI A;  2YT6 A;  4AZG A;  4PK4 A;  2H3J A;  2EGE A;  4Y91 A;  3D50 A;  3RES A;  2ED1 A;  1SU6 A;  4IKF A;  1D1C A;  4BE1 A;  1KQ2 A;  2GFU A;  2RQU A;  2KXC A;  4JNE A;  2ZPI B;  3CPW P;  3JB9 G;  1WGS A;  3JCM g;  1TQU A;  2L3R A;  1UFF A;  2EIF A;  4ATO A;  3BUI A;  4BUG A;  1YI2 T;  4R55 A;  2DAQ A;  2DNU A;  1AWO A;  2OTJ A;  1Y7X A;  3C94 A;  2RQW A;  4KH0 B;  4IUP A;  3VS2 A;  3ME9 A;  4AFS C;  5KCO A;  1K4U S;  3LH5 A;  3CCR A;  1IRE B;  3KBG A;  1BIA A;  3G1J A;  2P0Q A;  2EFI A;  4J7I A;  1VQK Q;  1VQM T;  1T3S A;  5GAN 2;  4M75 E;  4GLM A;  4LDY A;  1SRM A;  1YIT Q;  3QZ9 B;  1WQW A;  4XAX B;  2KK4 A;  1R0B G;  2F69 A;  4X34 A;  1PRL C;  1KC8 U;  1H3Z A;  3CD6 A;  2LX7 A;  1GCQ A;  3FJ5 A;  2RF0 A;  1V76 A;  4QQ6 A;  5CQX A;  4PJJ A;  3J81 E;  1M3A A;  4N4I A;  3TSW A;  5D6X A;  2DYB A;  3CZN A;  3JCM J;  2KRM A;  3QE6 A;  4OMF B;  2WSC E;  5HY6 A;  2QXF A;  2FL7 A;  3INZ A;  3A1P A;  3BVT A;  3JCM V;  4HT8 A;  1K73 C;  4ELZ C;  4RTT A;  1TQT A;  3ZFJ A;  4DEX A;  3PT9 A;  1NYG A;  2EQM A;  4ORZ A;  2DJQ A;  2JM9 A;  2V8J A;  2KVQ G;  3FEO A;  5AYF A;  5GAM h;  4PFZ A;  2CP7 A;  1IB8 A;  1JJ2 A;  1M8M A;  2EYX A;  3SHW A;  2QDY B;  2D0Q B;  3JCM X;  4A4F A;  2KQW A;  1M90 C;  1VQ9 Q;  1B3Q A;  1GN9 A;  3L2U A;  2LXY A;  2PNI A;  1Q86 U;  2OZN B;  3DX4 A;  5GMK m;  4XTX A;  3CKD A;  4C92 D;  1QVP A;  3J7A F;  3M4Y A;  5GAM d;  1R5E A;  1QP2 A;  3MO8 A;  3M58 A;  1V29 B;  1ZA1 B;  1VUB A;  4OMN A;  5FU7 C;  2XID A;  4JL9 A;  1PHT A;  1HSQ A;  2DIG A;  5FLX E;  2Z0N A;  1YCY A;  2E6Z A;  3QO3 A;  4KGX B;  1KHI A;  1Y96 A;  4DEY A;  2A28 A;  3E2U A;  2KNB B;  3KAW A;  4F7U G;  1S72 T;  2CSQ A;  1QVF A;  1W6X A;  2NWM A;  4CC7 A;  1I81 A;  1Q81 R;  3R6O A;  1RAF B;  2DL8 A;  4HYB A;  4RTW A;  2DXC A;  1MGQ A;  2RT6 A;  1Q95 G;  3DB4 A;  2RI2 A;  1YWP A;  2Y4Y A;  1VYV A;  1QVG S;  2K3B A;  1R8O B;  3HL8 A;  1M2V A;  1I8F A;  2E5K A;  4RCC A;  3CC4 Q;  5LJ3 f;  3OBW A;  2NYS A;  2NUT B;  3LYI A;  3B51 X;  4BDZ A;  2E65 A;  2X3X A;  1I49 A;  2CP6 A;  4HR1 B;  4J9B A;  2K4Y A;  4AZI A;  2FPF A;  3LLR A;  1TOV A;  2ZZD A;  1Y0M A;  1I07 A;  3NTK A;  3KUF A;  5D7U A;  4M7A G;  1IRX A;  1QWU A;  4XK8 E;  4C5G A;  3CCS Q;  3CME A;  2I2L A;  4DOV A;  2EFL A;  3D2E A;  1WA7 A;  2RHI A;  2M51 A;  2BZ8 A;  3E9F A;  2DXU A;  2F1A A;  1IO6 A;  3T48 A;  4LDU A;  1NJI C;  3QJY A;  2GNC A;  5HKC A;  3FD9 A;  4F16 A;  5CQY A;  1K8A R;  4HCK A;  2AT1 B;  1BU1 A;  1X03 A;  2ECZ A;  1MND A;  4N4G A;  4B9Q A;  3WVD B;  5LJ3 g;  1XQH A;  3CCJ Q;  4OVA A;  3DX1 A;  4AZ7 A;  2VB6 A;  1VQK A;  4RTZ A;  3E1S A;  1AWX A;  2V26 A;  1YIT A;  5GAO l;  4IIM A;  4R5G A;  1Q82 R;  2KI7 A;  3O5Z A;  1X43 A;  5E84 A;  4F04 B;  3JB9 J;  2EAY A;  4B9X A;  1CSK A;  2E3H A;  2HSE B;  3UIT A;  4HY9 A;  3OHX M;  4XTW A;  3EFO B;  3ER8 C;  3V7C A;  3JCM b;  2DYI A;  3HAI A;  3MP6 A;  3C7N A;  2A0F B;  2MI7 A;  4M77 F;  3VUB A;  3DX2 A;  3FRN A;  3RER A;  2K5L A;  1SF9 A;  2JZ2 A;  3C95 A;  7AT1 B;  2A7Y A;  2ABL A;  2FYV A;  2X3V A;  1LNX A;  2JVV A;  4PJO F;  2FZG B;  4B6M A;  4EZT A;  3HAJ A;  1SG5 A;  2O9S A;  1GBR A;  1BI3 A;  4WPC A;  3G71 Q;  3M9Q A;  4L59 A;  1ABO A;  1OQK A;  2O31 A;  2RPN A;  1VQ9 A;  3CC2 Q;  4JWD A;  2YUN A;  1OA1 A;  3T47 A;  5CAI A;  3HTR A;  3CCM Q;  2WYI A;  1MHN A;  2YLB A;  1OZ2 A;  1VQ7 T;  2M16 A;  3OW2 S;  4EZR A;  1JQK A;  5GAN 4;  2QG9 B;  4AFQ C;  4FYY B;  4AZB A;  1GCP A;  2DZ9 A;  2PVG B;  4MML A;  2R5M A;  1ZBJ A;  2A37 A;  1AHJ B;  2RQV A;  1OOT A;  3SDZ A;  4M77 A;  1UGP B;  4KGV B;  4C8Q D;  2NUP A;  3QKJ A;  4R5L A;  4R56 A;  4EMK A;  2AKK A;  5KBP A;  3D52 A;  3L3P A;  3EFO A;  1T0J A;  3RDV A;  1VQ6 T;  4A63 B;  4PJO A;  2CP0 A;  2QQA A;  1PC0 A;  2VYT A;  3O3M B;  2LCC A;  3RUX A;  2NCZ A;  2MMP A;  2HDA A;  1R33 A;  2IG0 A;  1DJ7 B;  4OB1 B;  4AT1 B;  5DY9 A;  2NUZ A;  4HXJ A;  5AT1 B;  1TWB A;  2P4T A;  5L8R E;  1ZUU A;  3CCV Q;  1SHG A;  4UDY X;  2X35 A;  2F7R A;  2BUD A;  3PGG A;  4PLI A;  3X20 B;  3G6E Q;  4R5K A;  3VS1 A;  2VWF A;  2RK2 A;  2COY A;  3O8V A;  5HK0 A;  2DIL A;  3M0U A;  1M1K R;  1GFD A;  1VQO A;  3AHU A;  1JRI A;  3CAZ A;  5A0D A;  1M8V A;  3JB9 H;  5GAM f;  1U06 A;  4M78 B;  1O7D B;  2RM4 A;  3UA6 A;  2OTJ T;  3CC7 A;  4BE0 A;  2JUF A;  3M57 A;  4A4G A;  1TXQ A;  4M7D B;  4M75 F;  3CCS A;  4J9F A;  3ZBD A;  3CCR T;  2KRN A;  2FYK A;  4CC2 A;  3I56 A;  1Q7Y R;  4O6J A;  4F7U E;  2FRY A;  1NEB A;  1B34 B;  3PFS A;  3BUQ A;  2C06 A;  4FW2 A;  1R34 A;  2OW6 A;  3CCE Q;  2C0O A;  3CD6 T;  1TUG B;  1K9M U;  4OP0 A;  3M0Q A;  5CKH A;  3KFV A;  2K79 A;  1Z9Q A;  4N0A A;  1QX1 A;  1UPX A;  4PO2 A;  1KQ1 A;  5CKE A;  4AVM A;  2YRV A;  1FXX A;  3JRZ A;  4D6W A;  1KK7 A;  1JBM A;  4BY6 B;  1CKB A;  5A2Q E;  1XOV A;  1PKS A;  3TRE A;  4XTZ A;  4EDU A;  5GAM g;  1VQP Q;  2K9G A;  3EAE A;  3QUI A;  1AOJ A;  4OMP A;  4EZU A;  3REB B;  4V2S A;  4JS5 A;  2RJD A;  3EG2 A;  4M75 A;  2ZPG B;  2W10 A;  2YHT A;  4D8K A;  4M77 C;  1AZE A;  1V1C A;  3C4S A;  5LJ5 e;  4M7A E;  4EMK C;  2DJZ A;  4XTV A;  3EHQ A;  4VUB A;  4AG2 C;  5FIG A;  2DBK A;  3CCQ Q;  1F1B B;  2QTV A;  1UGS B;  3BVW A;  4QVC A;  2LCS A;  3BDL A;  4RTY A;  2DKG A;  1U00 A;  5KYW B;  1W2B S;  3RKX A;  1QVF P;  1KHC A;  3G7Z A;  1B34 A;  3G71 A;  4RTX A;  4PFP A;  4MDW A;  3CD6 Q;  4LN2 A;  1YP5 A;  2DD4 A;  2EBP A;  3CC2 A;  1TQS A;  3CMA A;  4YTL A;  2ENM A;  4C8Q G;  2RJE A;  1R77 A;  2GFA A;  3QNI A;  2NLU A;  2SRC A;  2GTJ A;  1G3T A;  3CPF A;  1HTY A;  1VIF A;  9ATC B;  3QHS A;  1H92 A;  2RHU A;  1DKY A;  1VA7 A;  2L5Q A;  1WHM A;  3M54 A;  3EJR A;  2MOX A;  4F14 A;  4NQI A;  3L2V A;  1Y07 A;  2VGM A;  1UTI A;  2ZPE B;  4J9I A;  3M0P A;  2WYH A;  2XDD A;  1KC8 R;  2C0I A;  2EVR A;  5LL6 S;  1RAD B;  1M1K U;  2YIA A;  1RAG B;  1D0X A;  1RAI B;  1A0N B;  4JNF A;  2QI2 A;  2FEI A;  4C5E A;  2DRK A;  2LTO A;  1OYX A;  1GNL A;  5KYX B;  4J6W A;  1WJQ A;  3IQL A;  3QJ6 A;  1PS3 A;  2PY6 A;  3Q1J A;  1FMK A;  2CZ6 B;  4EMG A;  4RCB A;  5GAN h;  4X1V A;  4PJO E;  3EG1 A;  1OZ3 A;  3SEM A;  3EG0 A;  2KAF A;  2YXY A;  2RMO A;  2Y4X A;  3VS5 A;  4EZQ A;  2EKO A;  2YSQ A;  4FYW B;  1M30 A;  3H0F A;  5CKF A;  1IGU A;  1WZO A;  3H0I A;  3JB9 I;  1PNJ A;  2E64 A;  2R5A A;  1JO8 A;  4DBR A;  4F00 A;  1Q86 R;  3QA8 A;  1KD1 C;  2RI5 A;  4JRI A;  2CH4 W;  2GF4 A;  2VXF A;  1QW1 A;  3GLX A;  3D7S B;  4BI8 B;  5KYY A;  2JJ9 A;  3OB9 A;  3DPP A;  2K7A A;  4J9H A;  3V8J A;  3HKS A;  1NM7 A;  3JAM E;  1GBQ A;  4RG2 A;  2LJ3 A;  4M78 C;  5C5B A;  4XU1 A;  1WHK A;  1VQK T;  1YIT T;  2X51 A;  4RMO A;  5LJ5 h;  4E47 A;  3EH1 A;  4M7D C;  3NTI A;  4LNP A;  1QLY A;  1LCK A;  2KRO A;  2X3X D;  2YDL A;  3MJX A;  3PLT A;  5GAO p;  3VJP A;  2QAS A;  1JEG A;  4XU2 A;  3M0S A;  2KBT A;  3SB2 A;  4OGE A;  1OAO A;  4H8S A;  3JB9 F;  2COZ A;  2EQI A;  1OX9 A;  4KRT A;  4LE9 A;  1OPL A;  3VKH A;  3EGX A;  1WHH A;  3M56 A;  1YJW Q;  5ECA A;  4OMO A;  2YWW A;  2E4H A;  3CME Q;  5LJ5 d;  2YUP A;  1YJN Q;  1VQP A;  3BVX A;  1K73 U;  1PD1 A;  1IHW A;  4PJL A;  3FB9 A;  5GAN 8;  5IN1 A;  3EHR A;  4BY6 C;  4Y92 A;  2LT1 A;  4ZGD B;  4OML A;  4IWP A;  3RMS A;  3BDU A;  2F7O A;  2J6F A;  2DTI A;  3UWN A;  1EIF A;  1VQ9 T;  1Y2O A;  4BI3 A;  4NL2 A;  2E3I A;  2RAK A;  3H9N A;  4LDW A;  3UDC A;  2D9T A;  2J6O A;  3PIP A;  5I2S A;  1M90 U;  3CCQ A;  2EYW A;  4JZ3 A;  3T46 A;  1I4L A;  3V7R A;  4BNE A;  4EZO A;  1GRI A;  3OMC A;  2DRM A;  3I9Q A;  5KYN A;  4L6V 5;  3RV1 A;  2RQR A;  4NOY A;  4HCC A;  1Y96 B;  2BZX A;  1PG5 B;  5KCH A;  3OS2 A;  1RAC B;  3EJP A;  3MEA A;  3QII A;  2PTK A;  2JNG A;  1MMN A;  2FB7 A;  3P8B B;  1E9V A;  1X04 A;  2M1H A;  5EG2 A;  1AZG B;  1ZQ1 A;  1X69 A;  4JS4 A;  5I11 A;  3G4S Q;  3F7W A;  1MV0 B;  3I5S A;  4FL6 A;  2K6D A;  1PSF A;  2X4J A;  3TEE A;  3N5B B;  1WPY A;  1M2V B;  3HFO A;  1X2K A;  4A4H A;  3JV3 A;  3OY9 A;  3RNJ A;  1QWF A;  2WAC A;  3CC4 T;  3OSS C;  1W70 A;  2ESW A;  3VU3 C;  1M1F A;  1N9S A;  2DEQ A;  4KGZ B;  2KT1 A;  3U23 A;  4JJC A;  2VXE A;  1WHG A;  3DX3 A;  3BVV A;  2DD5 A;  3M53 A;  2HSP A;  2O4X B;  4MZM A;  5CVI A;  3EG3 A;  2F2W A;  3ERC C;  4C5I A;  1VQ8 Q;  2ZGW A;  3ZL7 C;  5GAM j;  1D1B A;  2A08 A;  4ZTJ A;  5GAO m;  1WXB A;  1QCN A;  2DXT A;  3OYN A;  2K3X A;  2O9V A;  3AT1 B;  2QA4 A;  4AKV A;  4TVR A;  2LT4 A;  4J6X A;  1VQN Q;  3VS0 A;  3QWY A;  4F7U F;  2ZCF B;  2OTL Q;  3CCS T;  2RK1 A;  4M77 D;  4C8Q E;  3KDR A;  4KH1 B;  3BE3 A;  5CIU A;  3CZS A;  1JXM A;  2F5K A;  4P5N A;  2XI9 A;  3A8L B;  2PUO B;  1VOM A;  4C0D B;  1E2U A;  2QXL A;  4JUV A;  2OW7 A;  3QYG B;  3A8O B;  1SEM A;  3FDR A;  1BIB A;  2MCN A;  2LC4 A;  2QGG A;  1NJI U;  5CO7 A;  3VYH B;  2YUQ A;  3OS1 A;  3BUB A;  4QQG A;  2EJF A;  4FIB A;  2EKH A;  3ULR B;  3CCJ T;  4A4K A;  1ZWW A;  3JCM e;  4RTU A;  1QQJ A;  5KE3 A;  2COW A;  3ZEH A;  1VQO Q;  2AIR B;  1ZLM A;  1BB9 A;  3SYV A;  2QEX A;  3I55 Q;  2O4X A;  3OW2 P;  2EYY A;  4F7U A;  3OYL A;  4M7A F;  1BYM A;  1I4T A;  2PMR A;  1GCQ C;  3CC7 Q;  2RN8 A;  1G3S A;  1EFN A;  2RI3 A;  3GNG A;  2MIO A;  3JCM c;  4DBF A;  1I4K 1;  4MZP A;  1YJW A;  3MCA B;  1YJN A;  1ZHI A;  3CCL Q;  1IGQ A;  4KT0 E;  3I56 Q;  1N8R C;  4E2F B;  1KJW A;  2KYM A;  2MK5 A;  2DFU A;  1X2Q A;  1FWZ A;  4E7K A;  3OYE A;  3M5A A;  2LQN A;  3JCM P;  4B9W A;  5DLQ E;  2F2V A;  3NTH A;  2EQJ A;  1UJ0 A;  1WX6 A;  3G71 T;  1D0Y A;  2X3W D;  3CC2 T;  2OJ2 A;  6AT1 B;  3OQ5 A;  1NZ9 A;  2JMA A;  1TQW A;  1WHJ A;  3CCM T;  4ATM A;  1K1Z A;  3OK8 A;  4GBQ A;  3X24 B;  4LDV A;  1NEG A;  3MHX A;  2HMA A;  3EFS A;  3HPW A;  4Y28 E;  3URG A;  2PVD B;  1W9M A;  4DCN C;  4LD9 K;  4M77 B;  1BI2 A;  2CP5 A;  4EZV A;  4M7A A;  2NUP B;  2BTT A;  1K9A A;  1NLO C;  3CXC S;  4EZN A;  2FO0 A;  5FWB A;  4EMK B;  1PKT A;  5J39 A;  4ZN3 A;  2QQ9 A;  3ACO A;  1BCO A;  4PJO B;  3EGU A;  4Z02 A;  1K9M R;  3EGD A;  4UDX X;  1UJY A;  5FWC A;  4M78 D;  5LJ5 f;  2EJG A;  2YI8 A;  1UG1 A;  5FW9 A;  5IXB A;  2LQW A;  1CKA A;  3G4S A;  4E81 A;  4RKU E;  2ND1 A;  4IW0 A;  3ABH A;  4J9E A;  2C0T A;  1N5Z A;  1OV3 A;  4IM2 A;  4M7D D;  4JDS A;  4C92 G;  3DDG A;  4EZS A;  3KXT A;  1N9R A;  3CCV T;  4FT2 A;  3LGL A;  3T9N A;  2AZS A;  4OMM A;  2KEA A;  3G6E T;  4AFU C;  2RHX A;  1G3W A;  1LJO A;  5GAO q;  1AT1 B;  3SFM A;  3CMA Q;  2LQ8 A;  1FYN A;  4R5J A;  2V1R A;  2GCX A;  1UB4 A;  4EZY A;  1VQ8 A;  3JCM Q;  3JCM h;  3DDF A;  1W1F A;  3PVQ A;  3HFN A;  1AD5 A;  4AMC A;  2EGA A;  4HKE A;  2RAJ A;  1UGV A;  2M9U A;  2VAS A;  1TU0 B;  2LRQ A;  1VQN A;  2RB6 A;  4NL3 A;  2OX7 A;  2G6F X;  4C5H A;  1JU5 C;  2OTL A;  1QVG A;  1VQ5 Q;  1B7T A;  2GBQ A;  4X9D A;  4IM0 A;  3RR6 A;  2L3S A;  5KE2 A;  2CDT A;  2JOY A;  1YIJ Q;  5LJ5 g;  2RNA A;  2DM1 A;  2KMT A;  5IHN A;  3CCE T;  1K0X A;  3JCM d;  2PQW A;  3PNW C;  3JSC A;  2GQI A;  4E7J A;  2XIC A;  2JTE A;  2DPP B;  4FZP A;  4IUU A;  8AT1 B;  3ER0 A;  4XTY A;  2B8A A;  1VQL Q;  1VQ4 Q;  2R58 A;  4C0D C;  4IUQ A;  1QWN A;  2D4C A;  1W2B P;  1MMA A;  3A8G B;  2CSI A;  5GMK e;  4AFZ C;  1HK9 A;  3L2W A;  1S1N A;  2YLA A;  2L3P A;  3OBY A;  1R0C B;  2D6F A;  2G3R A;  2XKO C;  2HZY A;  1VQP T;  4RTV A;  1LQ7 A;  4M75 B;  4FZS A;  1QCF A;  3I55 A;  3LGF A;  4QT7 A;  1C6V X;  4UC4 A;  2WSE E;  4M7A C;  2JN0 A;  2K2V A;  5D6W A;  1RAH B;  2CS7 A;  4E7H A;  1FMW A;  5LJ3 e;  1BCM A;  3NMZ C;  2RHY A;  5GAO n;  4KBM B;  1Y71 A;  2LX9 A;  1UEC A;  1Q81 C;  3OMG A;  3V8K A;  5GAN 7;  3CCQ T;  1UEB A;  3CCL A;  4L5G A;  1AVZ C;  2O88 A;  2D8H A;  3CBP A;  2CGH A;  5GAN e;  5C0M A;  2H3E B;  3MKD A;  1OA0 A;  3EH2 A;  2QGF B;  2L89 A;  4F01 A;  4EZX A;  4CRI A;  3D51 A;  1OPK A;  3EJQ A;  3NGP A;  2PUK B;  1KQS S;  3OS0 A;  2Q13 A;  2EYZ A;  4QVD A;  1S72 A;  5KH6 A;  5J3B A;  4J5Y A;  4M78 G;  2IVW A;  3OYC A;  2HL5 C;  5M9O A;  4ELY C;  2LCL A;  4BB7 A;  4KUD K;  4LUE A;  1G8X A;  2CYZ B;  5KYU A;  4M7D G;  3R6N A;  1YHQ A;  1E6H A;  1UDL A;  3RKW A;  2YIV X;  1FMV A;  2MAM A;  1NE8 A;  3DPO A;  4CI0 C;  5DM7 R;  2FRW A;  4PKC C;  1K8A C;  2CZ1 B;  3OW2 A;  4PJO C;  2P84 A;  5IXF A;  1PCX A;  2X4Y A;  3OSV A;  3GIB A;  2HBW A;  3BY7 A;  5J26 A;  1OEB A;  1K73 R;  4C8Q F;  2VV5 A;  1ZUY A;  4FSX A;  4EZZ A;  2RJF A;  3C12 A;  4RUG A;  3UF4 A;  1Q82 C;  3RV0 A;  5I22 A;  3QPH A;  2F1B A;  1NBE B;  5FU6 B;  1ZBX A;  3VEB A;  2JW4 A;  3VEA A;  1TH7 A;  1MJG A;  2VUB A;  1PRM C;  2K3Y A;  2HEQ A;  4EMH A;  4E3C A;  2QK0 A;  3HHT B;  5GMK h;  3SWN B;  2DEU A;  5KYY B;  1M90 R;  3FIF A;  1M2O A;  3V7S A;  2YLL A;  1YFN A;  1KD1 U;  3RIR A;  4IWQ A;  5C5B B;  2KSS A;  3MEU A;  3ASK A;  2DBM A;  4ANJ A;  2YRD A;  1VQ5 A;  1X6B A;  4OMQ A;  4DBQ A;  3OYY A;  2MPX C;  2JTM A;  1YIJ A;  2HCK A;  5LJ3 h;  2X9H A;  1T3L A;  3I39 X;  3QWE A;  2DO3 A;  2FG0 A;  2JM8 A;  3M4G A;  1SU8 A;  4FZO A;  1NPR A;  3RKY A;  4JWC A;  1BK2 A;  2DE0 X;  2CH4 A;  4ZN1 A;  3TSZ A;  4C8Q A;  1J3T A;  1URU A;  5TKY A;  1SSF A;  3L42 A;  4C92 E;  4FM3 A;  4G6Q A;  1QKX A;  4E7S A;  1HJD A;  4DBH A;  1AWJ A;  3H41 A;  1VQL A;  1VQ4 A;  3EGX B;  2QA4 Q;  4JN4 A;  3LVT A;  3MPU B;  4N0A C;  1QCO A;  1OX8 A;  3HRU A;  1QP3 A;  1D3B A;  1T0H A;  5GJW B;  4Z88 A;  5LJ3 d;  5GAO r;  1U1S A;  4I1Q A;  1YJW T;  1XJW B;  4JLC A;  1I1J A;  3CME T;  3VUZ A;  2JS0 A;  3X26 B;  1YJN T;  1HXD A;  4K11 A;  3CCU A;  2X4X A;  3A8H B;  3BFM A;  3A98 A;  1GNT A;  1DKZ A;  1D09 B;  5IHK A;  2I0N A;  1JJ2 S;  1HD3 A;  5GAN j;  3QZ5 B;  2QDL A;  3CBO A;  2FZK B;  3TQ7 P;  2DA9 A;  3SWN A;  2YL6 A;  1SRL A;  5GAN d;  2LJ0 A;  4HVV A;  3G9G A;  5IH2 A;  3HRT A;  1TUC A;  2H8H A;  4HT9 A;  4M75 C;  2J05 A;  3OYA A;  2XMF A;  4IUV A;  4J8O A;  3TCJ A;  3S3N A;  1TUD A;  3I04 A;  4J83 A;  4H6H A;  2VKN A;  2YLC A;  3REA B;  3WXM B;  4AZ6 A;  3EJS A;  5FRN A;  2E70 A;  4M0M A;  2A3L A;  1D1A A;  3PIO A;  2VVK A;  3FJP A;  2BKD N;  1TQV A;  2EFK A;  1E1D A;  1WIE A;  4XQ3 A;  2ATC B;  2M0O A;  2KYB A;  2QEX Q;  2DL7 A;  4AZC A;  2CKK A;  1EX4 A;  2Q12 A;  3O3N B;  4IM3 A;  1NJI R;  2OO2 A;  3NHN A;  1RAE B;  2LM0 A;  3Q0K A;  1QVF S;  3RBB B;  2EW3 A;  5LJ5 j;  1UUE A;  1K0S A;  3DKM A;  3G4S T;  3VRY A;  2HAX A;  1M27 C;  4KUL A;  4FCY A;  1ARK A;  3LH0 A;  2F7P A;  2HNI A;  1RLP C;  3SD4 A;  4AG1 C;  1W2B A;  2WSF E;  1ZSG A;  2D0N A;  1Q7Y C;  5HCK A;  4WCI A;  2CRE A;  3L1A A;  3QDF A;  8ATC B;  1ZUK A;  2OBM A;  1ZX6 A;  3GPL A;  4OB3 B;  1G2B A;  2XU8 A;  3S3M A;  1TTH B;  2MWP A;  4MZT A;  3OYI A;  2AKL A;  3OYH A;  1WYX A;  2FZC B;  1M3C A;  3RMQ A;  1VQ8 T;  2YKT A;  3BUP A;  1QVG P;  1U8R A;  3LW5 E;  4KIK A;  2CZ7 B;  2RJC A;  3DX0 A;  1OI1 A;  2GTO A;  4C8Q C;  4DQ2 A;  1YJ9 Q;  1RAA B;  3UPU A;  4M7A D;  1VQN T;  4E7I A;  5DLO A;  4DYL A;  3I5R A;  1KIK A;  2OTL T;  3QWX X;  1TSF A;  3BVU A;  4PL6 A;  5D6Y A;  2AZV A;  3QXE B;  4GLK A;  2DL4 A;  2DTO A;  4M78 E;  2QAZ A;  2PZ1 A;  5FU6 C; 
#chains in the Genus database with same CATH homology
 1K1Z A;  2JNS A;  3H0H A;  3UA6 A;  4GBQ A;  3I35 A;  2J7I A;  1NEG A;  5EC7 A;  1MUZ A;  3M0R A;  2YIB A;  1W9M A;  4LUD A;  1SPK A;  1H3H A;  4J9F A;  4EZV A;  1VYT A;  1RUW A;  2BTT A;  2KRN A;  1K9A A;  1NLO C;  4R5I A;  1BBZ A;  4EZN A;  2FO0 A;  5FWB A;  4CC2 A;  4Z89 A;  5L23 A;  1PKT A;  1WLP B;  2FRY A;  1NEB A;  2B86 A;  3EGU A;  1RLQ C;  1K76 A;  2WIN M;  4UDX X;  2JXB A;  4H6I A;  1UJY A;  2CT4 A;  2AK5 A;  2C0O A;  5FWC A;  2EWF A;  4KIK B;  3M0Q A;  2YI8 A;  1QWE A;  1VYU A;  1UG1 A;  1YNZ A;  2DLP A;  2F2X A;  3PVL A;  5FW9 A;  1H8K A;  2K79 A;  1Z9Q A;  2LQW A;  1CKA A;  3KFV A;  4E81 A;  5IXB A;  1UPX A;  2BZY A;  4PO2 A;  2KXD A;  2ND1 A;  4IW0 A;  2K2M A;  4J9E A;  2C0T A;  1N5Z A;  1OV3 A;  1YN8 A;  1E6G A;  4IM2 A;  3LMF A;  2DMO A;  1CKB A;  4EZS A;  1KFZ A;  4M4Z A;  3QNJ A;  1XOV A;  1PKS A;  1PWT A;  2AZS A;  2LMJ A;  2KEA A;  4OMM A;  4JJB A;  2D8J A;  2W0Z A;  4AFU C;  3THK A;  2K9G A;  1NG2 A;  5IHI A;  3B52 X;  1AOJ A;  4OMP A;  4EZU A;  3REB B;  1FYN A;  3TVT A;  2OAW A;  4R5J A;  2V1R A;  2YI9 A;  3EG2 A;  4EZY A;  2KGT A;  2W10 A;  4D8K A;  4JZ4 A;  1W1F A;  1AZE A;  1V1C A;  3PE0 A;  3PVQ A;  4D8D A;  4NPH A;  5FLE X;  1AD5 A;  2JS2 A;  2OI3 A;  2EGA A;  1WXU A;  3I01 A;  4Z8A A;  1UGV A;  4HVU A;  2ED0 A;  3EHQ A;  1JXO A;  1YWO A;  4AG2 C;  5FIG A;  1GFC A;  2DBK A;  4JJD A;  5GJV B;  2YT6 A;  2G6F X;  2LCS A;  2Z8Y A;  1JU5 C;  4RTY A;  2KHO A;  1U00 A;  2GBQ A;  4IM0 A;  2EGE A;  2L3S A;  2CDT A;  2ED1 A;  1SU6 A;  2EPD A;  4RTX A;  2RNA A;  2DM1 A;  2KXC A;  2RQU A;  4JNE A;  1Y57 A;  4LN2 A;  1YP5 A;  2YUO A;  5IHN A;  2EBP A;  4EIK A;  1K0X A;  1UFF A;  1UHC A;  1U3O A;  2EGC A;  2DL3 A;  2ENM A;  4HVW A;  2GQI A;  2JTE A;  2DNU A;  1AWO A;  2SRC A;  2RQW A;  2GTJ A;  2CUB A;  3VS2 A;  1H92 A;  4AFS C;  1K4U S;  1DKY A;  1VA7 A;  3LH5 A;  2CSI A;  2J06 A;  2MOX A;  4F14 A;  1RI9 A;  4AFZ C;  2KR3 A;  3T4A G;  4ESR A;  1S1N A;  1X27 A;  2L3P A;  1T3S A;  1UTI A;  3C0C A;  4J9I A;  3M0P A;  4EZP A;  4R0K A;  2C0I A;  4GLM A;  2EVR A;  4J9G A;  1SRM A;  4RTV A;  1ABQ A;  2YIA A;  1PRL C;  1QCF A;  1A0N B;  4JNF A;  2FEI A;  2LX7 A;  4QT7 A;  1GCQ A;  3FJ5 A;  2RF0 A;  2ND0 A;  2DRK A;  2L0A A;  1GNL A;  2DL5 A;  1M3A A;  1B07 A;  3TSW A;  3IQL A;  3NPF A;  2DYB A;  3NMZ C;  2KRM A;  4F17 A;  2PY6 A;  1UEC A;  3VS3 A;  1FMK A;  4X1V A;  3M0T A;  4RTT A;  3EG1 A;  4DEX A;  3SEM A;  3EG0 A;  1AVZ C;  2RMO A;  1NYG A;  4ORZ A;  2DJQ A;  2JM9 A;  2O88 A;  2GGR A;  3VS5 A;  4EZQ A;  2D8H A;  2YSQ A;  1M30 A;  3H0F A;  2LJ1 A;  3H0I A;  4JPB W;  1OA0 A;  1M8M A;  1KSW A;  1PNJ A;  2EYX A;  2JT4 A;  3SHW A;  1SUF A;  1JO8 A;  4F01 A;  3D2F A;  4EZX A;  3VS4 A;  4F00 A;  1OPK A;  3QA8 A;  3KAV A;  3NGP A;  1B3Q A;  2D1X A;  1GN9 A;  1SSH A;  2CH4 W;  2EYZ A;  2PNI A;  3O3O B;  3DPP A;  2K7A A;  4J9H A;  4HR1 A;  2DF6 A;  1NM7 A;  1GBQ A;  2LJ3 A;  4LUE A;  2SEM A;  3R6N A;  4OMN A;  1E6H A;  4JL9 A;  1PHT A;  1UDL A;  1HSQ A;  2YIV X;  4FSS A;  4LNP A;  3DPO A;  1QLY A;  1LCK A;  4DEY A;  2A28 A;  2L2P A;  4CC4 B;  2KNB B;  2FRW A;  2KRO A;  2X3X D;  3KAW A;  1UE9 A;  1WFW A;  2YDL A;  4E6R A;  3ZED A;  2CSQ A;  1W6X A;  1TG0 A;  2NWM A;  1JEG A;  1G83 A;  3M0S A;  4CC7 A;  2KBT A;  1OAO A;  5IXF A;  2DL8 A;  4HYB A;  2EQI A;  1SHF A;  4RTW A;  4KRT A;  2DVJ A;  2HBW A;  1OPL A;  4LE9 A;  3VKH A;  1YCS B;  1OEB A;  2RT6 A;  4J9C A;  5ECA A;  4OMO A;  1YWP A;  1ZUY A;  1VYV A;  2YUP A;  2K3B A;  4EZZ A;  3UF4 A;  1SU7 A;  4RUG A;  2E5K A;  4JWE A;  3RV0 A;  5I22 A;  2N3K A;  3VEB A;  2JW4 A;  3VEA A;  1MJG A;  3EHR A;  2X5C A;  4IIO A;  4Y92 A;  1PRM C;  3GBQ A;  2HEQ A;  2LP5 A;  1X6G A;  3B51 X;  4OML A;  2P4R A;  4IWP A;  4E3C A;  2J6F A;  2KE9 A;  1NLP C;  4J9B A;  4HR1 B;  2FPF A;  2OBL A;  2J6O A;  4J9D A;  1I0C A;  4IWQ A;  2EYW A;  4JZ3 A;  3T46 A;  1Y0M A;  3L3O M;  2DBM A;  1I07 A;  3ER9 B;  1ZYL A;  1WDX A;  1X6B A;  4OMQ A;  4ZNX A;  2HCK A;  4EZO A;  1GRI A;  2DRM A;  3I9Q A;  1T3L A;  3I39 X;  2V1Q A;  1M3B A;  3RV1 A;  2FG0 A;  2RQR A;  3D2E A;  1WA7 A;  2JM8 A;  2M51 A;  1SU8 A;  2BZX A;  2BZ8 A;  4JWC A;  1BK2 A;  1IO6 A;  2DE0 X;  1GL5 A;  3T48 A;  2PTK A;  2CH4 A;  2O2O A;  2RQT A;  3TSZ A;  1E9V A;  1J3T A;  2GNC A;  3FD9 A;  5TKY A;  4FM3 A;  1Z9Z A;  1AZG B;  4F16 A;  4G6Q A;  2GAF D;  1QKX A;  1X69 A;  1HJD A;  1AWJ A;  3H41 A;  1U5S A;  4HCK A;  5I11 A;  3F7W A;  4JN4 A;  1BU1 A;  1MV0 B;  2ECZ A;  3I5S A;  4B9Q A;  2K6D A;  3CQT A;  1T0H A;  5GJW B;  2IIM A;  4Z88 A;  1X2K A;  1QKW A;  3JV3 A;  3RNJ A;  1QWF A;  4RTZ A;  4JLC A;  1AWX A;  1I1J A;  2JS0 A;  4K11 A;  4IIM A;  4R5G A;  1W70 A;  3O5Z A;  1DKX A;  1X43 A;  2ESW A;  5E84 A;  3B53 X;  3A98 A;  1GNT A;  1DKZ A;  5IHK A;  4CC3 A;  2CT3 A;  2KT1 A;  2I0N A;  1CSK A;  4JJC A;  3U23 A;  1HD3 A;  2QDL A;  3UIT A;  4HY9 A;  2A36 A;  3OHX M;  2DA9 A;  4D8J A;  1SRL A;  3ER8 C;  2HSP A;  2LJ0 A;  4HVV A;  3EG3 A;  1WI7 A;  3ERC C;  2F2W A;  5IH2 A;  1TUC A;  2H8H A;  1AWW A;  3ZL7 C;  2KRS A;  2J05 A;  2J6K A;  4JWI A;  2XMF A;  2A08 A;  3C7N A;  1WXB A;  4IWO A;  1TUD A;  2O9V A;  3I04 A;  4H6H A;  2LNH B;  2VKN A;  2ABL A;  3REA B;  4M0M A;  2FPE A;  3VS0 A;  4EZT A;  2VVK A;  3QWY A;  4EZW A;  2O9S A;  3KDR A;  1E1D A;  1WIE A;  1GBR A;  2KYB A;  1JXM A;  1ABO A;  2DL7 A;  2O31 A;  2EX3 B;  3VS7 A;  2RPN A;  4JWD A;  1E2U A;  3T49 A;  2ROT A;  2YUN A;  1OA1 A;  3T47 A;  2QXL A;  3O3N B;  4IM3 A;  1MV3 A;  3NHN A;  2LM0 A;  1SEM A;  3RBB B;  2EW3 A;  2MCN A;  1UUE A;  1K0S A;  4EZR A;  3GI7 A;  2YUQ A;  3VRY A;  1JQK A;  3OWG A;  1M27 C;  2EKH A;  3ULR B;  1ARK A;  4AFQ C;  2QFF A;  1GCP A;  1RLP C;  1ZBJ A;  2A37 A;  4AG1 C;  4RTU A;  1ZSG A;  2D0N A;  2RQV A;  5HCK A;  1OOT A;  4WCI A;  3VRZ A;  2GA9 D;  2CRE A;  1JQQ A;  1ZLM A;  1ZUK A;  4R5L A;  2OBM A;  1BB9 A;  2DX1 A;  2ROL A;  1ZX6 A;  2AKK A;  1G2B A;  3UAT A;  1T0J A;  4A63 B;  2EYY A;  2AKL A;  3O3M B;  2KT8 A;  3DPQ A;  1WYX A;  1M3C A;  2NCZ A;  1GCQ C;  2RN8 A;  2L3Q A;  1EFN A;  2HDA A;  1WXT A;  1NYF A;  4KIK A;  2MIO A;  2M0Y A;  1AEY A;  2GTO A;  2JMC A;  2CUD A;  2FPD A;  2NUZ A;  4HXJ A;  1ZUU A;  1SHG A;  4UDY X;  2LZ6 B;  1KIK A;  3I5R A;  4R5K A;  1E7O A;  1KJW A;  2KYM A;  3VS1 A;  1UHF A;  2VWF A;  3QWX X;  1X2Q A;  3VS6 A;  2LQN A;  2AZV A;  2F2V A;  2DIL A;  3M0U A;  1UJ0 A;  1WX6 A;  1GFD A;  2X3W D;  2DL4 A;  2OJ2 A;  1U06 A;  2JMA A;  2PZ1 A;  3UA7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...