3A98A

Crystal structure of the complex of the interacting regions of dock2 and elmo1
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
168
structure length
157
Chain Sequence
GMAPWRKADKERHGVAIYNFQGSGAPQLSLQIGDVVRIQETCGDWYRGYLIKHKMLQGIFPKSFIHIKEVIPAEIPLAQEVTTTLWEWGSIWKQLYVASKKERFLQVQSMMYDLMEWRSQLLSGTLPKDELKELKQKVTSKIDYGNKILELDLIVRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of functional complex formation between DOCK2 and ELMO1 for Rac activation in lymphocyte chemotaxis
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Dedicator of cytokinesis protein 2
total genus 45
structure length 157
sequence length 168
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-10-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.350 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3a98A02
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3a98A01
4CC7A 2M51A 5IXBA 1ZUKA 2J05A 4J9BA 1KFZA 2L2PA 2C0TA 2DVJA 2RF0A 4F17A 1HSQA 1IO6A 2FO0A 4OMMA 1WI7A 2CUDA 1AD5A 3EG3A 3ULRB 2D8JA 2ECZA 2JM9A 4AFUC 2ESWA 4OMLA 2JS0A 2MIOA 1VYVA 1X43A 2DBKA 4RTZA 3VS3A 1OV3A 2GTJA 1QWEA 3M0PA 3M0TA 2YUQA 1KJWA 1CSKA 3FJ5A 4J9DA 2O2OA 3REAB 1RLQC 2SEMA 1B07A 3EHRA 1G2BA 4D8DA 3H0HA 3UF4A 2HEQA 4GLMA 2FEIA 4CC3A 1SHGA 4E6RA 1GRIA 1T0HA 2DA9A 1XOVA 2A28A 1I07A 4JPBW 1ABQA 1E6HA 1K4US 1WDXA 1ARKA 2VVKA 2CT3A 1ZUUA 1Y0MA 2FPFA 2ENMA 3I9QA 2RN8A 2DF6A 3R6NA 1G83A 1GBRA 4QT7A 4Y92A 2LJ3A 2JW4A 3I35A 1WXBA 2W0ZA 3EGUA 1SPKA 1UGVA 1ZLMA 2KNBB 1NLOC 1PHTA 5GJWB 2HDAA 2RPNA 4FSSA 1T3SA 1MUZA 2AK5A 5I22A 4RTYA 2EYWA 2KXDA 4J9GA 4J9FA 2EBPA 3RNJA 4OMNA 4D8KA 2K79A 3PVQA 4F14A 1X6BA 2LJ1A 2O9SA 4HVUA 1AWOA 2CT4A 4DEYA 3EHQA 4ESRA 2C0IA 3I5SA 5FW9A 2EQIA 1KIKA 1RUWA 3U23A 3EG2A 1RI9A 2DRMA 2F2XA 4LN2A 4JZ4A 4AFQC 1TUCA 1OEBA 2B86A 2RQUA 2DMOA 1AEYA 1OOTA 4WCIA 2I0NA 1AWWA 2AZSA 1WLPB 1AZGB 1WYXA 1GL5A 1PWTA 2D8HA 2LQNA 2KRNA 2RQWA 2BZYA 2D1XA 4M4ZA 3SEMA 1GCQC 2GNCA 2DL5A 2LQWA 1WFWA 2L3QA 4JJBA 1CKAA 1K0XA 1UDLA 3I5RA 1ABOA 2KR3A 2A36A 3QWYA 1JO8A 2LMJA 2RQTA 2KRSA 1B3QA 2H8HA 1W1FA 1YWPA 1NLPC 1UHFA 2DILA 2J06A 1PRMC 1YN8A 1JU5C 2YSQA 1ZBJA 3H41A 1JEGA 1AOJA 4JZ3A 2CSIA 2EGCA 2PZ1A 2G6FX 2DLPA 2EPDA 2XMFA 2A37A 3M0QA 2JMAA 2M0YA 2CH4A 1NEGA 1SHFA 2NUZA 1WXUA 2AZVA 4OMPA 2VWFA 2YUOA 1PKTA 2K3BA 1OPKA 1U3OA 5I11A 2HSPA 4RTUA 2DL4A 3TSZA 1UJ0A 2O88A 2O9VA 2ED1A 1K9AA 4KRTA 4Z88A 3CQTA 1E7OA 2DBMA 1ZSGA 1HJDA 2DL3A 1ZUYA 2FRYA 2EYYA 1FMKA 1UTIA 4Z89A 1PRLC 4OMOA 1SSHA 2ROLA 4J9CA 1QCFA 2K9GA 1H92A 2CDTA 3M0SA 1UHCA 4Z8AA 1U5SA 4IIOA 1JQQA 1SRLA 1K1ZA 4RTWA 2L0AA 5EC7A 1TG0A 4RUGA 3M0UA 2FPDA 1AWXA 3KFVA 2NWMA 1AWJA 1QKXA 2J6OA 1GCPA 2K6DA 1PKSA 2JMCA 3A98A 1M3AA 3M0RA 2YDLA 1LCKA 1WX6A 1VYUA 1JXMA 2JXBA 2DL8A 2CSQA 2KYMA 3JV3A 4GBQA 2E5KA 2DX1A 3VS2A 2BZ8A 1H8KA 2JM8A 3NPFA 1N5ZA 1NM7A 3EG0A 4DEXA 1YCSB 2CH4W 1EFNA 1WA7A 1M3BA 2DL7A 1E6GA 3NGPA 4HVWA 3RBBB 5L23A 1BBZA 2P4RA 2X3XD 1UUEA 1BB9A 4ZNXA 1JXOA 3EG1A 2V1QA 4J9EA 1W70A 3C0CA 2JT4A 2F2WA 1BK2A 2GGRA 3NMZC 3UATA 3GBQA 3VS7A 1QWFA 2RMOA 2L3SA 1SRMA 4HVVA 2ABLA 3IQLA 1UECA 4AG2C 4J9HA 2J6FA 4R0KA 4RTTA 4OMQA 1U06A 2GQIA 5IHNA 3H0FA 3SHWA 2EYXA 2DNUA 1TUDA 5IH2A 2K2MA 3QWXX 4RTVA 1FYNA 4EIKA 1X2KA 1T3LA 4HXJA 3O5ZA 1UFFA 2ED0A 2MCNA 1YNZA 2HCKA 1Z9ZA 5ECAA 1S1NA 4RTXA 3UA6A 2D0NA 5GJVB 1QKWA 2KT8A 2KROA 2QDLA 2RNAA 2YUPA 2A08A 1GCQA 2LNHB 2BTTA 2F2VA 4ORZA 4F16A 1VYTA 1QLYA 4HCKA 2FG0A 2DM1A 4X1VA 1K76A 2GBQA 2IIMA 1CKBA 2LX7A 1AVZC 2J6KA 1M30A 2FPEA 4CC4B 2PTKA 1J3TA 1X69A 2EVRA 2LJ0A 1W6XA 5IHKA 2ROTA 2LP5A 4LUEA 3PVLA 3VS4A 1H3HA 3TVTA 2KYBA 3REBB 4LUDA 1K0SA 2DE0X 2PNIA 3THKA 3ZL7C 2KXCA 2YT6A 3VS5A 2KT1A 4AG1C 1BU1A 3VS1A 1AZEA 2JS2A 2EYZA 2W10A 2MOXA 3TSWA 2LZ6B 5IHIA 4K11A 1KSWA 1UE9A 1UJYA 2L3PA 1M8MA 1WIEA 2EGEA 2VKNA 1NG2A 1A0NB 2RQRA 1Z9QA 2JTEA 2SRCA 4AFSC 1X2QA 2HBWA 2BZXA 2J7IA 2DJQA 5IXFA 1Y57A 1I1JA 2OAWA 2KEAA 4LNPA 1OPLA 3PE0A 2EGAA 2EW3A 2KBTA 1GBQA 2X3WD 5FWCA 3VS6A 3LH5A 2AKKA 1ZX6A 2KE9A 4LE9A 4IIMA 3VS0A 3NHNA 2GTOA 1X6GA 2V1RA 3UA7A 2CUBA 2CREA 1GFCA 3VRZA 4JJDA 1HD3A 1NEBA 4CC2A 1UG1A 1I0CA 1NYGA 1WXTA 1NYFA 1YWOA 2FRWA 1MV3A 2DRKA 2OJ2A 2KRMA 4J9IA 2K7AA 4JJCA 2DYBA 1V1CA 2YUNA 2C0OA 2O31A 1M27C 1YP5A 1SEMA 2EKHA 3VRYA 1M3CA 1X27A 2LCSA 2RQVA 1T0JA 1RLPC 3H0IA 1VA7A 4A63B 4AFZC 1MV0B 5FWBA 2AKLA 2OI3A 1PNJA 1GFDA 5HCKA 2KGTA
chains in the Genus database with same CATH superfamily
2F7OA 4IM0A 1QMCA 4F01A 3E19A 4J9BA 3EGDB 1YIJQ 3GLXA 1D3BA 4C5IA 2DVJA 4F17A 4EMGA 1HSQA 1PS3A 2HKNA 2XG8D 2FO0A 1YIJA 1VQ4A 4JRQA 1WI7A 3MKDA 1YFNA 5EG2A 4FL6A 4JWEA 1YJNA 3ULRB 4M78F 3VEAA 4EMKB 1RACB 2JM9A 2JS0A 4F7UG 1OV3A 3OYLA 1QWEA 2DXTA 3M0PA 1R33A 1YIJT 2QI2A 8ATCB 3FJ5A 2KDSA 3MO8A 4BDZA 2RHUA 4UDXX 2C06A 1B07A 2VC8A 4D8DA 4OGEA 2F1AA 3R6OA 1Y07A 3UF4A 4GLMA 1KQ1A 5GANh 4A4GA 4E47A 2LT4A 4CC3A 4M7DC 1KQSA 3JSCA 1K8AC 3MCAB 4AZCB 4AMCA 3LH0A 2ZAEA 1OQKA 5AT1B 1ABQA 3RDVA 1E6HA 5CKEA 1K4US 5KCOA 1WDXA 3E9FA 4HCCA 2YLBA 1Y0MA 2ENMA 5C5BB 2GFAA 5LL6S 3R6NA 1V29B 4R5LA 4KULA 3G1JA 4Y92A 3LX7A 2YL5A 4ATMA 3JCMf 1ZLMA 3KUFA 2KNBB 2NUPA 3CZNA 3BVTA 2RPNA 3MJXA 4PJNA 5M9OA 1MUZA 5GAOm 2DO3A 2KXDA 4J9GA 4Y91A 5GAMe 1JJ2P 1ZBXA 4D8KA 2K79A 4Y28E 1IHWA 4V2SA 1QP3A 2YL9A 1AWOA 1BI3A 2CT4A 2WINM 3CBMA 1NZ9A 4XU2A 4PJMA 4ESRA 2LC4A 1VQ8Q 5I2SA 4M7DE 2BE7D 1M2VA 2FICA 1VQKA 3ZEDA 1TUCA 4E81A 1I4DA 4IWPA 2DMOA 2IG0A 1WLPB 3E9GA 4JLGA 1WYXA 2QGGA 2D8HA 2Z0VA 1WHHA 2RQWA 4IKFA 4M4ZA 1MJGA 2EFLA 2NLUA 4QQDA 2DL5A 1M1GA 3QXEB 4AZIA 3O3NB 3CC2Q 5GAMf 5IN1A 3SWNB 1CKAA 4ZTFA 1VQ8A 3I5RA 2B8AA 1D0YA 2A36A 2RQTA 2KRSA 2F1BA 2ZPGB 1W1FA 3O3OB 2KVQG 4IUUA 4OB1B 4NL3A 1UHFA 1YJWA 1YN8A 3SWNA 3EJQA 3EJTA 3EGXB 1M90C 5GAN5 3BW1A 2YI8A 4A53A 2XMFA 1M2VB 1ZQ1A 1NEGA 3EJPA 1YCYA 5LJ5f 1WXUA 2AZVA 3QA8A 1PKTA 5I11A 3FRNA 3CCEA 2HSPA 1SG5A 2KMTA 5GAOp 4E2FB 1UJ0A 2O88A 1YHQA 1V76A 5KYUA 3I55Q 3CCMA 4XTYA 4F00A 4KRTA 3CCSA 3CCJT 4LDWA 4LDXA 3QJ6A 4J83A 3GNGA 2RM4A 1YITT 2QFFA 4OMOA 1QCFA 2K9GA 4ZGJB 3M0SA 2H3EB 3OSSC 4E7HA 4F7UE 3BUDA 1VQ9T 3EFRA 4RTWA 1BI0A 1Y96B 3BFMA 2L0AA 2OAUA 3HHTB 1TG0A 1R5EA 1D0ZA 1B34B 1M9SA 1WQWA 1AWXA 2NUPB 3KFVA 2DZCA 2J6OA 3F7WA 1VQMQ 2BKDN 4AT1B 4FZSA 4EZYA 4WF2A 2XDDA 3OYGA 4HCZA 4JWDA 3M53A 3ER9B 1WX6A 3DX2A 2JXBA 2DL8A 3JV3A 3FDRA 4GBQA 2E5KA 2YIBA 1O9SA 3VS2A 1IHVA 1W2BS 2A7YA 3CPWP 3QZ9B 3RMSA 3CD6A 2M02A 1WA7A 1M3BA 2DL7A 4M7DG 3WVEB 3RBBB 5L23A 1G8XA 1Q86U 4A4HA 1MMAA 2ZPFB 1OAOA 2DAQA 3DDFA 2YI9A 4Z02A 4JDSA 2K57A 4ZNXA 3ABHA 2V1QA 3QJYA 2QEXA 1WQ7A 3JCMb 4EMKA 1W70A 4QVCA 4XQ3A 4IM3A 3X20B 1VQ7T 3EJSA 1VQ6Q 4RKUE 3ACOA 4PFOA 3OWGA 4JNEA 1BI2A 2LVMA 3JCMe 3D51A 4B9WA 4C0DB 1EIFA 5IHNA 2YKTA 2EYXA 1QWNA 1U8RA 5D7UA 5IH2A 2K2MA 2EJGA 4IM2A 2HSEB 3OS1A 1I49A 3I2WA 3TQ7P 5GAOq 4HXJA 5GAN2 2OO2A 1QVGS 1XTDA 2FYKA 3HRSA 2HD0A 2VGMA 2PY6A 1DKZA 3GIBA 3SYVA 3UA6A 1VQLT 2DEQA 5GJVB 4XTZA 5DY9A 4MMLA 4IW0A 3C12A 4C92C 3JB9G 1YI2A 1LVKA 4KUIA 1O75A 2F2VA 4F16A 1HWWA 1QLYA 4BE2A 5IAYA 4X1VA 3QYGB 3CCQQ 3URGA 4C8QF 6AT1B 2Z8YA 1NPRA 1CKBA 2CP3A 2L5QA 1M1KU 1WJRA 3UWNA 3G71T 4AZ5A 2F7PA 1J3TA 1X69A 3H6ZA 3CC4T 3CMAQ 4PFZA 2K5IA 2R5MA 1W6XA 2ZXQA 2DEUA 2ROTA 3VS4A 3E1SA 3CCJA 4M78A 3PIPA 1KQ2A 2DE0X 3CCMT 2VB6A 2KXCA 2YT6A 1UGRB 3VS5A 2KY9A 1FWZA 2RAKA 3DKMA 3M54A 2P84A 1BU1A 3L2RA 2JS2A 2A0FB 2EYZA 2W10A 3DPPA 2RI5A 4N4GA 1MMNA 4BI3A 2XICA 3CCVA 3V7RA 1UE9A 1UJYA 3GOXA 1WIEA 4R5GA 3EJRA 2M9UA 4FIBA 2X9HA 1Z9QA 4JJNK 2MWPA 4IWQA 2J7IA 2QQAA 1X6OA 2QTXA 1YHQQ 2OAWA 2QASA 2KEAA 4QKUA 4X9CA 1FMWA 3PE0A 5CO7A 2EGAA 4AZHA 2BUDA 2X4JA 3HSBA 3G9GA 2AKKA 2E3IA 1ZX6A 1W9MA 4IIMA 1Q82U 4JLCA 4M7DD 3CCST 3S3MA 2GTOA 5LJ5e 5KYNA 3UA7A 2E70A 1QVGA 2CREA 1GFCA 4JJDA 2VXEA 1NEBA 4CC2A 1UG1A 2L3RA 1Q86C 1VQPQ 2MMPA 3SFMA 1TH7A 2OJ2A 4KT0E 5KYWB 4PO2A 4MMKA 4FYXB 1BCMA 5J3BA 1V1CA 2RK1A 2XHCA 2LNVA 2DXCA 4DOWA 4IUQA 1PD0A 1YP5A 2RJEA 4PJOG 3OYEA 3H0IA 4M75G 1VA7A 2HQEA 4GY5A 1Y71A 2D6FA 1YJNT 3CD6Q 1PNJA 2MWOA 5GMKh 1KD1C 4I1QA 4EMHA 4NSWA 2DD5A 3FB9A 2J05A 3OYIA 3JCMc 1Q81C 1I5OB 1ZA2B 1VQPT 3OMGA 2C0TA 4R55A 3CCLQ 2RHIA 3F70A 4DBRA 5L8RE 4OMMA 4E7LA 1AD5A 3CV5A 3HP9A 4F7UA 2RHYA 4PJLA 1VQKQ 4HY9A 4JS5A 2HMAA 4DCNC 3NTKA 3ZFJA 1VQ6A 2ZZDA 4EZWA 3SDZA 3X28B 2YRDA 3ER0A 2KQWA 4BI4A 4RCCA 4J9DA 1QW1A 4WPEA 1RLQC 3EHRA 3L2UA 3EFOA 4C5GA 1VQ5Q 5AYFA 3H0HA 2HEQA 3ZBDA 2L8DA 2WYIA 3MEAA 3M4YA 3CCJQ 4C0ZA 2FEIA 1OI1A 1HXDA 4E6RA 2DA9A 3I55T 1VQOT 3GP8A 3JCMh 3LLRA 1VQ9A 4JS4A 2LM0A 1URUA 2CT3A 1VQ9Q 3I01A 1EZZB 3LVTA 5GAMj 2P0KA 2X4XA 4JRKA 5LJ3d 1GBRA 4C92G 2DVEA 3OS0A 3JB9D 3FIFA 3HFNA 3X25B 1OX8A 1E9VA 3DLMA 2E6NA 1IGQA 4EZTA 3V8LA 1LNXA 5GJWB 3FJPA 1QWUA 5CCAA 5GMKj 4J9FA 3L3OM 4ANJA 3OYDA 3CCRQ 4M7AD 4F14A 1F1BB 1X6BA 4HVUA 1Q86R 4QQGA 1M90R 4II1A 2NCZA 3EHQA 3HFOA 1I4TA 3I5SA 5FW9A 3BVWA 3QKJA 2OW6A 4JL9A 5HK0A 3U23A 4L5GA 2DRMA 2F2XA 4JZ4A 1R34A 4AFQC 1YJNQ 2QG9B 3VKIA 5C0MA 2I0NA 4M75D 1AZGB 2GQVA 1N8RC 3V7CA 4JNFA 4PL6A 2E12A 3SEMA 4EZQA 3X26B 1GCQC 2GNCA 3T48A 3PMTA 4C8QA 1WFWA 4N4HA 1RL2A 1K8AU 1BIAA 3T47A 2YRVA 1AHJB 1UDLA 1LOJA 4H8SA 4D6WA 1JO8A 3D52A 2MI6A 1VQPA 1G3SA 2EFKA 2E1HA 4HT8A 1B3QA 5A0GA 1YWPA 4GLKA 2E41A 4IURA 1VQ5A 1PRMC 1O7DC 3LWIA 1W4SA 3BE3A 4KGXB 1JEGA 1AOJA 2HBPA 2X35A 2G6FX 2DLPA 5KH6A 1YHQT 3M0QA 3OBYA 2JMAA 4EZPA 4C92A 1AT1B 2QA4Q 5FIGA 2NUZA 4OMPA 5GANe 3EG9B 4XU3A 1U3OA 2CZ7B 2K3BA 4R5KA 2DL4A 3MEVA 1WHKA 2O9VA 1N8RR 4AZ6A 2RO0A 1K9AA 4Z88A 4X34A 3CQTA 3CMEQ 1E7OA 2DBMA 1XJWB 1YI2Q 4M78B 3I55A 4VUBA 3VYGA 3OYNA 3CCMQ 1H3ZA 1FMKA 4Z89A 1G3TA 2RB6A 2K3YA 1H92A 2CDTA 1LQ7A 1UHCA 1C0MA 1U5SA 4MZMA 3TCJA 3NTHA 1I81A 3CVRA 3INZA 3M0UA 2FPDA 3CC7A 4AZBA 2R57A 4ZGDB 1VQOQ 2VV5A 3C4SA 3DDGA 2FZCB 1AWJA 2I2LA 2LXYA 4RG2A 1PKSA 2CP0A 3LWHA 3PIOA 2CZ6B 3DX3A 2JMCA 3V8KA 3M0RA 2K5LA 4N0AA 4BY6C 4L59A 2ZPIB 2EWNA 4OB3B 2KYMA 3PMIA 3OYMA 2ND1A 4DBHA 4PJOF 2HZYA 2KSSA 2BZ8A 1JJ2S 3NPFA 4M75F 1NM7A 1IRXA 3DX0A 4EZUA 1EFNA 1E6GA 3NGPA 2Q12A 4HVWA 4UDYX 5FU6B 3QHSA 3ZEHA 4XU1A 2EYQA 4N4IA 2YRCA 3JB9I 4BNEA 3BVXA 4J9EA 3JRZA 2GA9D 3C0CA 2NUTA 1I8FA 1JBMA 2GGRA 3NMZC 3UATA 1VQ5T 4FT4A 1TSFA 2LDMA 2LQ8A 2RMOA 2L3SA 4FZPA 1ZYLA 1SRMA 3IQLA 1KQSP 2O4XA 3M4GA 1K73U 3DPQA 2MYSA 2RHXA 2J6FA 4PJOC 5GAMg 2GQIA 2E64A 2DNUA 2RD1A 2JNGA 2RI2A 3QZ5B 1FYNA 3RUXA 3QNIA 4M77A 1PD1A 1ZA1B 3LYIA 4C0GA 2Z0NA 3RMQA 2MCNA 1YNZA 3L2WA 2HCKA 4KH0B 5ECAA 4FT2A 2YXYA 4WTOB 3CCQA 2ZPHB 2RNAA 5GANj 1GCQA 1YITA 1KQSS 3EAEA 1PCXA 2HQXA 2FL7A 3EG9A 5LJ5g 2FG0A 5CAIA 2DM1A 2RJCA 4PJOA 1K76A 1B34A 4BD3A 1PC0A 1KHIA 2IIMA 2J6KA 4FM4B 1WPYA 2AT1B 3T4AG 3HRTA 4C0DC 2V8JA 1C6VX 4M78G 3PVLA 3VJPA 3QO3A 2F5KA 1MNDA 3OS2A 2KYBA 1N9RA 3RV1A 5KYXA 1K0SA 3ZL7C 5FU7C 4DBQA 1PSEA 4IUPA 1FMVA 3VS1A 1AZEA 2CZ0B 2CZ1B 1TQWA 3P8DA 4R5IA 2QDYB 3UPUA 4NS5A 3JB9H 2MOXA 4C8QB 2LZ6B 3JCMQ 4K11A 2F7QA 2L3PA 3O8VA 4C92D 5IT9E 2VKNA 3L2VA 3G4SA 5LJ5j 3CC2A 1KD1R 2SRCA 2QXLA 1X2QA 1XQHA 2BZXA 3H8ZA 1RAFB 1M1KC 2M16A 1Y57A 2GF7A 3A1PA 5D6WA 3OK8A 3EJUA 2EW3A 2PMRA 3TEEA 2KBTA 1GBQA 5FWCA 3VS6A 1TUGB 3LH5A 2K2VA 1QVFP 3T49A 2DD4A 2KE9A 4LE9A 1KD1U 1Q7YU 3NHNA 2OZNB 3MEWA 2V1RA 4F04B 5CKHA 2XU8A 3A8MB 1I0CA 1QX1A 1NYGA 1NYFA 2FZGB 1E1DA 1MV3A 1W2BP 3RPMA 4FYWB 4EZSA 2HKQB 2K7AA 1YITQ 3CMAT 3CC7Q 5FRNA 1H641 2X4WA 2YUNA 2QEXT 5LJ3e 1QCNA 4XTUA 3RR6A 2EKHA 3VRYA 1NJIR 1VQ7A 2GFUA 1BKBA 1Y7XA 2ZPBB 3CCRA 1HYOA 2QQSA 1TTHB 3CMEA 4AFZC 1NBEB 5FWBA 2IVWA 2X3VA 2JJ9A 2OI3A 2RJFA 2OTJQ 2KGTA 2QA4T 1UGSB 3CCVT 4CC7A 3EFSA 3EFOB 1VOMA 5IXBA 1NJIU 1KFZA 2L2PA 3G71A 4PJJA 5CKFA 2QTVA 4HYBA 2QQ9A 3E2UA 3T9NA 3G71Q 3EH2A 2K5FA 2JOYA 2CGHA 2D8JA 2ECZA 4AFUC 4OMLA 3JCMd 2DTHA 2MIOA 3S6WA 1VYVA 1X43A 4RTZA 3CXCA 3VS3A 5DM7R 2NYSA 4F7UB 1R77A 3M0TA 3SB2A 1UGQB 3KDRA 1MGQA 5LJ3f 3CPWA 4ZTJA 5TKYA 2QKWA 4EPCA 1CSKA 1VIEA 3OW2A 4FW2A 3EH1A 4M77E 3REAB 5C5BA 4QVZA 3CC2T 1G2BA 1X75C 3D4YA 3OHXM 1ACMB 2EQJA 2O4XB 2PU9B 4EMKC 4JUVA 3FD9A 2ZCFB 1R0BG 1GRIA 1T0HA 3CKDA 1UEBA 4PFPA 4FW1A 2DXBA 5I2MA 2JNKA 4JPBW 2ATCB 4HCBA 2XI9A 1S72T 2M1HA 4TVRA 4C92E 3L42A 3I9QA 2RN8A 3GI7A 4E7ZA 2DZ9A 1G83A 1WJQA 1TU0B 4QT7A 2BE9B 1VQ8T 1PSFA 1UGVA 1QP2A 1NLOC 2KAFA 3G4SQ 1T3SA 3DPOA 2FHDA 1QQJA 2JTFA 2AK5A 4RTYA 4HA8A 2EYWA 3MP1A 4EZZA 2FB7A 2LCCA 2LT1A 2CP2A 2KHOA 2EBPA 1VQKT 5FLEX 3CC4A 2LJ1A 3HAJA 3QDFA 4DEYA 3EGDA 1K9MR 5KE3A 2JNSA 3DYTA 1I4K1 1MMGA 4HKEA 1UB4A 2PVGB 3RKYA 1TOVA 2X3XA 1SU8A 2QGFB 1OEBA 1YI2T 4XK8E 4ELYC 2JTMA 1AEYA 3I56T 4WCIA 2AZSA 5CIUA 2Q13A 1U1SA 1U00A 4KIKA 4M75C 2V0OA 4J6XA 5FROA 4WPCA 1SSFA 1GL5A 2LQNA 4FU6A 1VQMA 3ASKA 2H3JA 3FLGA 3QPHA 4P5NA 2D1XA 3CAZA 3CCUQ 4IUTA 3G6EQ 2FYVA 4M0MA 4M7DB 4EZXA 5KE2A 1N6AA 2FZKB 3OB9A 4PK4A 3LMFA 2LQWA 2L3QA 3MPUB 3G7ZA 1K0XA 3CMET 5CVIA 5E84A 3OY9A 1KK7A 3QWYA 3Q1JA 4E3CA 3OYAA 1OU8A 2H8HA 3D7SB 1IREB 3CCSQ 2VGNA 2J06A 1JU5C 5A2QE 2YSQA 1ZBJA 2QYZA 2GCXA 3H41A 3OMCA 3OQ5A 4JZ3A 3RKXA 3BDUA 2CSIA 2PZ1A 2AIRB 2YLLA 2A37A 5CQXA 1I5LA 2M0YA 2BIVA 2XIDA 1SHFA 4G6QA 1RAEB 1FXXA 3M3WA 2FVUA 2Y4YA 1JB0E 1GNTA 2XK0A 2YUOA 3I56A 3CD6T 5CKBA 3CCRT 1KC8C 1DKXA 3UITA 3M56A 4AKVA 1BYMA 4M7AA 2ED1A 3ERCC 3GNFB 2COYA 1JQKA 1ZSGA 5I21A 1TQSA 5HY6A 2DL3A 1ZUYA 2FRYA 2EYYA 1UTIA 5DLOA 1SSHA 2DERA 3BUQA 3M57A 1N9SA 3A8HB 1X01A 1VQ4Q 4H6HA 1D1CA 3DB4A 3JCMX 2F7RA 2V8KA 4IIOA 1D0XA 1JQQA 1SRLA 4ZN3A 1QCOA 3QUIA 5EC7A 4RUGA 2WACA 2JUFA 5CK9A 4J5YA 3CXCS 3NFCA 2NWMA 3OYBA 2K6DA 3M59A 9ATCB 1K73C 1D1AA 2E4HA 3M9QA 4ELZC 2YDLA 1LCKA 4KGZB 1ZWWA 1TWBA 2DX1A 3ME9A 3BUIA 2LQKA 3EG0A 1KHCA 4DEXA 2CH4W 1OA1A 2OW7A 4EZNA 3NTIA 1UPXA 2P4RA 2QK0A 2EQMA 1OZ3A 2RH2A 3B53X 1WGSA 1O7DB 1JXOA 3VV0A 2JT4A 3CCLT 2F2WA 1BK2A 5FU7B 4FYVB 3BVVA 1QVFS 3VS7A 1QWFA 2EFIA 3OS5A 2OTJT 2QQRA 3GF5A 3VEBA 1UECA 3G6ET 3FC3A 4J9HA 4BUGA 4R0KA 2D9TA 1U06A 1TQTA 3SHWA 1TUDA 3LW5E 7AT1B 2QAZA 3QWXX 3L2QA 4RTVA 5GMKl 5CKDA 1T3LA 1K73R 1R0CB 4XU0A 2Y4XA 4NQIA 2HQHA 1UFFA 2ED0A 2OTLT 3META 2OBLA 1Z9ZA 4M78C 1RABB 5LJ3h 2YLCA 3L2ZA 1EX4A 4RTXA 5LJ5d 3WXMB 5KYUB 1QKWA 2EKOA 3I04A 4N0AC 2KROA 4BDYA 2QDLA 4J8OA 3CBOA 3X24B 2O01E 3EGXA 1C1AA 2O0I1 3JAME 3WVDB 3DX1A 3PNWC 4C0FA 4MZTA 1VQMT 2OTLA 3DB3A 1AVZC 2LX7A 2KK4A 3OW2P 3OYFA 4A4KA 1M30A 5GAMh 2EVRA 2WSEE 2LJ0A 1IZ6A 4ATOA 2OTJA 4LUEA 3L3PA 1H3HA 3REBB 4LUDA 3S3OA 3S3NA 2PNIA 3OYYA 3THKA 4JWIA 2LRQA 1VQNT 5KYWA 4AG1C 5GMKi 5A0DA 1YJWQ 2DETA 1M4ZA 3MHXA 5KYYB 4A4FA 1Q81U 5J26A 2QEXQ 3UDCA 4M77F 4MDWA 1WHGA 1KSWA 2JVVA 5FU6C 2EGEA 2L89A 1NG2A 1A0NB 3PLTA 2RQRA 3JCMg 3Q84A 4EZRA 5KYXB 4M78D 2MPXC 2YWWA 2DJQA 4XTXA 5CQYA 5IXFA 1Q81R 3SWNC 3C95A 1XNIA 4KBMB 4LNPA 5GAN4 1U1TA 2E6ZA 2HL5C 4KGVB 3G4ST 4FM3A 1M1FA 4A4EA 3DLLA 1GNLA 2LX9A 2PUOB 5LJ3j 4BACA 2VYTA 1ZSZA 1WXTA 4LD6A 1WNLA 1YJ9A 3JCMJ 2FRWA 4B9QA 2DRKA 2D0QB 2Y90A 1Q7YR 2KRMA 4JRIA 1Q82C 4J9IA 4B6MA 5FRMA 2GAFD 4E7KA 4JJCA 3RIRA 2DYBA 2DTOA 3CCUT 2C0OA 4PJOB 3I39X 1SEMA 1WJSA 1PG5B 1X27A 4LDYA 4JLIA 2LCSA 4AZCA 3JCMV 1T0JA 1OX9A 3J80E 2HNIA 3CCQT 4C5HA 5FLXE 1K8AR 3JCMP 3Q0KA 1HK9A 4A63B 5GAN3 3JB9F 1MV0B 1SU7A 4M7AE 2AKLA 5HK3A 2MI7A 3ER8C 1GFDA 2RAJA 3A5ZB 2M51A 3MEUA 2P4TA 1ZUKA 3TREA 3VUZA 2ELBA 4XTVA 2DFUA 3OBWA 2RT6A 4C8QG 5GAOn 4EDUA 2CS7A 2RF0A 3VUBA 4C8QE 1IO6A 3HTRA 1E2UA 3P8BB 2CUDA 4M78E 3VU3C 2NUTB 3EG3A 2YLAA 4M7AG 5A0LA 2K4YA 4OVAA 5C6SA 4JWCA 2ESWA 2PQWA 3OYJA 2DBKA 2Z0OA 2GTJA 2YIAA 2YUQA 3QSUA 2YL6A 4DOVA 4BY6B 4L6V5 1KJWA 3VYHB 1OZ2A 5HKCA 2O2OA 3G6EA 1RAAB 2JN0A 1K9MC 3L1AA 4C8QC 1M8VA 1FX7A 2SEMA 3JCMW 2F1LA 1R8OB 3BDLA 4PKCC 1IGUA 3AT1B 2P0PA 3KXTA 4OP0A 1S72Q 1GN9A 1HTYA 1SHGA 4M7AC 2CYZB 1XOVA 2A28A 2EAYA 1WZOA 1VIFA 2X3WA 1I07A 1D3BB 3I56Q 2RA2A 2PVDB 4JRPA 1ARKA 2YL8A 2OX7A 1I4LA 2VVKA 4OGCA 1ZUUA 4OB0B 2FPFA 2DF6A 3D2FA 3HKSA 1N27A 4PLLA 2QA4A 1NPPA 2DTIA 2LJ3A 1KG1A 2JW4A 3I35A 1WXBA 2W0ZA 3D4ZA 3EGUA 3M55A 4OB2B 1SPKA 4OMFB 4FZOA 3D50A 1PHTA 2EJ9A 2CP6A 2HDAA 4FSSA 4LDUA 3BUPA 5GANg 5I22A 1SKUB 2QQBA 3VKHA 3FEOA 4J7IA 3RNJA 4OMNA 1M2OA 3RERA 3PVQA 4J7FA 3KAWA 1QVFA 2O9SA 3T46A 3SD4A 3KBGA 4NPHA 1VQLQ 2C0IA 2V8IA 2EQIA 3LGFA 1Q7YC 1Q82R 4C8QD 1YJ9Q 1KIKA 1RUWA 2COWA 3EG2A 2VUBA 4C92B 1Y96A 1RI9A 1MNEA 4LN2A 1W2BA 5GMKm 2N3KA 2B86A 2DJZA 1VQOA 2RQUA 5GAOr 4M77C 1OOTA 4RG8A 1AWWA 4M75A 4X9DA 1KC8R 3HL8A 3KAVA 2DYIA 4D8JA 4EZOA 1ZSZB 1PWTA 1M5Q1 2KRNA 2EQKA 2BZYA 2ND0A 4M7DA 3QNJA 2VXFA 3M58A 2DXUA 2MAMA 1ZSZC 1VQ6T 3OA6A 4JJBA 2V26A 4BI8B 1ABOA 2KR3A 3CPFA 2D4CA 2LMJA 2R5AA 1MMDA 3V7SA 2R58A 3UT1A 3OYCA 1NLPC 2EJFA 3GPLA 2F18A 3QYHB 2DILA 4PJOD 1VUBA 4PNOA 5KYYA 4RCBA 4E7IA 2F69A 8AT1B 1G3WA 2EGCA 2EX3B 1D1BA 1LPLA 2RJDA 2EPDA 4FYYB 2EIFA 2HL3A 3HAIA 4B9XA 2K3XA 2CH4A 5J39A 4J6YA 4ZGEB 3QE6A 4IWOA 5LJ3g 5GAMd 1IXDA 4R5JA 1OU9A 2COZA 4XAXB 3BVUA 1BIBA 2VWFA 1OPKA 3BLBA 4MZPA 4KH1B 4RTUA 2IPOB 3TSZA 4C92F 2P0QA 2E65A 2WYHA 4KUDK 1RI0A 1HJDA 3CPWS 2M0OA 3PT9A 5LJ5h 2DIQA 4O6JA 5D6YA 1PRLC 2ROLA 4E7JA 1YJ9T 4J9CA 3TU4K 3MP6A 4F7UF 1JRIA 2DKGA 2KI7A 4Z8AA 1SUFA 3OW2S 4DA4A 1K1ZA 3BUBA 2D1LA 1OYXA 4R56A 4EZVA 2HAXA 2RK2A 4LD9K 2C08A 4AZ7A 1WHJA 1DJ7B 1QKXA 1Q95G 3LLLA 4M77D 1GCPA 2ZGWA 2AHJB 1Y2OA 1D09B 4AVMA 3SOGA 2YIVX 1WHLA 3A98A 1M3AA 2EQUA 1NE8A 2JZ2A 1JJ2A 1VYUA 2LTOA 1JXMA 4ME7A 2CSQA 4UC4A 4E7SA 3OSVA 3J7AF 2JM8A 1H8KA 2WSCE 1N5ZA 4CRIA 1OULA 1YCSB 1WDZA 2XDPA 4QVDA 2A3LA 5DLQE 1BBZA 2E3HA 5GAN6 2X3XD 1QVGP 4JN4A 1RAGB 1M90U 4RMOA 1UUEA 3OYKA 1BB9A 3CCET 2DPPB 3EG1A 3LGLA 3C94A 2OBMA 4PLIA 1DKYA 3HAHA 3CCUA 4DYLA 3GBQA 1TQUA 4M7AF 4BE0A 3PFSA 4HVVA 2ABLA 4AG2C 4BB7A 2CP5A 3B52X 3AHUA 2X5CA 2RHZA 4RTTA 4OMQA 4LDVA 3H0FA 3PGGA 3QG1A 1VQNA 4NL2A 3DX4A 4FCYA 4IUVA 4EIKA 1X2KA 1RADB 2ZPEB 3O5ZA 4Q5WA 3A8GB 3P8HA 1S72A 1RAIB 2VASA 3N5BB 4ZN1A 1S1NA 5GAOl 1P92A 2D0NA 1YWMA 1TXQA 3PTAA 2MF2A 1M1KR 2KT8A 2OTLQ 2YUPA 2A08A 1SF9A 2LNHB 2BTTA 4ORZA 1VYTA 2G3RA 5KCHA 4HCKA 2DIGA 1MHNA 3RESA 2GBQA 3D2EA 2GF4A 3CCLA 1X03A 2XDBA 1OA0A 1VQNQ 1ZHIA 4CC4B 2FPEA 2PTKA 4OF1A 1BCOA 4C5EA 2E5QA 1VQ4T 5KBPA 5GANf 5IHKA 2CKKA 2LP5A 2E10A 3A8LB 3CEYA 2F5TX 1IB8A 4HR1A 3TVTA 1N8RU 4LXCA 3J81E 2YHTA 2PVOB 3CMAA 4M7AB 1UGPB 5GMKe 2KT1A 3M5AA 1QVPA 3MP8A 1YJWT 5CR2A 1NJIC 3BY7A 4MDXA 3A8OB 4M75E 3C7NA 3CC7T 3TSWA 1G3YA 4BE1A 4PJOE 3QWEA 5IHIA 4CI0C 5GANd 1M8MA 2CP7A 2ALWA 2JTEA 4AFSC 2HBWA 2X4YA 2MK5A 4NOYA 4XTWA 5GAN7 1I1JA 1RAHB 4M75B 1OPLA 3CBPA 4QQ6A 3QIIA 2WSFE 3OYHA 2X3WD 3CXCP 2X51A 1X04A 1YBYA 2RI3A 4YTLA 1K9MU 3VS0A 4DBFA 3HPWA 4O5VA 1TQVA 4QW2A 5D6XA 3RKWA 1X6GA 4J6WA 1SU6A 3O3MB 2CUBA 3QBYA 2RAIA 3VRZA 4H6IA 1HD3A 1BI1A 2LCLA 1PM3A 1LJOA 2EWFA 1HXKA 1WHMA 2XKOC 4M77B 4HT9A 3HRUA 1YWOA 3QDRB 1G5VA 4DQ2A 1KC8U 2PUKB 2XD0A 3CCVQ 3RV0A 3V8JA 1B7TA 4A54A 4M77G 4AZGA 1VQLA 3CC4Q 5GAN8 1VQ7Q 1TS9A 3JB9J 4HR1B 2O31A 4KIKB 1M27C 3CZSA 1M3CA 2RQVA 3CCEQ 1RLPC 3B51X 2Z0WA 4FSXA 2QXFA 4M7DF 2DK3A 3H9NA 1GXIE 5HCKA
chains in the Genus database with same CATH topology
4CC7A 2M51A 5IXBA 1ZUKA 4IM0A 4F01A 2J05A 4J9BA 1KFZA 2L2PA 2RT6A 2C0TA 2DVJA 2RF0A 4F17A 4HYBA 1HSQA 1IO6A 2FO0A 4OMMA 1E2UA 1WI7A 2CUDA 1AD5A 3EG3A 4JWEA 3ULRB 3VEAA 2D8JA 2ECZA 4HY9A 2JM9A 4AFUC 4JWCA 2ESWA 4OMLA 2JS0A 2MIOA 1VYVA 1X43A 2DBKA 4RTZA 3VS3A 1OV3A 2GTJA 1QWEA 3M0PA 2YIAA 3M0TA 2YUQA 4EZWA 3KDRA 1KJWA 5TKYA 1CSKA 3FJ5A 4J9DA 2O2OA 3REAB 4UDXX 1RLQC 2SEMA 1B07A 3EHRA 1G2BA 4D8DA 3H0HA 3UF4A 2HEQA 3OHXM 4GLMA 3FD9A 2FEIA 4CC3A 1GN9A 1SHGA 4E6RA 1GRIA 1T0HA 2DA9A 1XOVA 2A28A 1I07A 4JPBW 2LM0A 1ABQA 1E6HA 1K4US 1WDXA 1ARKA 2VVKA 2CT3A 1ZUUA 1Y0MA 3I01A 2FPFA 2ENMA 3I9QA 2RN8A 2DF6A 3D2FA 3GI7A 3R6NA 1G83A 4R5LA 1GBRA 4QT7A 4Y92A 2LJ3A 2JW4A 3I35A 1WXBA 2W0ZA 3EGUA 1E9VA 1SPKA 1UGVA 1ZLMA 4EZTA 2KNBB 1NLOC 1PHTA 5GJWB 2HDAA 2RPNA 4FSSA 1T3SA 3DPOA 1MUZA 2AK5A 5I22A 4RTYA 3VKHA 2EYWA 4EZZA 2KXDA 4J9GA 4J9FA 2EBPA 2KHOA 4OMNA 3L3OM 3RNJA 4D8KA 5FLEX 2K79A 3PVQA 4F14A 1X6BA 3KAWA 2LJ1A 2O9SA 4HVUA 1AWOA 3T46A 2CT4A 2WINM 4NPHA 4DEYA 2NCZA 3EHQA 4ESRA 2C0IA 3I5SA 5FW9A 2EQIA 2JNSA 4JL9A 1KIKA 1RUWA 3U23A 3EG2A 1RI9A 2DRMA 3ZEDA 2F2XA 4JZ4A 4LN2A 4AFQC 1SU8A 1TUCA 2N3KA 4E81A 1OEBA 2B86A 4IWPA 2RQUA 2DMOA 1AEYA 1OOTA 4WCIA 2I0NA 1AWWA 2AZSA 1WLPB 1U00A 3KAVA 4KIKA 1AZGB 1WYXA 4D8JA 4EZOA 1GL5A 1PWTA 2D8HA 2LQNA 2KRNA 2RQWA 2BZYA 2D1XA 4JNFA 2ND0A 4M4ZA 3QNJA 4M0MA 4EZXA 3SEMA 4EZQA 1MJGA 1GCQC 2GNCA 3T48A 2DL5A 3LMFA 2LQWA 3O3NB 1WFWA 2L3QA 3T47A 4JJBA 1CKAA 1K0XA 1UDLA 3I5RA 5E84A 1ABOA 2KR3A 2A36A 3QWYA 4E3CA 1JO8A 2LMJA 2RQTA 2KRSA 1B3QA 2H8HA 1W1FA 3O3OB 1YWPA 1NLPC 1UHFA 2DILA 2J06A 1PRMC 1YN8A 1JU5C 2YSQA 1ZBJA 3H41A 1JEGA 1AOJA 4JZ3A 2CSIA 2EGCA 2EX3B 2PZ1A 2G6FX 2DLPA 2YI8A 2EPDA 2XMFA 2A37A 3M0QA 2JMAA 4EZPA 2M0YA 2CH4A 1NEGA 1SHFA 4G6QA 4IWOA 4R5JA 5FIGA 2NUZA 1WXUA 2AZVA 4OMPA 1GNTA 2VWFA 2YUOA 3QA8A 1PKTA 1U3OA 1OPKA 2K3BA 5I11A 2HSPA 1DKXA 4RTUA 4R5KA 2DL4A 3UITA 3TSZA 1UJ0A 2O88A 2O9VA 2ED1A 3ERCC 1K9AA 4F00A 4KRTA 4Z88A 3CQTA 1JQKA 1E7OA 2DBMA 1ZSGA 1HJDA 2DL3A 1ZUYA 2FRYA 2EYYA 1FMKA 1UTIA 4Z89A 1PRLC 2QFFA 4OMOA 1SSHA 2ROLA 4J9CA 1QCFA 2K9GA 1H92A 2CDTA 3M0SA 1UHCA 4H6HA 4Z8AA 1SUFA 1U5SA 4IIOA 1JQQA 1SRLA 1K1ZA 4RTWA 2L0AA 5EC7A 1TG0A 4RUGA 3M0UA 2FPDA 4EZVA 1AWXA 3KFVA 2NWMA 1AWJA 1QKXA 3F7WA 2J6OA 1GCPA 2K6DA 1PKSA 4EZYA 2YIVX 2JMCA 4JWDA 3A98A 1M3AA 3M0RA 2YDLA 1LCKA 3ER9B 1WX6A 1VYUA 1JXMA 2JXBA 2DL8A 2CSQA 2KYMA 3JV3A 4GBQA 2E5KA 2YIBA 2ND1A 2DX1A 3VS2A 2BZ8A 1H8KA 2JM8A 3NPFA 1N5ZA 1NM7A 3EG0A 4DEXA 1YCSB 2CH4W 1OA1A 4EZUA 1EFNA 1WA7A 1M3BA 2DL7A 1E6GA 3NGPA 4HVWA 4EZNA 3RBBB 5L23A 4UDYX 1BBZA 1UPXA 2P4RA 2X3XD 4JN4A 1OAOA 3B53X 1UUEA 2YI9A 1BB9A 4ZNXA 1JXOA 3EG1A 2V1QA 4J9EA 2GA9D 2OBMA 1W70A 3C0CA 2JT4A 4IM3A 1DKYA 2F2WA 1BK2A 2GGRA 3NMZC 3UATA 3GBQA 3VS7A 3OWGA 1QWFA 2RMOA 2L3SA 1ZYLA 1SRMA 4JNEA 4HVVA 2ABLA 3IQLA 3VEBA 1UECA 4AG2C 3B52X 4J9HA 3DPQA 2J6FA 2X5CA 4R0KA 4RTTA 4OMQA 1U06A 2GQIA 5IHNA 3H0FA 3SHWA 2EYXA 2DNUA 1TUDA 5IH2A 2K2MA 4IM2A 3QWXX 4RTVA 1FYNA 4EIKA 1X2KA 1T3LA 4HXJA 3O5ZA 1UFFA 2PY6A 2ED0A 1YNZA 2MCNA 2OBLA 1DKZA 2HCKA 1Z9ZA 5ECAA 1S1NA 4RTXA 3UA6A 2D0NA 5GJVB 1QKWA 4IW0A 3I04A 2KT8A 2KROA 2QDLA 2RNAA 2YUPA 2A08A 1GCQA 2LNHB 2BTTA 2F2VA 4ORZA 4F16A 1VYTA 1QLYA 4HCKA 2FG0A 2DM1A 4X1VA 1K76A 2GBQA 2IIMA 2Z8YA 3D2EA 1CKBA 1AVZC 2LX7A 1OA0A 2J6KA 1M30A 2FPEA 4CC4B 2PTKA 1J3TA 3T4AG 1X69A 2EVRA 2LJ0A 1W6XA 5IHKA 2ROTA 2LP5A 4LUEA 3PVLA 3VS4A 1H3HA 3TVTA 4HR1A 2KYBA 3REBB 3RV1A 4LUDA 1K0SA 2DE0X 2PNIA 3THKA 3ZL7C 4JWIA 2KXCA 2YT6A 3VS5A 2KT1A 4AG1C 1BU1A 3VS1A 1AZEA 2JS2A 2EYZA 2W10A 3DPPA 4R5IA 3C7NA 2MOXA 3TSWA 2LZ6B 5IHIA 4K11A 1KSWA 1UE9A 1UJYA 2L3PA 1M8MA 1WIEA 4R5GA 2EGEA 2VKNA 1NG2A 1A0NB 2RQRA 1Z9QA 2JTEA 2SRCA 2QXLA 4AFSC 4IWQA 1X2QA 4EZRA 2HBWA 2BZXA 2J7IA 2DJQA 5IXFA 1Y57A 1I1JA 2OAWA 2KEAA 4LNPA 1OPLA 3PE0A 2EGAA 2EW3A 2KBTA 1GBQA 2X3WD 5FWCA 3VS6A 3LH5A 2AKKA 1ZX6A 3T49A 1W9MA 2KE9A 4IIMA 4LE9A 3VS0A 4JLCA 3NHNA 4FM3A 2GTOA 1X6GA 2V1RA 1SU6A 3O3MB 3UA7A 1GNLA 2CUBA 2CREA 1GFCA 3VRZA 4JJDA 4H6IA 1HD3A 1NEBA 4CC2A 2EWFA 1UG1A 1I0CA 1NYGA 1WXTA 1NYFA 1YWOA 2FRWA 1E1DA 4B9QA 1MV3A 2DRKA 2OJ2A 3RV0A 4PO2A 4EZSA 2KRMA 4J9IA 2GAFD 2K7AA 4JJCA 2DYBA 1V1CA 2YUNA 4HR1B 2C0OA 2O31A 4KIKB 3I39X 1M27C 1YP5A 1SEMA 2EKHA 3VRYA 1M3CA 1X27A 2LCSA 2RQVA 1T0JA 1RLPC 3B51X 3H0IA 1VA7A 4A63B 4AFZC 1MV0B 1SU7A 5FWBA 2AKLA 3ER8C 2OI3A 1PNJA 1GFDA 5HCKA 2KGTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CC7 A;  2M51 A;  5IXB A;  1ZUK A;  2J05 A;  4J9B A;  1KFZ A;  2L2P A;  2C0T A;  2DVJ A;  2RF0 A;  4F17 A;  1HSQ A;  1IO6 A;  2FO0 A;  4OMM A;  1WI7 A;  2CUD A;  1AD5 A;  3EG3 A;  3ULR B;  2D8J A;  2ECZ A;  2JM9 A;  4AFU C;  2ESW A;  4OML A;  2JS0 A;  2MIO A;  1VYV A;  1X43 A;  2DBK A;  4RTZ A;  3VS3 A;  1OV3 A;  2GTJ A;  1QWE A;  3M0P A;  3M0T A;  2YUQ A;  1KJW A;  1CSK A;  3FJ5 A;  4J9D A;  2O2O A;  3REA B;  1RLQ C;  2SEM A;  1B07 A;  3EHR A;  1G2B A;  4D8D A;  3H0H A;  3UF4 A;  2HEQ A;  4GLM A;  2FEI A;  4CC3 A;  1SHG A;  4E6R A;  1GRI A;  1T0H A;  2DA9 A;  1XOV A;  2A28 A;  1I07 A;  4JPB W;  1ABQ A;  1E6H A;  1K4U S;  1WDX A;  1ARK A;  2VVK A;  2CT3 A;  1ZUU A;  1Y0M A;  2FPF A;  2ENM A;  3I9Q A;  2RN8 A;  2DF6 A;  3R6N A;  1G83 A;  1GBR A;  4QT7 A;  4Y92 A;  2LJ3 A;  2JW4 A;  3I35 A;  1WXB A;  2W0Z A;  3EGU A;  1SPK A;  1UGV A;  1ZLM A;  2KNB B;  1NLO C;  1PHT A;  5GJW B;  2HDA A;  2RPN A;  4FSS A;  1T3S A;  1MUZ A;  2AK5 A;  5I22 A;  4RTY A;  2EYW A;  2KXD A;  4J9G A;  4J9F A;  2EBP A;  3RNJ A;  4OMN A;  4D8K A;  2K79 A;  3PVQ A;  4F14 A;  1X6B A;  2LJ1 A;  2O9S A;  4HVU A;  1AWO A;  2CT4 A;  4DEY A;  3EHQ A;  4ESR A;  2C0I A;  3I5S A;  5FW9 A;  2EQI A;  1KIK A;  1RUW A;  3U23 A;  3EG2 A;  1RI9 A;  2DRM A;  2F2X A;  4LN2 A;  4JZ4 A;  4AFQ C;  1TUC A;  1OEB A;  2B86 A;  2RQU A;  2DMO A;  1AEY A;  1OOT A;  4WCI A;  2I0N A;  1AWW A;  2AZS A;  1WLP B;  1AZG B;  1WYX A;  1GL5 A;  1PWT A;  2D8H A;  2LQN A;  2KRN A;  2RQW A;  2BZY A;  2D1X A;  4M4Z A;  3SEM A;  1GCQ C;  2GNC A;  2DL5 A;  2LQW A;  1WFW A;  2L3Q A;  4JJB A;  1CKA A;  1K0X A;  1UDL A;  3I5R A;  1ABO A;  2KR3 A;  2A36 A;  3QWY A;  1JO8 A;  2LMJ A;  2RQT A;  2KRS A;  1B3Q A;  2H8H A;  1W1F A;  1YWP A;  1NLP C;  1UHF A;  2DIL A;  2J06 A;  1PRM C;  1YN8 A;  1JU5 C;  2YSQ A;  1ZBJ A;  3H41 A;  1JEG A;  1AOJ A;  4JZ3 A;  2CSI A;  2EGC A;  2PZ1 A;  2G6F X;  2DLP A;  2EPD A;  2XMF A;  2A37 A;  3M0Q A;  2JMA A;  2M0Y A;  2CH4 A;  1NEG A;  1SHF A;  2NUZ A;  1WXU A;  2AZV A;  4OMP A;  2VWF A;  2YUO A;  1PKT A;  2K3B A;  1OPK A;  1U3O A;  5I11 A;  2HSP A;  4RTU A;  2DL4 A;  3TSZ A;  1UJ0 A;  2O88 A;  2O9V A;  2ED1 A;  1K9A A;  4KRT A;  4Z88 A;  3CQT A;  1E7O A;  2DBM A;  1ZSG A;  1HJD A;  2DL3 A;  1ZUY A;  2FRY A;  2EYY A;  1FMK A;  1UTI A;  4Z89 A;  1PRL C;  4OMO A;  1SSH A;  2ROL A;  4J9C A;  1QCF A;  2K9G A;  1H92 A;  2CDT A;  3M0S A;  1UHC A;  4Z8A A;  1U5S A;  4IIO A;  1JQQ A;  1SRL A;  1K1Z A;  4RTW A;  2L0A A;  5EC7 A;  1TG0 A;  4RUG A;  3M0U A;  2FPD A;  1AWX A;  3KFV A;  2NWM A;  1AWJ A;  1QKX A;  2J6O A;  1GCP A;  2K6D A;  1PKS A;  2JMC A;  3A98 A;  1M3A A;  3M0R A;  2YDL A;  1LCK A;  1WX6 A;  1VYU A;  1JXM A;  2JXB A;  2DL8 A;  2CSQ A;  2KYM A;  3JV3 A;  4GBQ A;  2E5K A;  2DX1 A;  3VS2 A;  2BZ8 A;  1H8K A;  2JM8 A;  3NPF A;  1N5Z A;  1NM7 A;  3EG0 A;  4DEX A;  1YCS B;  2CH4 W;  1EFN A;  1WA7 A;  1M3B A;  2DL7 A;  1E6G A;  3NGP A;  4HVW A;  3RBB B;  5L23 A;  1BBZ A;  2P4R A;  2X3X D;  1UUE A;  1BB9 A;  4ZNX A;  1JXO A;  3EG1 A;  2V1Q A;  4J9E A;  1W70 A;  3C0C A;  2JT4 A;  2F2W A;  1BK2 A;  2GGR A;  3NMZ C;  3UAT A;  3GBQ A;  3VS7 A;  1QWF A;  2RMO A;  2L3S A;  1SRM A;  4HVV A;  2ABL A;  3IQL A;  1UEC A;  4AG2 C;  4J9H A;  2J6F A;  4R0K A;  4RTT A;  4OMQ A;  1U06 A;  2GQI A;  5IHN A;  3H0F A;  3SHW A;  2EYX A;  2DNU A;  1TUD A;  5IH2 A;  2K2M A;  3QWX X;  4RTV A;  1FYN A;  4EIK A;  1X2K A;  1T3L A;  4HXJ A;  3O5Z A;  1UFF A;  2ED0 A;  2MCN A;  1YNZ A;  2HCK A;  1Z9Z A;  5ECA A;  1S1N A;  4RTX A;  3UA6 A;  2D0N A;  5GJV B;  1QKW A;  2KT8 A;  2KRO A;  2QDL A;  2RNA A;  2YUP A;  2A08 A;  1GCQ A;  2LNH B;  2BTT A;  2F2V A;  4ORZ A;  4F16 A;  1VYT A;  1QLY A;  4HCK A;  2FG0 A;  2DM1 A;  4X1V A;  1K76 A;  2GBQ A;  2IIM A;  1CKB A;  2LX7 A;  1AVZ C;  2J6K A;  1M30 A;  2FPE A;  4CC4 B;  2PTK A;  1J3T A;  1X69 A;  2EVR A;  2LJ0 A;  1W6X A;  5IHK A;  2ROT A;  2LP5 A;  4LUE A;  3PVL A;  3VS4 A;  1H3H A;  3TVT A;  2KYB A;  3REB B;  4LUD A;  1K0S A;  2DE0 X;  2PNI A;  3THK A;  3ZL7 C;  2KXC A;  2YT6 A;  3VS5 A;  2KT1 A;  4AG1 C;  1BU1 A;  3VS1 A;  1AZE A;  2JS2 A;  2EYZ A;  2W10 A;  2MOX A;  3TSW A;  2LZ6 B;  5IHI A;  4K11 A;  1KSW A;  1UE9 A;  1UJY A;  2L3P A;  1M8M A;  1WIE A;  2EGE A;  2VKN A;  1NG2 A;  1A0N B;  2RQR A;  1Z9Q A;  2JTE A;  2SRC A;  4AFS C;  1X2Q A;  2HBW A;  2BZX A;  2J7I A;  2DJQ A;  5IXF A;  1Y57 A;  1I1J A;  2OAW A;  2KEA A;  4LNP A;  1OPL A;  3PE0 A;  2EGA A;  2EW3 A;  2KBT A;  1GBQ A;  2X3W D;  5FWC A;  3VS6 A;  3LH5 A;  2AKK A;  1ZX6 A;  2KE9 A;  4LE9 A;  4IIM A;  3VS0 A;  3NHN A;  2GTO A;  1X6G A;  2V1R A;  3UA7 A;  2CUB A;  2CRE A;  1GFC A;  3VRZ A;  4JJD A;  1HD3 A;  1NEB A;  4CC2 A;  1UG1 A;  1I0C A;  1NYG A;  1WXT A;  1NYF A;  1YWO A;  2FRW A;  1MV3 A;  2DRK A;  2OJ2 A;  2KRM A;  4J9I A;  2K7A A;  4JJC A;  2DYB A;  1V1C A;  2YUN A;  2C0O A;  2O31 A;  1M27 C;  1YP5 A;  1SEM A;  2EKH A;  3VRY A;  1M3C A;  1X27 A;  2LCS A;  2RQV A;  1T0J A;  1RLP C;  3H0I A;  1VA7 A;  4A63 B;  4AFZ C;  1MV0 B;  5FWB A;  2AKL A;  2OI3 A;  1PNJ A;  1GFD A;  5HCK A;  2KGT A; 
#chains in the Genus database with same CATH topology
 2F7O A;  4IM0 A;  1QMC A;  4F01 A;  3E19 A;  4J9B A;  3EGD B;  1YIJ Q;  3GLX A;  1D3B A;  4C5I A;  2DVJ A;  4F17 A;  4EMG A;  1HSQ A;  1PS3 A;  2HKN A;  2XG8 D;  2FO0 A;  1YIJ A;  1VQ4 A;  4JRQ A;  1WI7 A;  3MKD A;  1YFN A;  5EG2 A;  4FL6 A;  4JWE A;  1YJN A;  3ULR B;  4M78 F;  3VEA A;  4EMK B;  1RAC B;  2JM9 A;  2JS0 A;  4F7U G;  1OV3 A;  3OYL A;  1QWE A;  2DXT A;  3M0P A;  1R33 A;  1YIJ T;  2QI2 A;  8ATC B;  3FJ5 A;  2KDS A;  3MO8 A;  4BDZ A;  2RHU A;  4UDX X;  2C06 A;  1B07 A;  2VC8 A;  4D8D A;  4OGE A;  2F1A A;  3R6O A;  1Y07 A;  3UF4 A;  4GLM A;  1KQ1 A;  5GAN h;  4A4G A;  4E47 A;  2LT4 A;  4CC3 A;  4M7D C;  1KQS A;  3JSC A;  1K8A C;  3MCA B;  4AZC B;  4AMC A;  3LH0 A;  2ZAE A;  1OQK A;  5AT1 B;  1ABQ A;  3RDV A;  1E6H A;  5CKE A;  1K4U S;  5KCO A;  1WDX A;  3E9F A;  4HCC A;  2YLB A;  1Y0M A;  2ENM A;  5C5B B;  2GFA A;  5LL6 S;  3R6N A;  1V29 B;  4R5L A;  4KUL A;  3G1J A;  4Y92 A;  3LX7 A;  2YL5 A;  4ATM A;  3JCM f;  1ZLM A;  3KUF A;  2KNB B;  2NUP A;  3CZN A;  3BVT A;  2RPN A;  3MJX A;  4PJN A;  5M9O A;  1MUZ A;  5GAO m;  2DO3 A;  2KXD A;  4J9G A;  4Y91 A;  5GAM e;  1JJ2 P;  1ZBX A;  4D8K A;  2K79 A;  4Y28 E;  1IHW A;  4V2S A;  1QP3 A;  2YL9 A;  1AWO A;  1BI3 A;  2CT4 A;  2WIN M;  3CBM A;  1NZ9 A;  4XU2 A;  4PJM A;  4ESR A;  2LC4 A;  1VQ8 Q;  5I2S A;  4M7D E;  2BE7 D;  1M2V A;  2FIC A;  1VQK A;  3ZED A;  1TUC A;  4E81 A;  1I4D A;  4IWP A;  2DMO A;  2IG0 A;  1WLP B;  3E9G A;  4JLG A;  1WYX A;  2QGG A;  2D8H A;  2Z0V A;  1WHH A;  2RQW A;  4IKF A;  4M4Z A;  1MJG A;  2EFL A;  2NLU A;  4QQD A;  2DL5 A;  1M1G A;  3QXE B;  4AZI A;  3O3N B;  3CC2 Q;  5GAM f;  5IN1 A;  3SWN B;  1CKA A;  4ZTF A;  1VQ8 A;  3I5R A;  2B8A A;  1D0Y A;  2A36 A;  2RQT A;  2KRS A;  2F1B A;  2ZPG B;  1W1F A;  3O3O B;  2KVQ G;  4IUU A;  4OB1 B;  4NL3 A;  1UHF A;  1YJW A;  1YN8 A;  3SWN A;  3EJQ A;  3EJT A;  3EGX B;  1M90 C;  5GAN 5;  3BW1 A;  2YI8 A;  4A53 A;  2XMF A;  1M2V B;  1ZQ1 A;  1NEG A;  3EJP A;  1YCY A;  5LJ5 f;  1WXU A;  2AZV A;  3QA8 A;  1PKT A;  5I11 A;  3FRN A;  3CCE A;  2HSP A;  1SG5 A;  2KMT A;  5GAO p;  4E2F B;  1UJ0 A;  2O88 A;  1YHQ A;  1V76 A;  5KYU A;  3I55 Q;  3CCM A;  4XTY A;  4F00 A;  4KRT A;  3CCS A;  3CCJ T;  4LDW A;  4LDX A;  3QJ6 A;  4J83 A;  3GNG A;  2RM4 A;  1YIT T;  2QFF A;  4OMO A;  1QCF A;  2K9G A;  4ZGJ B;  3M0S A;  2H3E B;  3OSS C;  4E7H A;  4F7U E;  3BUD A;  1VQ9 T;  3EFR A;  4RTW A;  1BI0 A;  1Y96 B;  3BFM A;  2L0A A;  2OAU A;  3HHT B;  1TG0 A;  1R5E A;  1D0Z A;  1B34 B;  1M9S A;  1WQW A;  1AWX A;  2NUP B;  3KFV A;  2DZC A;  2J6O A;  3F7W A;  1VQM Q;  2BKD N;  4AT1 B;  4FZS A;  4EZY A;  4WF2 A;  2XDD A;  3OYG A;  4HCZ A;  4JWD A;  3M53 A;  3ER9 B;  1WX6 A;  3DX2 A;  2JXB A;  2DL8 A;  3JV3 A;  3FDR A;  4GBQ A;  2E5K A;  2YIB A;  1O9S A;  3VS2 A;  1IHV A;  1W2B S;  2A7Y A;  3CPW P;  3QZ9 B;  3RMS A;  3CD6 A;  2M02 A;  1WA7 A;  1M3B A;  2DL7 A;  4M7D G;  3WVE B;  3RBB B;  5L23 A;  1G8X A;  1Q86 U;  4A4H A;  1MMA A;  2ZPF B;  1OAO A;  2DAQ A;  3DDF A;  2YI9 A;  4Z02 A;  4JDS A;  2K57 A;  4ZNX A;  3ABH A;  2V1Q A;  3QJY A;  2QEX A;  1WQ7 A;  3JCM b;  4EMK A;  1W70 A;  4QVC A;  4XQ3 A;  4IM3 A;  3X20 B;  1VQ7 T;  3EJS A;  1VQ6 Q;  4RKU E;  3ACO A;  4PFO A;  3OWG A;  4JNE A;  1BI2 A;  2LVM A;  3JCM e;  3D51 A;  4B9W A;  4C0D B;  1EIF A;  5IHN A;  2YKT A;  2EYX A;  1QWN A;  1U8R A;  5D7U A;  5IH2 A;  2K2M A;  2EJG A;  4IM2 A;  2HSE B;  3OS1 A;  1I49 A;  3I2W A;  3TQ7 P;  5GAO q;  4HXJ A;  5GAN 2;  2OO2 A;  1QVG S;  1XTD A;  2FYK A;  3HRS A;  2HD0 A;  2VGM A;  2PY6 A;  1DKZ A;  3GIB A;  3SYV A;  3UA6 A;  1VQL T;  2DEQ A;  5GJV B;  4XTZ A;  5DY9 A;  4MML A;  4IW0 A;  3C12 A;  4C92 C;  3JB9 G;  1YI2 A;  1LVK A;  4KUI A;  1O75 A;  2F2V A;  4F16 A;  1HWW A;  1QLY A;  4BE2 A;  5IAY A;  4X1V A;  3QYG B;  3CCQ Q;  3URG A;  4C8Q F;  6AT1 B;  2Z8Y A;  1NPR A;  1CKB A;  2CP3 A;  2L5Q A;  1M1K U;  1WJR A;  3UWN A;  3G71 T;  4AZ5 A;  2F7P A;  1J3T A;  1X69 A;  3H6Z A;  3CC4 T;  3CMA Q;  4PFZ A;  2K5I A;  2R5M A;  1W6X A;  2ZXQ A;  2DEU A;  2ROT A;  3VS4 A;  3E1S A;  3CCJ A;  4M78 A;  3PIP A;  1KQ2 A;  2DE0 X;  3CCM T;  2VB6 A;  2KXC A;  2YT6 A;  1UGR B;  3VS5 A;  2KY9 A;  1FWZ A;  2RAK A;  3DKM A;  3M54 A;  2P84 A;  1BU1 A;  3L2R A;  2JS2 A;  2A0F B;  2EYZ A;  2W10 A;  3DPP A;  2RI5 A;  4N4G A;  1MMN A;  4BI3 A;  2XIC A;  3CCV A;  3V7R A;  1UE9 A;  1UJY A;  3GOX A;  1WIE A;  4R5G A;  3EJR A;  2M9U A;  4FIB A;  2X9H A;  1Z9Q A;  4JJN K;  2MWP A;  4IWQ A;  2J7I A;  2QQA A;  1X6O A;  2QTX A;  1YHQ Q;  2OAW A;  2QAS A;  2KEA A;  4QKU A;  4X9C A;  1FMW A;  3PE0 A;  5CO7 A;  2EGA A;  4AZH A;  2BUD A;  2X4J A;  3HSB A;  3G9G A;  2AKK A;  2E3I A;  1ZX6 A;  1W9M A;  4IIM A;  1Q82 U;  4JLC A;  4M7D D;  3CCS T;  3S3M A;  2GTO A;  5LJ5 e;  5KYN A;  3UA7 A;  2E70 A;  1QVG A;  2CRE A;  1GFC A;  4JJD A;  2VXE A;  1NEB A;  4CC2 A;  1UG1 A;  2L3R A;  1Q86 C;  1VQP Q;  2MMP A;  3SFM A;  1TH7 A;  2OJ2 A;  4KT0 E;  5KYW B;  4PO2 A;  4MMK A;  4FYX B;  1BCM A;  5J3B A;  1V1C A;  2RK1 A;  2XHC A;  2LNV A;  2DXC A;  4DOW A;  4IUQ A;  1PD0 A;  1YP5 A;  2RJE A;  4PJO G;  3OYE A;  3H0I A;  4M75 G;  1VA7 A;  2HQE A;  4GY5 A;  1Y71 A;  2D6F A;  1YJN T;  3CD6 Q;  1PNJ A;  2MWO A;  5GMK h;  1KD1 C;  4I1Q A;  4EMH A;  4NSW A;  2DD5 A;  3FB9 A;  2J05 A;  3OYI A;  3JCM c;  1Q81 C;  1I5O B;  1ZA2 B;  1VQP T;  3OMG A;  2C0T A;  4R55 A;  3CCL Q;  2RHI A;  3F70 A;  4DBR A;  5L8R E;  4OMM A;  4E7L A;  1AD5 A;  3CV5 A;  3HP9 A;  4F7U A;  2RHY A;  4PJL A;  1VQK Q;  4HY9 A;  4JS5 A;  2HMA A;  4DCN C;  3NTK A;  3ZFJ A;  1VQ6 A;  2ZZD A;  4EZW A;  3SDZ A;  3X28 B;  2YRD A;  3ER0 A;  2KQW A;  4BI4 A;  4RCC A;  4J9D A;  1QW1 A;  4WPE A;  1RLQ C;  3EHR A;  3L2U A;  3EFO A;  4C5G A;  1VQ5 Q;  5AYF A;  3H0H A;  2HEQ A;  3ZBD A;  2L8D A;  2WYI A;  3MEA A;  3M4Y A;  3CCJ Q;  4C0Z A;  2FEI A;  1OI1 A;  1HXD A;  4E6R A;  2DA9 A;  3I55 T;  1VQO T;  3GP8 A;  3JCM h;  3LLR A;  1VQ9 A;  4JS4 A;  2LM0 A;  1URU A;  2CT3 A;  1VQ9 Q;  3I01 A;  1EZZ B;  3LVT A;  5GAM j;  2P0K A;  2X4X A;  4JRK A;  5LJ3 d;  1GBR A;  4C92 G;  2DVE A;  3OS0 A;  3JB9 D;  3FIF A;  3HFN A;  3X25 B;  1OX8 A;  1E9V A;  3DLM A;  2E6N A;  1IGQ A;  4EZT A;  3V8L A;  1LNX A;  5GJW B;  3FJP A;  1QWU A;  5CCA A;  5GMK j;  4J9F A;  3L3O M;  4ANJ A;  3OYD A;  3CCR Q;  4M7A D;  4F14 A;  1F1B B;  1X6B A;  4HVU A;  1Q86 R;  4QQG A;  1M90 R;  4II1 A;  2NCZ A;  3EHQ A;  3HFO A;  1I4T A;  3I5S A;  5FW9 A;  3BVW A;  3QKJ A;  2OW6 A;  4JL9 A;  5HK0 A;  3U23 A;  4L5G A;  2DRM A;  2F2X A;  4JZ4 A;  1R34 A;  4AFQ C;  1YJN Q;  2QG9 B;  3VKI A;  5C0M A;  2I0N A;  4M75 D;  1AZG B;  2GQV A;  1N8R C;  3V7C A;  4JNF A;  4PL6 A;  2E12 A;  3SEM A;  4EZQ A;  3X26 B;  1GCQ C;  2GNC A;  3T48 A;  3PMT A;  4C8Q A;  1WFW A;  4N4H A;  1RL2 A;  1K8A U;  1BIA A;  3T47 A;  2YRV A;  1AHJ B;  1UDL A;  1LOJ A;  4H8S A;  4D6W A;  1JO8 A;  3D52 A;  2MI6 A;  1VQP A;  1G3S A;  2EFK A;  2E1H A;  4HT8 A;  1B3Q A;  5A0G A;  1YWP A;  4GLK A;  2E41 A;  4IUR A;  1VQ5 A;  1PRM C;  1O7D C;  3LWI A;  1W4S A;  3BE3 A;  4KGX B;  1JEG A;  1AOJ A;  2HBP A;  2X35 A;  2G6F X;  2DLP A;  5KH6 A;  1YHQ T;  3M0Q A;  3OBY A;  2JMA A;  4EZP A;  4C92 A;  1AT1 B;  2QA4 Q;  5FIG A;  2NUZ A;  4OMP A;  5GAN e;  3EG9 B;  4XU3 A;  1U3O A;  2CZ7 B;  2K3B A;  4R5K A;  2DL4 A;  3MEV A;  1WHK A;  2O9V A;  1N8R R;  4AZ6 A;  2RO0 A;  1K9A A;  4Z88 A;  4X34 A;  3CQT A;  3CME Q;  1E7O A;  2DBM A;  1XJW B;  1YI2 Q;  4M78 B;  3I55 A;  4VUB A;  3VYG A;  3OYN A;  3CCM Q;  1H3Z A;  1FMK A;  4Z89 A;  1G3T A;  2RB6 A;  2K3Y A;  1H92 A;  2CDT A;  1LQ7 A;  1UHC A;  1C0M A;  1U5S A;  4MZM A;  3TCJ A;  3NTH A;  1I81 A;  3CVR A;  3INZ A;  3M0U A;  2FPD A;  3CC7 A;  4AZB A;  2R57 A;  4ZGD B;  1VQO Q;  2VV5 A;  3C4S A;  3DDG A;  2FZC B;  1AWJ A;  2I2L A;  2LXY A;  4RG2 A;  1PKS A;  2CP0 A;  3LWH A;  3PIO A;  2CZ6 B;  3DX3 A;  2JMC A;  3V8K A;  3M0R A;  2K5L A;  4N0A A;  4BY6 C;  4L59 A;  2ZPI B;  2EWN A;  4OB3 B;  2KYM A;  3PMI A;  3OYM A;  2ND1 A;  4DBH A;  4PJO F;  2HZY A;  2KSS A;  2BZ8 A;  1JJ2 S;  3NPF A;  4M75 F;  1NM7 A;  1IRX A;  3DX0 A;  4EZU A;  1EFN A;  1E6G A;  3NGP A;  2Q12 A;  4HVW A;  4UDY X;  5FU6 B;  3QHS A;  3ZEH A;  4XU1 A;  2EYQ A;  4N4I A;  2YRC A;  3JB9 I;  4BNE A;  3BVX A;  4J9E A;  3JRZ A;  2GA9 D;  3C0C A;  2NUT A;  1I8F A;  1JBM A;  2GGR A;  3NMZ C;  3UAT A;  1VQ5 T;  4FT4 A;  1TSF A;  2LDM A;  2LQ8 A;  2RMO A;  2L3S A;  4FZP A;  1ZYL A;  1SRM A;  3IQL A;  1KQS P;  2O4X A;  3M4G A;  1K73 U;  3DPQ A;  2MYS A;  2RHX A;  2J6F A;  4PJO C;  5GAM g;  2GQI A;  2E64 A;  2DNU A;  2RD1 A;  2JNG A;  2RI2 A;  3QZ5 B;  1FYN A;  3RUX A;  3QNI A;  4M77 A;  1PD1 A;  1ZA1 B;  3LYI A;  4C0G A;  2Z0N A;  3RMQ A;  2MCN A;  1YNZ A;  3L2W A;  2HCK A;  4KH0 B;  5ECA A;  4FT2 A;  2YXY A;  4WTO B;  3CCQ A;  2ZPH B;  2RNA A;  5GAN j;  1GCQ A;  1YIT A;  1KQS S;  3EAE A;  1PCX A;  2HQX A;  2FL7 A;  3EG9 A;  5LJ5 g;  2FG0 A;  5CAI A;  2DM1 A;  2RJC A;  4PJO A;  1K76 A;  1B34 A;  4BD3 A;  1PC0 A;  1KHI A;  2IIM A;  2J6K A;  4FM4 B;  1WPY A;  2AT1 B;  3T4A G;  3HRT A;  4C0D C;  2V8J A;  1C6V X;  4M78 G;  3PVL A;  3VJP A;  3QO3 A;  2F5K A;  1MND A;  3OS2 A;  2KYB A;  1N9R A;  3RV1 A;  5KYX A;  1K0S A;  3ZL7 C;  5FU7 C;  4DBQ A;  1PSE A;  4IUP A;  1FMV A;  3VS1 A;  1AZE A;  2CZ0 B;  2CZ1 B;  1TQW A;  3P8D A;  4R5I A;  2QDY B;  3UPU A;  4NS5 A;  3JB9 H;  2MOX A;  4C8Q B;  2LZ6 B;  3JCM Q;  4K11 A;  2F7Q A;  2L3P A;  3O8V A;  4C92 D;  5IT9 E;  2VKN A;  3L2V A;  3G4S A;  5LJ5 j;  3CC2 A;  1KD1 R;  2SRC A;  2QXL A;  1X2Q A;  1XQH A;  2BZX A;  3H8Z A;  1RAF B;  1M1K C;  2M16 A;  1Y57 A;  2GF7 A;  3A1P A;  5D6W A;  3OK8 A;  3EJU A;  2EW3 A;  2PMR A;  3TEE A;  2KBT A;  1GBQ A;  5FWC A;  3VS6 A;  1TUG B;  3LH5 A;  2K2V A;  1QVF P;  3T49 A;  2DD4 A;  2KE9 A;  4LE9 A;  1KD1 U;  1Q7Y U;  3NHN A;  2OZN B;  3MEW A;  2V1R A;  4F04 B;  5CKH A;  2XU8 A;  3A8M B;  1I0C A;  1QX1 A;  1NYG A;  1NYF A;  2FZG B;  1E1D A;  1MV3 A;  1W2B P;  3RPM A;  4FYW B;  4EZS A;  2HKQ B;  2K7A A;  1YIT Q;  3CMA T;  3CC7 Q;  5FRN A;  1H64 1;  2X4W A;  2YUN A;  2QEX T;  5LJ3 e;  1QCN A;  4XTU A;  3RR6 A;  2EKH A;  3VRY A;  1NJI R;  1VQ7 A;  2GFU A;  1BKB A;  1Y7X A;  2ZPB B;  3CCR A;  1HYO A;  2QQS A;  1TTH B;  3CME A;  4AFZ C;  1NBE B;  5FWB A;  2IVW A;  2X3V A;  2JJ9 A;  2OI3 A;  2RJF A;  2OTJ Q;  2KGT A;  2QA4 T;  1UGS B;  3CCV T;  4CC7 A;  3EFS A;  3EFO B;  1VOM A;  5IXB A;  1NJI U;  1KFZ A;  2L2P A;  3G71 A;  4PJJ A;  5CKF A;  2QTV A;  4HYB A;  2QQ9 A;  3E2U A;  3T9N A;  3G71 Q;  3EH2 A;  2K5F A;  2JOY A;  2CGH A;  2D8J A;  2ECZ A;  4AFU C;  4OML A;  3JCM d;  2DTH A;  2MIO A;  3S6W A;  1VYV A;  1X43 A;  4RTZ A;  3CXC A;  3VS3 A;  5DM7 R;  2NYS A;  4F7U B;  1R77 A;  3M0T A;  3SB2 A;  1UGQ B;  3KDR A;  1MGQ A;  5LJ3 f;  3CPW A;  4ZTJ A;  5TKY A;  2QKW A;  4EPC A;  1CSK A;  1VIE A;  3OW2 A;  4FW2 A;  3EH1 A;  4M77 E;  3REA B;  5C5B A;  4QVZ A;  3CC2 T;  1G2B A;  1X75 C;  3D4Y A;  3OHX M;  1ACM B;  2EQJ A;  2O4X B;  2PU9 B;  4EMK C;  4JUV A;  3FD9 A;  2ZCF B;  1R0B G;  1GRI A;  1T0H A;  3CKD A;  1UEB A;  4PFP A;  4FW1 A;  2DXB A;  5I2M A;  2JNK A;  4JPB W;  2ATC B;  4HCB A;  2XI9 A;  1S72 T;  2M1H A;  4TVR A;  4C92 E;  3L42 A;  3I9Q A;  2RN8 A;  3GI7 A;  4E7Z A;  2DZ9 A;  1G83 A;  1WJQ A;  1TU0 B;  4QT7 A;  2BE9 B;  1VQ8 T;  1PSF A;  1UGV A;  1QP2 A;  1NLO C;  2KAF A;  3G4S Q;  1T3S A;  3DPO A;  2FHD A;  1QQJ A;  2JTF A;  2AK5 A;  4RTY A;  4HA8 A;  2EYW A;  3MP1 A;  4EZZ A;  2FB7 A;  2LCC A;  2LT1 A;  2CP2 A;  2KHO A;  2EBP A;  1VQK T;  5FLE X;  3CC4 A;  2LJ1 A;  3HAJ A;  3QDF A;  4DEY A;  3EGD A;  1K9M R;  5KE3 A;  2JNS A;  3DYT A;  1I4K 1;  1MMG A;  4HKE A;  1UB4 A;  2PVG B;  3RKY A;  1TOV A;  2X3X A;  1SU8 A;  2QGF B;  1OEB A;  1YI2 T;  4XK8 E;  4ELY C;  2JTM A;  1AEY A;  3I56 T;  4WCI A;  2AZS A;  5CIU A;  2Q13 A;  1U1S A;  1U00 A;  4KIK A;  4M75 C;  2V0O A;  4J6X A;  5FRO A;  4WPC A;  1SSF A;  1GL5 A;  2LQN A;  4FU6 A;  1VQM A;  3ASK A;  2H3J A;  3FLG A;  3QPH A;  4P5N A;  2D1X A;  3CAZ A;  3CCU Q;  4IUT A;  3G6E Q;  2FYV A;  4M0M A;  4M7D B;  4EZX A;  5KE2 A;  1N6A A;  2FZK B;  3OB9 A;  4PK4 A;  3LMF A;  2LQW A;  2L3Q A;  3MPU B;  3G7Z A;  1K0X A;  3CME T;  5CVI A;  5E84 A;  3OY9 A;  1KK7 A;  3QWY A;  3Q1J A;  4E3C A;  3OYA A;  1OU8 A;  2H8H A;  3D7S B;  1IRE B;  3CCS Q;  2VGN A;  2J06 A;  1JU5 C;  5A2Q E;  2YSQ A;  1ZBJ A;  2QYZ A;  2GCX A;  3H41 A;  3OMC A;  3OQ5 A;  4JZ3 A;  3RKX A;  3BDU A;  2CSI A;  2PZ1 A;  2AIR B;  2YLL A;  2A37 A;  5CQX A;  1I5L A;  2M0Y A;  2BIV A;  2XID A;  1SHF A;  4G6Q A;  1RAE B;  1FXX A;  3M3W A;  2FVU A;  2Y4Y A;  1JB0 E;  1GNT A;  2XK0 A;  2YUO A;  3I56 A;  3CD6 T;  5CKB A;  3CCR T;  1KC8 C;  1DKX A;  3UIT A;  3M56 A;  4AKV A;  1BYM A;  4M7A A;  2ED1 A;  3ERC C;  3GNF B;  2COY A;  1JQK A;  1ZSG A;  5I21 A;  1TQS A;  5HY6 A;  2DL3 A;  1ZUY A;  2FRY A;  2EYY A;  1UTI A;  5DLO A;  1SSH A;  2DER A;  3BUQ A;  3M57 A;  1N9S A;  3A8H B;  1X01 A;  1VQ4 Q;  4H6H A;  1D1C A;  3DB4 A;  3JCM X;  2F7R A;  2V8K A;  4IIO A;  1D0X A;  1JQQ A;  1SRL A;  4ZN3 A;  1QCO A;  3QUI A;  5EC7 A;  4RUG A;  2WAC A;  2JUF A;  5CK9 A;  4J5Y A;  3CXC S;  3NFC A;  2NWM A;  3OYB A;  2K6D A;  3M59 A;  9ATC B;  1K73 C;  1D1A A;  2E4H A;  3M9Q A;  4ELZ C;  2YDL A;  1LCK A;  4KGZ B;  1ZWW A;  1TWB A;  2DX1 A;  3ME9 A;  3BUI A;  2LQK A;  3EG0 A;  1KHC A;  4DEX A;  2CH4 W;  1OA1 A;  2OW7 A;  4EZN A;  3NTI A;  1UPX A;  2P4R A;  2QK0 A;  2EQM A;  1OZ3 A;  2RH2 A;  3B53 X;  1WGS A;  1O7D B;  1JXO A;  3VV0 A;  2JT4 A;  3CCL T;  2F2W A;  1BK2 A;  5FU7 B;  4FYV B;  3BVV A;  1QVF S;  3VS7 A;  1QWF A;  2EFI A;  3OS5 A;  2OTJ T;  2QQR A;  3GF5 A;  3VEB A;  1UEC A;  3G6E T;  3FC3 A;  4J9H A;  4BUG A;  4R0K A;  2D9T A;  1U06 A;  1TQT A;  3SHW A;  1TUD A;  3LW5 E;  7AT1 B;  2QAZ A;  3QWX X;  3L2Q A;  4RTV A;  5GMK l;  5CKD A;  1T3L A;  1K73 R;  1R0C B;  4XU0 A;  2Y4X A;  4NQI A;  2HQH A;  1UFF A;  2ED0 A;  2OTL T;  3MET A;  2OBL A;  1Z9Z A;  4M78 C;  1RAB B;  5LJ3 h;  2YLC A;  3L2Z A;  1EX4 A;  4RTX A;  5LJ5 d;  3WXM B;  5KYU B;  1QKW A;  2EKO A;  3I04 A;  4N0A C;  2KRO A;  4BDY A;  2QDL A;  4J8O A;  3CBO A;  3X24 B;  2O01 E;  3EGX A;  1C1A A;  2O0I 1;  3JAM E;  3WVD B;  3DX1 A;  3PNW C;  4C0F A;  4MZT A;  1VQM T;  2OTL A;  3DB3 A;  1AVZ C;  2LX7 A;  2KK4 A;  3OW2 P;  3OYF A;  4A4K A;  1M30 A;  5GAM h;  2EVR A;  2WSE E;  2LJ0 A;  1IZ6 A;  4ATO A;  2OTJ A;  4LUE A;  3L3P A;  1H3H A;  3REB B;  4LUD A;  3S3O A;  3S3N A;  2PNI A;  3OYY A;  3THK A;  4JWI A;  2LRQ A;  1VQN T;  5KYW A;  4AG1 C;  5GMK i;  5A0D A;  1YJW Q;  2DET A;  1M4Z A;  3MHX A;  5KYY B;  4A4F A;  1Q81 U;  5J26 A;  2QEX Q;  3UDC A;  4M77 F;  4MDW A;  1WHG A;  1KSW A;  2JVV A;  5FU6 C;  2EGE A;  2L89 A;  1NG2 A;  1A0N B;  3PLT A;  2RQR A;  3JCM g;  3Q84 A;  4EZR A;  5KYX B;  4M78 D;  2MPX C;  2YWW A;  2DJQ A;  4XTX A;  5CQY A;  5IXF A;  1Q81 R;  3SWN C;  3C95 A;  1XNI A;  4KBM B;  4LNP A;  5GAN 4;  1U1T A;  2E6Z A;  2HL5 C;  4KGV B;  3G4S T;  4FM3 A;  1M1F A;  4A4E A;  3DLL A;  1GNL A;  2LX9 A;  2PUO B;  5LJ3 j;  4BAC A;  2VYT A;  1ZSZ A;  1WXT A;  4LD6 A;  1WNL A;  1YJ9 A;  3JCM J;  2FRW A;  4B9Q A;  2DRK A;  2D0Q B;  2Y90 A;  1Q7Y R;  2KRM A;  4JRI A;  1Q82 C;  4J9I A;  4B6M A;  5FRM A;  2GAF D;  4E7K A;  4JJC A;  3RIR A;  2DYB A;  2DTO A;  3CCU T;  2C0O A;  4PJO B;  3I39 X;  1SEM A;  1WJS A;  1PG5 B;  1X27 A;  4LDY A;  4JLI A;  2LCS A;  4AZC A;  3JCM V;  1T0J A;  1OX9 A;  3J80 E;  2HNI A;  3CCQ T;  4C5H A;  5FLX E;  1K8A R;  3JCM P;  3Q0K A;  1HK9 A;  4A63 B;  5GAN 3;  3JB9 F;  1MV0 B;  1SU7 A;  4M7A E;  2AKL A;  5HK3 A;  2MI7 A;  3ER8 C;  1GFD A;  2RAJ A;  3A5Z B;  2M51 A;  3MEU A;  2P4T A;  1ZUK A;  3TRE A;  3VUZ A;  2ELB A;  4XTV A;  2DFU A;  3OBW A;  2RT6 A;  4C8Q G;  5GAO n;  4EDU A;  2CS7 A;  2RF0 A;  3VUB A;  4C8Q E;  1IO6 A;  3HTR A;  1E2U A;  3P8B B;  2CUD A;  4M78 E;  3VU3 C;  2NUT B;  3EG3 A;  2YLA A;  4M7A G;  5A0L A;  2K4Y A;  4OVA A;  5C6S A;  4JWC A;  2ESW A;  2PQW A;  3OYJ A;  2DBK A;  2Z0O A;  2GTJ A;  2YIA A;  2YUQ A;  3QSU A;  2YL6 A;  4DOV A;  4BY6 B;  4L6V 5;  1KJW A;  3VYH B;  1OZ2 A;  5HKC A;  2O2O A;  3G6E A;  1RAA B;  2JN0 A;  1K9M C;  3L1A A;  4C8Q C;  1M8V A;  1FX7 A;  2SEM A;  3JCM W;  2F1L A;  1R8O B;  3BDL A;  4PKC C;  1IGU A;  3AT1 B;  2P0P A;  3KXT A;  4OP0 A;  1S72 Q;  1GN9 A;  1HTY A;  1SHG A;  4M7A C;  2CYZ B;  1XOV A;  2A28 A;  2EAY A;  1WZO A;  1VIF A;  2X3W A;  1I07 A;  1D3B B;  3I56 Q;  2RA2 A;  2PVD B;  4JRP A;  1ARK A;  2YL8 A;  2OX7 A;  1I4L A;  2VVK A;  4OGC A;  1ZUU A;  4OB0 B;  2FPF A;  2DF6 A;  3D2F A;  3HKS A;  1N27 A;  4PLL A;  2QA4 A;  1NPP A;  2DTI A;  2LJ3 A;  1KG1 A;  2JW4 A;  3I35 A;  1WXB A;  2W0Z A;  3D4Z A;  3EGU A;  3M55 A;  4OB2 B;  1SPK A;  4OMF B;  4FZO A;  3D50 A;  1PHT A;  2EJ9 A;  2CP6 A;  2HDA A;  4FSS A;  4LDU A;  3BUP A;  5GAN g;  5I22 A;  1SKU B;  2QQB A;  3VKH A;  3FEO A;  4J7I A;  3RNJ A;  4OMN A;  1M2O A;  3RER A;  3PVQ A;  4J7F A;  3KAW A;  1QVF A;  2O9S A;  3T46 A;  3SD4 A;  3KBG A;  4NPH A;  1VQL Q;  2C0I A;  2V8I A;  2EQI A;  3LGF A;  1Q7Y C;  1Q82 R;  4C8Q D;  1YJ9 Q;  1KIK A;  1RUW A;  2COW A;  3EG2 A;  2VUB A;  4C92 B;  1Y96 A;  1RI9 A;  1MNE A;  4LN2 A;  1W2B A;  5GMK m;  2N3K A;  2B86 A;  2DJZ A;  1VQO A;  2RQU A;  5GAO r;  4M77 C;  1OOT A;  4RG8 A;  1AWW A;  4M75 A;  4X9D A;  1KC8 R;  3HL8 A;  3KAV A;  2DYI A;  4D8J A;  4EZO A;  1ZSZ B;  1PWT A;  1M5Q 1;  2KRN A;  2EQK A;  2BZY A;  2ND0 A;  4M7D A;  3QNJ A;  2VXF A;  3M58 A;  2DXU A;  2MAM A;  1ZSZ C;  1VQ6 T;  3OA6 A;  4JJB A;  2V26 A;  4BI8 B;  1ABO A;  2KR3 A;  3CPF A;  2D4C A;  2LMJ A;  2R5A A;  1MMD A;  3V7S A;  2R58 A;  3UT1 A;  3OYC A;  1NLP C;  2EJF A;  3GPL A;  2F18 A;  3QYH B;  2DIL A;  4PJO D;  1VUB A;  4PNO A;  5KYY A;  4RCB A;  4E7I A;  2F69 A;  8AT1 B;  1G3W A;  2EGC A;  2EX3 B;  1D1B A;  1LPL A;  2RJD A;  2EPD A;  4FYY B;  2EIF A;  2HL3 A;  3HAI A;  4B9X A;  2K3X A;  2CH4 A;  5J39 A;  4J6Y A;  4ZGE B;  3QE6 A;  4IWO A;  5LJ3 g;  5GAM d;  1IXD A;  4R5J A;  1OU9 A;  2COZ A;  4XAX B;  3BVU A;  1BIB A;  2VWF A;  1OPK A;  3BLB A;  4MZP A;  4KH1 B;  4RTU A;  2IPO B;  3TSZ A;  4C92 F;  2P0Q A;  2E65 A;  2WYH A;  4KUD K;  1RI0 A;  1HJD A;  3CPW S;  2M0O A;  3PT9 A;  5LJ5 h;  2DIQ A;  4O6J A;  5D6Y A;  1PRL C;  2ROL A;  4E7J A;  1YJ9 T;  4J9C A;  3TU4 K;  3MP6 A;  4F7U F;  1JRI A;  2DKG A;  2KI7 A;  4Z8A A;  1SUF A;  3OW2 S;  4DA4 A;  1K1Z A;  3BUB A;  2D1L A;  1OYX A;  4R56 A;  4EZV A;  2HAX A;  2RK2 A;  4LD9 K;  2C08 A;  4AZ7 A;  1WHJ A;  1DJ7 B;  1QKX A;  1Q95 G;  3LLL A;  4M77 D;  1GCP A;  2ZGW A;  2AHJ B;  1Y2O A;  1D09 B;  4AVM A;  3SOG A;  2YIV X;  1WHL A;  3A98 A;  1M3A A;  2EQU A;  1NE8 A;  2JZ2 A;  1JJ2 A;  1VYU A;  2LTO A;  1JXM A;  4ME7 A;  2CSQ A;  4UC4 A;  4E7S A;  3OSV A;  3J7A F;  2JM8 A;  1H8K A;  2WSC E;  1N5Z A;  4CRI A;  1OUL A;  1YCS B;  1WDZ A;  2XDP A;  4QVD A;  2A3L A;  5DLQ E;  1BBZ A;  2E3H A;  5GAN 6;  2X3X D;  1QVG P;  4JN4 A;  1RAG B;  1M90 U;  4RMO A;  1UUE A;  3OYK A;  1BB9 A;  3CCE T;  2DPP B;  3EG1 A;  3LGL A;  3C94 A;  2OBM A;  4PLI A;  1DKY A;  3HAH A;  3CCU A;  4DYL A;  3GBQ A;  1TQU A;  4M7A F;  4BE0 A;  3PFS A;  4HVV A;  2ABL A;  4AG2 C;  4BB7 A;  2CP5 A;  3B52 X;  3AHU A;  2X5C A;  2RHZ A;  4RTT A;  4OMQ A;  4LDV A;  3H0F A;  3PGG A;  3QG1 A;  1VQN A;  4NL2 A;  3DX4 A;  4FCY A;  4IUV A;  4EIK A;  1X2K A;  1RAD B;  2ZPE B;  3O5Z A;  4Q5W A;  3A8G B;  3P8H A;  1S72 A;  1RAI B;  2VAS A;  3N5B B;  4ZN1 A;  1S1N A;  5GAO l;  1P92 A;  2D0N A;  1YWM A;  1TXQ A;  3PTA A;  2MF2 A;  1M1K R;  2KT8 A;  2OTL Q;  2YUP A;  2A08 A;  1SF9 A;  2LNH B;  2BTT A;  4ORZ A;  1VYT A;  2G3R A;  5KCH A;  4HCK A;  2DIG A;  1MHN A;  3RES A;  2GBQ A;  3D2E A;  2GF4 A;  3CCL A;  1X03 A;  2XDB A;  1OA0 A;  1VQN Q;  1ZHI A;  4CC4 B;  2FPE A;  2PTK A;  4OF1 A;  1BCO A;  4C5E A;  2E5Q A;  1VQ4 T;  5KBP A;  5GAN f;  5IHK A;  2CKK A;  2LP5 A;  2E10 A;  3A8L B;  3CEY A;  2F5T X;  1IB8 A;  4HR1 A;  3TVT A;  1N8R U;  4LXC A;  3J81 E;  2YHT A;  2PVO B;  3CMA A;  4M7A B;  1UGP B;  5GMK e;  2KT1 A;  3M5A A;  1QVP A;  3MP8 A;  1YJW T;  5CR2 A;  1NJI C;  3BY7 A;  4MDX A;  3A8O B;  4M75 E;  3C7N A;  3CC7 T;  3TSW A;  1G3Y A;  4BE1 A;  4PJO E;  3QWE A;  5IHI A;  4CI0 C;  5GAN d;  1M8M A;  2CP7 A;  2ALW A;  2JTE A;  4AFS C;  2HBW A;  2X4Y A;  2MK5 A;  4NOY A;  4XTW A;  5GAN 7;  1I1J A;  1RAH B;  4M75 B;  1OPL A;  3CBP A;  4QQ6 A;  3QII A;  2WSF E;  3OYH A;  2X3W D;  3CXC P;  2X51 A;  1X04 A;  1YBY A;  2RI3 A;  4YTL A;  1K9M U;  3VS0 A;  4DBF A;  3HPW A;  4O5V A;  1TQV A;  4QW2 A;  5D6X A;  3RKW A;  1X6G A;  4J6W A;  1SU6 A;  3O3M B;  2CUB A;  3QBY A;  2RAI A;  3VRZ A;  4H6I A;  1HD3 A;  1BI1 A;  2LCL A;  1PM3 A;  1LJO A;  2EWF A;  1HXK A;  1WHM A;  2XKO C;  4M77 B;  4HT9 A;  3HRU A;  1YWO A;  3QDR B;  1G5V A;  4DQ2 A;  1KC8 U;  2PUK B;  2XD0 A;  3CCV Q;  3RV0 A;  3V8J A;  1B7T A;  4A54 A;  4M77 G;  4AZG A;  1VQL A;  3CC4 Q;  5GAN 8;  1VQ7 Q;  1TS9 A;  3JB9 J;  4HR1 B;  2O31 A;  4KIK B;  1M27 C;  3CZS A;  1M3C A;  2RQV A;  3CCE Q;  1RLP C;  3B51 X;  2Z0W A;  4FSX A;  2QXF A;  4M7D F;  2DK3 A;  3H9N A;  1GXI E;  5HCK A; 
#chains in the Genus database with same CATH homology
 4CC7 A;  2M51 A;  5IXB A;  1ZUK A;  4IM0 A;  4F01 A;  2J05 A;  4J9B A;  1KFZ A;  2L2P A;  2RT6 A;  2C0T A;  2DVJ A;  2RF0 A;  4F17 A;  4HYB A;  1HSQ A;  1IO6 A;  2FO0 A;  4OMM A;  1E2U A;  1WI7 A;  2CUD A;  1AD5 A;  3EG3 A;  4JWE A;  3ULR B;  3VEA A;  2D8J A;  2ECZ A;  4HY9 A;  2JM9 A;  4AFU C;  4JWC A;  2ESW A;  4OML A;  2JS0 A;  2MIO A;  1VYV A;  1X43 A;  2DBK A;  4RTZ A;  3VS3 A;  1OV3 A;  2GTJ A;  1QWE A;  3M0P A;  2YIA A;  3M0T A;  2YUQ A;  4EZW A;  3KDR A;  1KJW A;  5TKY A;  1CSK A;  3FJ5 A;  4J9D A;  2O2O A;  3REA B;  4UDX X;  1RLQ C;  2SEM A;  1B07 A;  3EHR A;  1G2B A;  4D8D A;  3H0H A;  3UF4 A;  2HEQ A;  3OHX M;  4GLM A;  3FD9 A;  2FEI A;  4CC3 A;  1GN9 A;  1SHG A;  4E6R A;  1GRI A;  1T0H A;  2DA9 A;  1XOV A;  2A28 A;  1I07 A;  4JPB W;  2LM0 A;  1ABQ A;  1E6H A;  1K4U S;  1WDX A;  1ARK A;  2VVK A;  2CT3 A;  1ZUU A;  1Y0M A;  3I01 A;  2FPF A;  2ENM A;  3I9Q A;  2RN8 A;  2DF6 A;  3D2F A;  3GI7 A;  3R6N A;  1G83 A;  4R5L A;  1GBR A;  4QT7 A;  4Y92 A;  2LJ3 A;  2JW4 A;  3I35 A;  1WXB A;  2W0Z A;  3EGU A;  1E9V A;  1SPK A;  1UGV A;  1ZLM A;  4EZT A;  2KNB B;  1NLO C;  1PHT A;  5GJW B;  2HDA A;  2RPN A;  4FSS A;  1T3S A;  3DPO A;  1MUZ A;  2AK5 A;  5I22 A;  4RTY A;  3VKH A;  2EYW A;  4EZZ A;  2KXD A;  4J9G A;  4J9F A;  2EBP A;  2KHO A;  4OMN A;  3L3O M;  3RNJ A;  4D8K A;  5FLE X;  2K79 A;  3PVQ A;  4F14 A;  1X6B A;  3KAW A;  2LJ1 A;  2O9S A;  4HVU A;  1AWO A;  3T46 A;  2CT4 A;  2WIN M;  4NPH A;  4DEY A;  2NCZ A;  3EHQ A;  4ESR A;  2C0I A;  3I5S A;  5FW9 A;  2EQI A;  2JNS A;  4JL9 A;  1KIK A;  1RUW A;  3U23 A;  3EG2 A;  1RI9 A;  2DRM A;  3ZED A;  2F2X A;  4JZ4 A;  4LN2 A;  4AFQ C;  1SU8 A;  1TUC A;  2N3K A;  4E81 A;  1OEB A;  2B86 A;  4IWP A;  2RQU A;  2DMO A;  1AEY A;  1OOT A;  4WCI A;  2I0N A;  1AWW A;  2AZS A;  1WLP B;  1U00 A;  3KAV A;  4KIK A;  1AZG B;  1WYX A;  4D8J A;  4EZO A;  1GL5 A;  1PWT A;  2D8H A;  2LQN A;  2KRN A;  2RQW A;  2BZY A;  2D1X A;  4JNF A;  2ND0 A;  4M4Z A;  3QNJ A;  4M0M A;  4EZX A;  3SEM A;  4EZQ A;  1MJG A;  1GCQ C;  2GNC A;  3T48 A;  2DL5 A;  3LMF A;  2LQW A;  3O3N B;  1WFW A;  2L3Q A;  3T47 A;  4JJB A;  1CKA A;  1K0X A;  1UDL A;  3I5R A;  5E84 A;  1ABO A;  2KR3 A;  2A36 A;  3QWY A;  4E3C A;  1JO8 A;  2LMJ A;  2RQT A;  2KRS A;  1B3Q A;  2H8H A;  1W1F A;  3O3O B;  1YWP A;  1NLP C;  1UHF A;  2DIL A;  2J06 A;  1PRM C;  1YN8 A;  1JU5 C;  2YSQ A;  1ZBJ A;  3H41 A;  1JEG A;  1AOJ A;  4JZ3 A;  2CSI A;  2EGC A;  2EX3 B;  2PZ1 A;  2G6F X;  2DLP A;  2YI8 A;  2EPD A;  2XMF A;  2A37 A;  3M0Q A;  2JMA A;  4EZP A;  2M0Y A;  2CH4 A;  1NEG A;  1SHF A;  4G6Q A;  4IWO A;  4R5J A;  5FIG A;  2NUZ A;  1WXU A;  2AZV A;  4OMP A;  1GNT A;  2VWF A;  2YUO A;  3QA8 A;  1PKT A;  1U3O A;  1OPK A;  2K3B A;  5I11 A;  2HSP A;  1DKX A;  4RTU A;  4R5K A;  2DL4 A;  3UIT A;  3TSZ A;  1UJ0 A;  2O88 A;  2O9V A;  2ED1 A;  3ERC C;  1K9A A;  4F00 A;  4KRT A;  4Z88 A;  3CQT A;  1JQK A;  1E7O A;  2DBM A;  1ZSG A;  1HJD A;  2DL3 A;  1ZUY A;  2FRY A;  2EYY A;  1FMK A;  1UTI A;  4Z89 A;  1PRL C;  2QFF A;  4OMO A;  1SSH A;  2ROL A;  4J9C A;  1QCF A;  2K9G A;  1H92 A;  2CDT A;  3M0S A;  1UHC A;  4H6H A;  4Z8A A;  1SUF A;  1U5S A;  4IIO A;  1JQQ A;  1SRL A;  1K1Z A;  4RTW A;  2L0A A;  5EC7 A;  1TG0 A;  4RUG A;  3M0U A;  2FPD A;  4EZV A;  1AWX A;  3KFV A;  2NWM A;  1AWJ A;  1QKX A;  3F7W A;  2J6O A;  1GCP A;  2K6D A;  1PKS A;  4EZY A;  2YIV X;  2JMC A;  4JWD A;  3A98 A;  1M3A A;  3M0R A;  2YDL A;  1LCK A;  3ER9 B;  1WX6 A;  1VYU A;  1JXM A;  2JXB A;  2DL8 A;  2CSQ A;  2KYM A;  3JV3 A;  4GBQ A;  2E5K A;  2YIB A;  2ND1 A;  2DX1 A;  3VS2 A;  2BZ8 A;  1H8K A;  2JM8 A;  3NPF A;  1N5Z A;  1NM7 A;  3EG0 A;  4DEX A;  1YCS B;  2CH4 W;  1OA1 A;  4EZU A;  1EFN A;  1WA7 A;  1M3B A;  2DL7 A;  1E6G A;  3NGP A;  4HVW A;  4EZN A;  3RBB B;  5L23 A;  4UDY X;  1BBZ A;  1UPX A;  2P4R A;  2X3X D;  4JN4 A;  1OAO A;  3B53 X;  1UUE A;  2YI9 A;  1BB9 A;  4ZNX A;  1JXO A;  3EG1 A;  2V1Q A;  4J9E A;  2GA9 D;  2OBM A;  1W70 A;  3C0C A;  2JT4 A;  4IM3 A;  1DKY A;  2F2W A;  1BK2 A;  2GGR A;  3NMZ C;  3UAT A;  3GBQ A;  3VS7 A;  3OWG A;  1QWF A;  2RMO A;  2L3S A;  1ZYL A;  1SRM A;  4JNE A;  4HVV A;  2ABL A;  3IQL A;  3VEB A;  1UEC A;  4AG2 C;  3B52 X;  4J9H A;  3DPQ A;  2J6F A;  2X5C A;  4R0K A;  4RTT A;  4OMQ A;  1U06 A;  2GQI A;  5IHN A;  3H0F A;  3SHW A;  2EYX A;  2DNU A;  1TUD A;  5IH2 A;  2K2M A;  4IM2 A;  3QWX X;  4RTV A;  1FYN A;  4EIK A;  1X2K A;  1T3L A;  4HXJ A;  3O5Z A;  1UFF A;  2PY6 A;  2ED0 A;  1YNZ A;  2MCN A;  2OBL A;  1DKZ A;  2HCK A;  1Z9Z A;  5ECA A;  1S1N A;  4RTX A;  3UA6 A;  2D0N A;  5GJV B;  1QKW A;  4IW0 A;  3I04 A;  2KT8 A;  2KRO A;  2QDL A;  2RNA A;  2YUP A;  2A08 A;  1GCQ A;  2LNH B;  2BTT A;  2F2V A;  4ORZ A;  4F16 A;  1VYT A;  1QLY A;  4HCK A;  2FG0 A;  2DM1 A;  4X1V A;  1K76 A;  2GBQ A;  2IIM A;  2Z8Y A;  3D2E A;  1CKB A;  1AVZ C;  2LX7 A;  1OA0 A;  2J6K A;  1M30 A;  2FPE A;  4CC4 B;  2PTK A;  1J3T A;  3T4A G;  1X69 A;  2EVR A;  2LJ0 A;  1W6X A;  5IHK A;  2ROT A;  2LP5 A;  4LUE A;  3PVL A;  3VS4 A;  1H3H A;  3TVT A;  4HR1 A;  2KYB A;  3REB B;  3RV1 A;  4LUD A;  1K0S A;  2DE0 X;  2PNI A;  3THK A;  3ZL7 C;  4JWI A;  2KXC A;  2YT6 A;  3VS5 A;  2KT1 A;  4AG1 C;  1BU1 A;  3VS1 A;  1AZE A;  2JS2 A;  2EYZ A;  2W10 A;  3DPP A;  4R5I A;  3C7N A;  2MOX A;  3TSW A;  2LZ6 B;  5IHI A;  4K11 A;  1KSW A;  1UE9 A;  1UJY A;  2L3P A;  1M8M A;  1WIE A;  4R5G A;  2EGE A;  2VKN A;  1NG2 A;  1A0N B;  2RQR A;  1Z9Q A;  2JTE A;  2SRC A;  2QXL A;  4AFS C;  4IWQ A;  1X2Q A;  4EZR A;  2HBW A;  2BZX A;  2J7I A;  2DJQ A;  5IXF A;  1Y57 A;  1I1J A;  2OAW A;  2KEA A;  4LNP A;  1OPL A;  3PE0 A;  2EGA A;  2EW3 A;  2KBT A;  1GBQ A;  2X3W D;  5FWC A;  3VS6 A;  3LH5 A;  2AKK A;  1ZX6 A;  3T49 A;  1W9M A;  2KE9 A;  4IIM A;  4LE9 A;  3VS0 A;  4JLC A;  3NHN A;  4FM3 A;  2GTO A;  1X6G A;  2V1R A;  1SU6 A;  3O3M B;  3UA7 A;  1GNL A;  2CUB A;  2CRE A;  1GFC A;  3VRZ A;  4JJD A;  4H6I A;  1HD3 A;  1NEB A;  4CC2 A;  2EWF A;  1UG1 A;  1I0C A;  1NYG A;  1WXT A;  1NYF A;  1YWO A;  2FRW A;  1E1D A;  4B9Q A;  1MV3 A;  2DRK A;  2OJ2 A;  3RV0 A;  4PO2 A;  4EZS A;  2KRM A;  4J9I A;  2GAF D;  2K7A A;  4JJC A;  2DYB A;  1V1C A;  2YUN A;  4HR1 B;  2C0O A;  2O31 A;  4KIK B;  3I39 X;  1M27 C;  1YP5 A;  1SEM A;  2EKH A;  3VRY A;  1M3C A;  1X27 A;  2LCS A;  2RQV A;  1T0J A;  1RLP C;  3B51 X;  3H0I A;  1VA7 A;  4A63 B;  4AFZ C;  1MV0 B;  1SU7 A;  5FWB A;  2AKL A;  3ER8 C;  2OI3 A;  1PNJ A;  1GFD A;  5HCK A;  2KGT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...