3A98A

Crystal structure of the complex of the interacting regions of dock2 and elmo1
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
168
structure length
157
Chain Sequence
b'GMAPWRKADKERHGVAIYNFQGSGAPQLSLQIGDVVRIQETCGDWYRGYLIKHKMLQGIFPKSFIHIKEVIPAEIPLAQEVTTTLWEWGSIWKQLYVASKKERFLQVQSMMYDLMEWRSQLLSGTLPKDELKELKQKVTSKIDYGNKILELDLIVRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dedicator of cytokinesis protein 2
publication title Structural basis of functional complex formation between DOCK2 and ELMO1 for Rac activation in lymphocyte chemotaxis
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 45
structure length 157
sequence length 168
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-10-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.350 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3a98A02
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3a98A01
1X6GA 3EG2A 2D0NA 2DE0X 1W1FA 1S1NA 1GFDA 2DJQA 2JM8A 3PVQA 2EYYA 2G6FX 2SRCA 2LX7A 4ZNXA 4HVWA 4E6RA 1PKTA 2F2VA 2A37A 1AWWA 1BB9A 2DL3A 1M8MA 1U06A 2YUPA 2O9VA 3EG1A 4RTTA 3VRYA 2FEIA 2D8HA 1E6HA 1SSHA 5IHIA 1E7OA 1AEYA 1QWFA 1E6GA 2GTJA 3VS2A 1UECA 5IHNA 2V1QA 2AZVA 2D8JA 1H3HA 1IO6A 3JV3A 1VYVA 3H41A 3QWXX 2FRWA 2L0AA 4R0KA 3ULRB 3SEMA 3EHQA 1HD3A 1KSWA 2JS0A 4LN2A 1JQQA 3REBB 4GBQA 2A36A 4KRTA 2EW3A 4OMPA 1M27C 1OPKA 3NHNA 1SHGA 1Y0MA 5EC7A 2KXCA 2LJ0A 1FYNA 2L2PA 2X3XD 2EYXA 2PTKA 4LUDA 2EQIA 2J7IA 5IXFA 1ZLMA 1BK2A 1WDXA 2DBMA 3M0RA 5FW9A 1WYXA 1PHTA 1HSQA 1CKAA 1QLYA 3TSWA 2EBPA 2K6DA 1JO8A 1UTIA 3I9QA 2DNUA 3EGUA 5I22A 2KEAA 2DRMA 1Y57A 1UHCA 1WIEA 2YSQA 3UF4A 4AFUC 1BU1A 1PNJA 2RPNA 1AWOA 2DA9A 2DF6A 4Y92A 2OJ2A 2V1RA 1AZEA 2SEMA 5FWCA 4RUGA 3U23A 2I0NA 1GCPA 2LZ6B 3PVLA 4AFQC 4JJCA 4J9GA 2W10A 1X2QA 4J9DA 1M3AA 2FO0A 1SRLA 2JMCA 4AG2C 1KIKA 2KRNA 4QT7A 2GBQA 1GBRA 2EKHA 2J6OA 2EYZA 4Z8AA 2RNAA 3IQLA 2C0TA 1WLPB 2EGAA 2JS2A 1N5ZA 2FRYA 3FJ5A 5HCKA 1PWTA 2H8HA 1GRIA 2O2OA 1NG2A 1ZSGA 3UA7A 3VS5A 2X3WD 5IHKA 2EPDA 2FPEA 3VS7A 4OMOA 2CT4A 3ZL7C 2KRMA 1JXOA 4J9FA 2J6KA 2KRSA 4J9EA 2HEQA 1OEBA 2DMOA 1WI7A 4OMLA 1Z9ZA 2KYBA 1OV3A 1CSKA 4JJDA 1VYTA 2BTTA 2GNCA 1ZUYA 2EYWA 2GGRA 2NUZA 4Z89A 2CT3A 3VS4A 4DEYA 2FG0A 3CQTA 1GBQA 1AWXA 1UGVA 3H0IA 1UJ0A 2NWMA 1YWPA 1RLQC 1ARKA 1UDLA 2KT1A 2VVKA 2DL7A 1EFNA 1AOJA 1JU5C 1MUZA 3NPFA 1QCFA 2LP5A 3THKA 1TUDA 2DILA 1QWEA 4LE9A 4GLMA 1T0HA 2OI3A 1ZX6A 3O5ZA 4FSSA 1OPLA 2HDAA 4WCIA 1T3LA 2FPDA 4OMMA 2ED1A 3M0QA 2CDTA 1UFFA 1V1CA 3R6NA 1HJDA 2KGTA 2RN8A 1LCKA 4JZ4A 2CSQA 1QKWA 1QKXA 2K2MA 3C0CA 1AVZC 1CKBA 3VS0A 5GJWB 1RLPC 1YP5A 2RMOA 1JEGA 2A08A 5FWBA 1UHFA 2K7AA 2D1XA 3A98A 1YN8A 5L23A 4A63B 2DVJA 1GCQA 4OMNA 2VWFA 2P4RA 1H92A 3TSZA 2GQIA 5I11A 2M51A 3RBBB 4LUEA 5ECAA 2CH4W 2DL4A 1PRLC 1UJYA 3LH5A 3M0SA 1MV0B 2J05A 4Z88A 4F14A 5IXBA 1X69A 1UG1A 2DX1A 4AG1C 3REAB 2IIMA 2DL5A 2LQWA 2VKNA 1NEGA 2F2XA 2ABLA 2ECZA 1KJWA 2JXBA 2PNIA 1GFCA 1I1JA 1NYGA 2YT6A 2HCKA 3EG3A 2O31A 1FMKA 2RQRA 2AKKA 2E5KA 2CREA 4F17A 1W6XA 1WX6A 3PE0A 1NEBA 1VYUA 2JTEA 1SEMA 4HVVA 3UA6A 3I5SA 2KXDA 1GL5A 1X43A 4J9IA 4CC7A 2CUBA 1TG0A 1WA7A 2MOXA 4HVUA 2RQUA 1H8KA 1OOTA 2K79A 2C0OA 2ROTA 3M0UA 1NM7A 2AKLA 2RF0A 2EVRA 2RQWA 1X27A 4X1VA 4RTWA 1WXBA 2OAWA 2B86A 1K0SA 2RQVA 2KNBB 2ED0A 1W70A 1MV3A 1SHFA 1UE9A 2O9SA 3TVTA 2EGCA 1ABOA 2CUDA 1ZUUA 2YUOA 4RTVA 5IH2A 4JZ3A 2ENMA 4RTYA 1PKSA 3H0FA 1ZBJA 3H0HA 3QWYA 1Z9QA 4OMQA 2JMAA 2LJ3A 1J3TA 2KE9A 1B3QA 2DBKA 1G2BA 4ESRA 2HBWA 1WXTA 2KBTA 2JM9A 4K11A 2MIOA 1TUCA 4J9HA 2DYBA 1SPKA 1I07A 3VS1A 3SHWA 1AZGB 1NLPC 2L3SA 3M0PA 2YDLA 4IIMA 3EHRA 4IIOA 2LJ1A 2J06A 4HCKA 2O88A 2JT4A 3VRZA 2BZ8A 1UUEA 2A28A 4RTUA 2DL8A 3KFVA 1K9AA 2HSPA 4JPBW 2BZYA 1X2KA 4D8DA 2KYMA 1M3BA 1NYFA 2DM1A 2LQNA 3NMZC 4M4ZA 2RQTA 4LNPA 1B07A 1K4US 2KT8A 4DEXA 2F2WA 4AFZC 2ESWA 1WFWA 4CC3A 3I35A 2KR3A 2YUNA 1BBZA 4HXJA 1I0CA 1A0NB 2K3BA 4J9CA 3M0TA 1RI9A 4RTZA 2K9GA 1VA7A 1JXMA 1M3CA 4CC2A 2M0YA 2QDLA 4AFSC 1X6BA 2J6FA 2MCNA 3UATA 3I5RA 1K1ZA 3VS6A 2LCSA 2FPFA 1KFZA 2YUQA 4D8KA 2CSIA 1AD5A 2PZ1A 1ABQA 2LNHB 3VS3A 2L3PA 1T3SA 2EGEA 1NLOC 1RUWA 2KROA 2XMFA 2BZXA 2CH4A 1AWJA 4CC4B 2GTOA 2L3QA 2DRKA 2DLPA 1XOVA 3RNJA 2W0ZA 1YCSB 2AK5A 1T0JA 1SRMA 5GJVB 1K0XA 4ORZA 4J9BA 2LMJA 1WXUA 4RTXA 4JJBA 3EG0A 1U3OA 1G83A 1YWOA 2C0IA 3GBQA 1PRMC 1K76A 3NGPA 1YNZA 2ROLA 4F16A 1ZUKA 1M30A 2JW4A 4EIKA 2AZSA 1GCQC 1U5SA
chains in the Genus database with same CATH superfamily
2OBMA 1QVFP 2ZPIB 3CCRQ 2D0NA 4O5VA 3CCUA 1S1NA 4A4HA 4DOWA 1VQ5T 2F7PA 2OO2A 1RL2A 2DJQA 2EYYA 2G6FX 2LT4A 1D0ZA 3A8HB 4M77C 1PKTA 4E6RA 4IW0A 2PQWA 1BB9A 1OZ2A 3EG1A 2MAMA 5DLQE 2D8HA 3OYIA 2IPOB 1SSHA 1Q81U 2FZKB 4JDSA 4ZN1A 4FYWB 3NTKA 5GAN4 3CCLA 3LLRA 2VYTA 4F04B 4A4KA 2CZ6B 3OS1A 1UECA 1D1BA 3O3MB 5IHNA 2F7OA 2V1QA 2EFKA 2AZVA 4AZHA 1VQ9T 2QXLA 5GANg 5GMKi 2DIGA 2GFAA 2DAQA 4F7UE 2NUPA 4JLCA 2XU8A 3EFRA 3RKXA 2XDBA 4NL3A 3EHQA 5GANj 4H6HA 1PSFA 2A3LA 4AVMA 3CD6A 3DLMA 4LN2A 1U1TA 3OSVA 2A36A 2X4YA 4KRTA 1PM3A 5AT1B 2GAFD 4J7FA 3OYHA 2ZPEB 4PJOC 4BNEA 4BACA 3FLGA 4C5HA 2EYXA 2J7IA 3L2ZA 5IXFA 5GMKh 1TQWA 5GAN7 2DBMA 3EJPA 1ZA2B 3EGXB 3OYBA 1QLYA 2P0QA 1VQ8Q 5C5BB 2KHOA 3I9QA 2EWFA 4MZPA 4LDYA 1I8FA 1Y57A 1WQWA 3P8BB 1SU8A 2HQXA 4XU2A 1QVGA 3D51A 1RAFB 1PNJA 4M75F 1YJWQ 1XQHA 4Y92A 1PS3A 2LQKA 2OJ2A 1VQKA 5IN1A 3OWGA 1GCPA 2LZ6B 3LH0A 3PVLA 2Z0WA 3CC2T 1M3AA 3H9NA 4IUTA 2GF4A 2JMCA 1HTYA 1YJNQ 3V7SA 4AG2C 1KIKA 2ELBA 2F5KA 3ZFJA 4M7DG 4OB3B 2EKHA 4C8QG 2EYZA 3KAVA 3AHUA 3L2WA 1VQ5Q 2JS2A 4PFOA 1PWTA 3JCMJ 2EFIA 3FDRA 2O2OA 3JB9J 4QQGA 3MP8A 3TQ7P 3EFSA 2K57A 1YHQT 2D1LA 2YRCA 4N4IA 2FPEA 5KCOA 4OMOA 2CT4A 2WSEE 5CR2A 2K5LA 2KRMA 4J9EA 2MWPA 2H3EB 3CCJT 4M7AB 1WI7A 1BYMA 1TQSA 4C5EA 3HRSA 2BUDA 5LJ5h 3OYAA 1CSKA 1VQ9Q 2CP7A 2F1BA 3OYJA 5CO7A 1W2BS 5GMKm 1VYTA 1I4LA 3E1SA 3EGDB 2DETA 1VQNT 3TCJA 2GGRA 2NUZA 3CCST 5GMKe 3HFNA 2HKQB 2Q13A 2XICA 4B9WA 4F01A 4C0DC 2QQBA 1UGVA 2NWMA 1OYXA 3M5AA 9ATCB 2OTJT 3G71T 1KQSP 2RI2A 4F7UG 3L3PA 1EFNA 2EIFA 1JU5C 4E7IA 4M75B 1QCFA 4PJOD 4PK4A 1GN9A 4F00A 4GLMA 1T0HA 4E2FB 5CAIA 4C0ZA 5CQYA 3O5ZA 1O75A 3CCRA 1IZ6A 1KQ2A 3RIRA 3DDFA 4NQIA 2ZPHB 3M9QA 2DVEA 1LCKA 1G5VA 2E10A 1W2BA 2E3IA 2YI8A 3TREA 1AVZC 4OF1A 5GAOn 5LJ3j 1YP5A 4M7DF 4C8QF 1K73C 5IT9E 5KYWB 2YKTA 4EZYA 3CC2Q 3A98A 3CMET 3CPWS 1OQKA 3J7AF 1G3TA 4QVZA 4R56A 2DTOA 2JUFA 2R58A 2K5IA 4DCNC 3RV0A 2CP2A 4KBMB 3BDUA 4O6JA 2YL6A 1D0YA 2O4XB 4OB0B 3M55A 3A8MB 1RAGB 5DM7R 3D2FA 5KYYA 3OYKA 1YHQQ 4AZGA 1MV0B 5IXBA 1VQ4T 2DX1A 1TQTA 3OYGA 2RHZA 2IIMA 1IREB 1NEGA 2F2XA 3A8LB 3CCJQ 5GAMj 1GFCA 1M2VA 2HCKA 1VIFA 3UPUA 1VQ8A 2WACA 1WHMA 4R5KA 2D0QB 1XJWB 3C4SA 1KG1A 1IB8A 1VQNQ 1ACMB 3M53A 4WPCA 3OW2P 5KYXB 2JTEA 4HVVA 3UA6A 3CPWA 4F7UF 3CCSQ 3S3NA 2EKOA 4J9IA 4QQ6A 4M7DD 1KC8R 3L2QA 2MOXA 3CBMA 4HVUA 4C8QD 1OA0A 3VYHB 1MMDA 2OTJQ 2K79A 5KYUB 3G71Q 2DK3A 3M0UA 4PJOA 1R77A 5DY9A 1DKXA 3B53X 3V7RA 3CC7Q 3KXTA 2ZPGB 1WPYA 2RK1A 2F7RA 2B86A 1KHIA 2KNBB 1MV3A 3TVTA 4AMCA 2CUDA 1ZUUA 1R34A 4JZ3A 2ENMA 4PL6A 1PKSA 4RG8A 2DPPB 3S6WA 2CS7A 1ZBJA 4OMQA 2QEXA 2JNGA 4B9XA 1J3TA 1R0BG 2KE9A 3DX2A 3ME9A 1G2BA 1AT1B 4ZN3A 1MNDA 2HMAA 4J9HA 4C92C 3LWIA 2DYBA 4JWDA 1I07A 2VV5A 2M1HA 5CK9A 4FYXB 4ZTFA 3JCMd 2QGFB 4AZBA 2DYIA 1M9SA 3CEYA 3CMEQ 4QQDA 2D4CA 2YLCA 2PVGB 1G8XA 1IHVA 1KD1C 4RCCA 1VQ9A 1JJ2P 3VRZA 1UUEA 3D52A 2V0OA 4PFZA 3D2EA 1UB4A 1X2KA 4L6V5 4D8DA 1VQPA 3JCMb 4HR1A 2DM1A 3NMZC 3OS5A 1K4US 5TKYA 4AFZC 2ESWA 2CKKA 3R6OA 1B7TA 3C95A 2OAUA 1VQ4Q 3EJTA 4OVAA 1O9SA 1A0NB 4J9CA 2E6NA 2K9GA 1OX9A 4F7UB 3X20B 3I2WA 3RMSA 2KK4A 3EJUA 1BCOA 4AFSC 1I5LA 2RHXA 3KAWA 3UATA 2GFUA 4OGCA 2CSIA 2PZ1A 1ABQA 3VS3A 4M7DA 4AZ6A 4C8QA 4NSWA 1OULA 4N0AC 2XMFA 2NUTB 1WNLA 3PNWC 2YWWA 1AWJA 4M77E 4ME7A 2KAFA 2IG0A 4CC4B 2GTOA 1BI0A 2VXEA 2QXFA 3RNJA 5GMKj 4FL6A 3HP9A 2JVVA 3VEAA 3CV5A 1MMGA 1RABB 4JJBA 3DB3A 1U3OA 3CC2A 3CD6Q 2C0IA 4EZTA 1X75C 4WPEA 4MZMA 3RKYA 3SWNC 2MPXC 1M30A 3P8DA 4EIKA 4QVDA 1GCQC 5FU6C 4H8SA 3EG2A 1LJOA 2JM8A 3PVQA 1I4DA 4R5IA 4LDWA 2SRCA 5KH6A 4ZNXA 3VJPA 4PJOE 4BDYA 5I21A 1AWWA 2DL3A 1M8MA 2YUPA 2QK0A 4D8JA 1QP2A 5J3BA 3OYFA 1WHJA 1Y96A 2QDYB 3MEAA 1E7OA 5FU7B 4EZWA 1QWFA 4C92D 2KMTA 1E6GA 4ZGJB 3DX4A 5GAOq 3LVTA 1FWZA 3JV3A 1VYVA 4JWEA 2FRWA 3DDGA 4R0KA 3ULRB 5CIUA 3ER8C 1HD3A 5CKDA 3T46A 2JS0A 5M9OA 2DTIA 3REBB 3DKMA 1K73U 1W4SA 1YBYA 4OMPA 1OPKA 5LJ5j 5D6WA 5D7UA 1B34A 4BI8B 3DPQA 4AZ5A 3UWNA 2LJ0A 3GP8A 1SSFA 3BVTA 2PTKA 3V8KA 3DX0A 1QMCA 4PLLA 2LVMA 3V8LA 3M0RA 4XQ3A 4A4FA 5GMKl 2QFFA 3LW5E 3QXEB 5FRNA 4BY6B 4PJMA 4AZCA 1UTIA 4XTXA 2RD1A 4BI3A 2DNUA 2RO0A 1E1DA 4IWOA 2DRMA 2CP5A 4AZ7A 2YSQA 1IRXA 2VUBA 4AFUC 1BU1A 2RPNA 1AWOA 2DD5A 2KY9A 3DX1A 3FB9A 1ZBXA 3CBOA 2V1RA 2NUPB 4EZZA 2Y4XA 3U23A 2I0NA 2Z0NA 4JJCA 4M77G 1LVKA 1EIFA 1X2QA 3CBPA 4YTLA 4E3CA 1M90C 3CXCA 1GBRA 2LRQA 4DOVA 3QO3A 2DEUA 4EZQA 4XK8E 4CRIA 3I56T 3WXMB 2NCZA 2FRYA 3FJ5A 1SG5A 3G1JA 4II1A 4PJNA 4IKFA 4C92A 1ZSGA 3UA7A 3VS5A 2E5QA 3OYCA 1KD1R 1VQOT 4OB2B 3E19A 3OK8A 2J6KA 2KRSA 2HEQA 2ZAEA 2QEXT 1QVFS 1UGPB 3OYYA 3D50A 3QYHB 1VQLT 1OV3A 4M7AC 3RKWA 3HAHA 3UT1A 4PJOG 5FIGA 1BI1A 1HK9A 5FROA 1WHLA 1E9VA 2GNCA 4JWIA 2VB6A 4Z89A 3VS4A 2FL7A 3M54A 2ZZDA 3CQTA 1AWXA 2F5TX 1YWPA 2FYVA 4AZIA 4JWCA 3CCET 3UITA 1ARKA 2KT1A 1DKYA 2VVKA 4EZSA 3GOXA 2RJDA 2YIBA 4X34A 1VQPT 4C0FA 6AT1B 1YWMA 1Q7YR 3ZBDA 1MUZA 3NPFA 2DXCA 2K3YA 1QVGP 2ALWA 1OA1A 4LE9A 4QVCA 2OI3A 2OZNB 4FSSA 4N0AA 3D4ZA 4PFPA 1OPLA 4WCIA 1T3LA 2FPDA 1Q86R 2ED1A 3CCQT 4C5GA 1KC8C 2CDTA 3O3NB 3RUXA 2C08A 1UFFA 1LQ7A 3R6NA 2KGTA 5FRMA 3CCMA 4JZ4A 2YIVX 2CSQA 4M77F 1U8RA 4IUUA 1K9MR 2K2MA 1CKBA 3MEWA 3EH2A 2YL8A 5GANd 5GJWB 1RLPC 3HHTB 3JCMe 1UHFA 3BDLA 3LGFA 2D1XA 3CMAA 2Q12A 3INZA 1GNTA 3SWNA 2Y4YA 1P92A 1YN8A 3G4SA 4A63B 3DPOA 2DVJA 3VEBA 2VGMA 1GCQA 1UEBA 1H641 1K8AR 3JB9H 5KBPA 4JNFA 4OMNA 1ZSZA 1H92A 2QGGA 2F18A 5KCHA 3JCMQ 4HCCA 2GQIA 3JB9I 5I11A 2M51A 5KYNA 3BVUA 5ECAA 1UJYA 4IUPA 3M0SA 2CZ0B 3JAME 1UG1A 1IHWA 2HBPA 4A54A 4PJOF 4Z02A 2KI7A 2QEXQ 3VKHA 1BI2A 1VQLQ 4HY9A 2JXBA 3QSUA 2PNIA 1NYGA 3EG3A 2O31A 3JB9F 4FZSA 2WSCE 2RQRA 3CC4T 4EPCA 2PY6A 2MI7A 1M1GA 3EFOA 4M77D 3QDFA 3I5SA 1FXXA 3OS2A 1GL5A 2EJGA 3DLLA 1ZQ1A 4CC7A 4C92E 3JCMX 1JB0E 1WA7A 1OI1A 4RCBA 5J26A 3OB9A 4JLGA 1YIJA 1EX4A 1KQ1A 3CCEQ 1WHKA 4OB1B 1X27A 2OTLT 4KH0B 2BKDN 1Q95G 4RTWA 2OAWA 1VQPQ 1WZOA 1WHGA 4EDUA 1BKBA 1AHJB 4J6XA 4RTVA 4E7HA 2P84A 5KYYB 3MEUA 1WDZA 1Z9QA 3L2RA 2JMAA 3CCQQ 4N4HA 2M16A 1KQSS 1O7DB 1B3QA 2DBKA 2LTOA 2LX9A 1SUFA 1RAAB 4ESRA 1QP3A 1WXTA 2GA9D 4NL2A 1M2VB 2JM9A 3MJXA 4K11A 4BE1A 4GLKA 1SPKA 3VS1A 5CKEA 2CP6A 2LC4A 4D6WA 1M90R 3EG9A 3JB9D 2DKGA 2YI9A 4GY5A 3M0PA 3LMFA 5A0DA 3EHRA 1KHCA 2LJ1A 3CZNA 3MCAB 2A28A 2DL8A 3C12A 4PJOB 3FD9A 2HSPA 3PLTA 2KYMA 2FB7A 4HT8A 1SKUB 2QKWA 5E84A 1WJSA 1NYFA 2VASA 4ZGDB 4LNPA 2ZGWA 5KE3A 4DEXA 1TQVA 2F2WA 4J6WA 1WFWA 3I35A 4FM3A 1TXQA 4KULA 1BBZA 1YI2T 1I81A 4WF2A 3EJSA 4KUDK 1JXMA 3I04A 2M0YA 2QDLA 4M77A 2J6FA 1PD1A 3QUIA 2MCNA 3V8JA 3I5RA 4M7AA 1GNLA 5I2MA 3M58A 3CC4Q 3QPHA 5LJ3d 1YJ9T 2KROA 2F1AA 4X9DA 2CH4A 2M9UA 4A4EA 2CZ7B 2FHDA 2DRKA 4LDXA 1ZHIA 2X4XA 2AK5A 3PMTA 1T0JA 1SRMA 1U1SA 2L89A 4ORZA 3QJYA 4J9BA 4RTXA 4FYVB 2DEQA 4C0GA 4LD9K 3PTAA 4HR1B 4EZUA 3S3MA 2HQHA 3GBQA 3OW2S 1K76A 2O01E 3BUIA 4C92G 2E41A 2RM4A 2ND0A 1OU9A 3I56A 4C5IA 3QG1A 2LP5A 1SF9A 1X6GA 4A53A 5GAMd 1W1FA 3RV1A 2P4TA 1VOMA 3A8OB 3L42A 2BE7D 2DD4A 1GFDA 3J80E 4XTYA 3OS0A 3M3WA 5HK3A 2RH2A 4MMLA 3VV0A 3L2UA 3MEVA 5GAOl 4M7DB 1LOJA 3BUDA 1U06A 2E6ZA 3KBGA 4C8QB 3BVWA 3QNJA 1VQOA 3JCMg 1E6HA 1VQLA 4OMFB 2WINM 2PMRA 1TWBA 1QWUA 4C0DB 2AHJB 5A2QE 3VS2A 5FU7C 2X9HA 4M78C 1VQ6A 3HPWA 3CCMT 4R5GA 1KC8U 1N6AA 2D8JA 1H3HA 2VC8A 1I4K1 3H41A 3QWXX 2L0AA 1G3WA 3X25B 1Q82R 1D0XA 3OW2A 3L3OM 2NYSA 3CKDA 3HRTA 4E81A 1TU0B 3CMAT 1MGQA 3T49A 2E1HA 1YI2Q 3CCEA 3G4ST 2X3VA 1M27C 3NHNA 5GAN8 1SHGA 5L8RE 3ACOA 2EX3B 1JJ2S 5KE2A 5EC7A 2K4YA 4EMKB 2DFUA 3QE6A 3BVXA 2ZXQA 3LWHA 4LUDA 3D7SB 1X6OA 4EZXA 2R5MA 5FW9A 1HSQA 3FRNA 3BY7A 2JJ9A 3RPMA 1YJ9Q 3FC3A 2MI6A 3CCQA 5FLXE 4BY6C 1IGQA 3EGUA 1R0CB 1Y96B 4G6QA 1UHCA 1WIEA 1Y07A 2KVQG 3UF4A 4DBFA 3H6ZA 4M78F 2EWNA 3RR6A 4C92F 3CZSA 2WSFE 3G6ET 1AZEA 1Q7YC 4DA4A 5GANe 4L59A 2SEMA 4RKUE 4FZOA 4NPHA 3HTRA 4M7AE 1HYOA 4AFQC 1KK7A 3ASKA 2DZCA 3MPUB 1V29B 1W9MA 4J9DA 3T4AG 1SRLA 1JJ2A 4IUQA 2KRNA 4QT7A 3MKDA 1YIJT 5LJ3f 1Q86C 1C6VX 1MJGA 1I5OB 3P8HA 1B34B 3RERA 1HXDA 2J6OA 2CZ1B 4DBHA 3IQLA 2C0TA 2RJEA 5HCKA 2YRDA 1K9MC 2H8HA 3DB4A 3EJQA 3BUPA 1BCMA 2K5FA 1V76A 1NPPA 3OQ5A 1ZA1B 1UPXA 2EPDA 3VS7A 2LT1A 4J9FA 3RMQA 3E9GA 2ZPBB 4IUVA 5CCAA 3HKSA 3QJ6A 1OEBA 2DMOA 3Q84A 1K8AC 3CCMQ 1M1KR 3KUFA 5IAYA 5GAN2 3CC4A 3QKJA 3JCMW 4ELZC 2L3RA 8ATCB 1JBMA 3EJRA 5GAMf 2R5AA 4M78D 4FU6A 1OU8A 2EYWA 2BIVA 2CT3A 3CMAQ 5A0GA 2RHUA 3X26B 2FG0A 4L5GA 1GBQA 3H0IA 3G4SQ 4XU3A 2XDDA 1DKZA 2OTLA 3F7WA 1RLQC 3PGGA 1UDLA 5CKHA 1NJIC 2DL7A 4M0MA 3VKIA 3ABHA 3C94A 1QWNA 1RAEB 3THKA 1XNIA 1QWEA 1ZX6A 1QX1A 5GAOr 2Z0OA 3JCMf 4FSXA 3VUBA 2XG8D 3OYMA 4IM2A 1V1CA 4EZNA 2RA2A 1D1CA 1YFNA 1QKXA 3CXCP 2D6FA 3G6EQ 3C0CA 3I55T 2P0PA 2RMOA 1JEGA 2A08A 3BUBA 2YLAA 3DX3A 2K7AA 3SYVA 3OA6A 2DZ9A 4V2SA 5LJ5d 1YIJQ 1M1FA 2HSEB 3HAIA 2ND1A 2VWFA 4HT9A 3QNIA 1QCOA 3TSZA 4M7AG 3RBBB 4LUEA 1YI2A 1PRLC 3TU4K 2G3RA 3B52X 3LH5A 4Z88A 5LL6S 1D3BA 3OHXM 3BE3A 3M56A 2CYZB 2VGNA 1M2OA 4N4GA 4BE2A 3JCMh 4MDXA 2PU9B 2X5CA 3G7ZA 4M78A 1KJWA 1LNXA 2HZYA 3HL8A 1I1JA 2YT6A 2PVOB 3ERCC 2RJCA 1FMKA 1YJ9A 5LJ3e 3X24B 4JL9A 3QWEA 2AKKA 2QQRA 3CPFA 4F17A 1Q81R 1W6XA 4LDUA 4EMHA 1WX6A 3HFOA 4MDWA 4EZOA 3QIIA 4EZRA 1VYUA 2N3KA 1SEMA 2QAZA 2XI9A 2XDPA 5D6XA 3SWNB 1TG0A 1WJRA 2LCCA 2RQUA 3RESA 1H8KA 2JTMA 5HY6A 2C0OA 1VQ6T 2XD0A 5FU6B 1NM7A 2AKLA 3M57A 1RAIB 1Y2OA 2EVRA 4J83A 4JRQA 2YLLA 1ZSZB 1R33A 3CCVT 1K0SA 4AKVA 3PFSA 2PUKB 2RQVA 2RI5A 4BUGA 3JB9G 4PNOA 5C0MA 3I01A 2ED0A 1SHFA 4JRKA 2JNSA 2EGCA 4UDYX 2YL9A 2MF2A 2YUOA 5IH2A 4RTYA 3HAJA 3H0FA 2AIRB 3BW1A 2QTXA 3E2UA 3H0HA 4H6IA 1KD1U 5GAMe 2RI3A 1NPRA 2JNKA 2M02A 1O7DC 2HBWA 5CKBA 1M5Q1 2KBTA 3BVVA 4HCBA 5CVIA 4M75C 3OYLA 3SDZA 2IVWA 1I4TA 4HA8A 3I55Q 3QYGB 4J8OA 1QVGS 1TUCA 2F69A 3H8ZA 1FMVA 4ATOA 1QVFA 2LQ8A 3EFOB 1NE8A 2QQ9A 2YDLA 4IIMA 1TQUA 3FIFA 3T48A 2J06A 3G9GA 4HCKA 4M7AF 4E7SA 2BZ8A 4RTUA 2RB6A 2YLBA 2YL5A 2RT6A 3KFVA 3LX7A 4FW1A 4CI0C 4R5JA 2DXBA 3MP1A 1M3BA 4P5NA 4KIKA 2A7YA 2RQTA 2EQJA 1B07A 2KT8A 4BD3A 4PKCC 1Q7YU 1UGQB 3KDRA 4BB7A 2KR3A 2JOYA 4HXJA 2V26A 3I56Q 1I0CA 2XIDA 4RG2A 2K3BA 2QASA 3M0TA 1RI9A 2EQMA 3OY9A 2FZGB 3D4YA 2ZPFB 4CC2A 1Q86U 1K1ZA 1R5EA 2FPFA 1KFZA 2YUQA 5LJ5f 1VQMA 3I39X 3QDRB 3OBWA 3OBYA 1Q82C 1N8RC 2QYZA 4JRPA 2EGEA 1VQOQ 1K9MU 1NLOC 1RUWA 3WVEB 3EG9B 2KQWA 1PSEA 2BZXA 5A0LA 2PVDB 3LLLA 1PG5B 1NJIR 4HKEA 1ZWWA 2DLPA 2FVUA 4TVRA 2COWA 2QG9B 4R5LA 1YCSB 1VQ6Q 4QW2A 3G6EA 3SOGA 5GJVB 4JJNK 2E65A 2F1LA 1WHHA 1K0XA 1WXUA 3JCMV 1K8AU 3A1PA 3CCVQ 2CGHA 4M7AD 1VQ7T 5GAN5 4A4GA 4M78E 1G83A 2RHYA 3RDVA 1BIBA 4UC4A 1RAHB 1YNZA 2EJFA 4WTOB 3BLBA 4FCYA 2ROLA 4F16A 1ZUKA 4QKUA 4IWPA 2FICA 2K2VA 4DBRA 4J7IA 3EG0A 1U5SA 2ATCB 2R57A 2HD0A 4LXCA 2DE0X 5C6SA 3O8VA 4M77B 4IURA 1ZYLA 3T9NA 2LX7A 3EGXA 1W2BP 1NJIU 4HVWA 2F2VA 2A37A 4FYYB 1E2UA 4B9QA 5C5BA 1PD0A 2O9VA 4RTTA 1S72A 3VRYA 2FEIA 4M7DC 1WJQA 2VXFA 4C8QC 4M75D 3JRZA 2MYSA 5IHIA 1AEYA 1YITT 3B51X 4FZPA 2GTJA 3N5BB 1VIEA 1UGSB 4E7ZA 3NTIA 1IO6A 2QA4T 2HL5C 4PJLA 1LPLA 2GQVA 2KDSA 4XTWA 3SEMA 5I2SA 2RAJA 3CC7T 1X03A 3A8GB 4PJJA 2LM0A 1KSWA 3VYGA 3UDCA 1JQQA 1EZZB 4JUVA 3X28B 4GBQA 2E70A 4IM0A 1M4ZA 2NLUA 2EW3A 1C1AA 4AT1B 1Y0MA 2KXCA 1FYNA 2L2PA 5CQXA 2X3XD 1M1KC 1BIAA 2EQIA 4EMKC 2EQKA 4R55A 1ZLMA 1BK2A 1QW1A 1WDXA 1WYXA 3ER9B 1PHTA 1TTHB 2BE9B 1CKAA 3PT9A 5LJ3g 3HSBA 3TSWA 2EBPA 2K6DA 3NFCA 4X9CA 5AYFA 1JO8A 2QQSA 5D6YA 1KQSA 5GANf 4ZGEB 4XU0A 2EAYA 4DQ2A 1F1BB 5I22A 3CPWP 2KEAA 3EAEA 1M90U 2MMPA 3SB2A 2OW7A 4KH1B 3J81E 2I2LA 3OSSC 2DA9A 2DF6A 3I55A 4EMGA 2C06A 2GCXA 3E9FA 1N27A 2B8AA 2Y90A 3EGDA 5FWCA 1VQ7Q 4RUGA 4VUBA 3JCMP 2JZ2A 4HCZA 2QI2A 4J9GA 2W10A 4RMOA 3DYTA 3GI7A 3ER0A 2Z0VA 2FO0A 5LJ5e 2GBQA 1OZ3A 2OTLQ 3CAZA 2V8IA 3QZ5B 4XTZA 5GAMg 1I49A 4Z8AA 2AT1B 2RNAA 3F70A 2MK5A 4OP0A 3NTHA 2FYKA 1JRIA 1WLPB 2EGAA 4BI4A 1N5ZA 4M78G 5J39A 3CCUT 4M75A 1GRIA 5FLEX 3WVDB 2YXYA 4NS5A 4MZTA 1NG2A 2X3WD 1TH7A 3LYIA 5IHKA 4OGEA 5GANh 3ZL7C 3META 1JXOA 2KSSA 1HWWA 1YITQ 5EG2A 1BI3A 1QVPA 3GF5A 3CCLT 4OMLA 1Y7XA 1Z9ZA 2MWOA 2KYBA 1YJWA 3BFMA 4JJDA 2O0I1 2EQUA 2QA4Q 4KGXB 2BTTA 2E12A 1MNEA 1ZUYA 2JN0A 2RAIA 2WYIA 5KYWA 2L5QA 2RJFA 4DYLA 4DEYA 2X3XA 3CD6T 2OX7A 3QBYA 1OX8A 4ATMA 1YJNA 1UJ0A 5DLOA 3URGA 1IXDA 3CCVA 1N8RR 1AOJA 1VQ5A 1XTDA 2P0KA 3O3OB 2COZA 2O4XA 4Y91A 1SU7A 1TUDA 1Q81C 2DILA 2M0OA 1RI0A 2HDAA 4JS4A 3Q0KA 4ELYC 3OMGA 4OMMA 2EFLA 3M0QA 4EZVA 1HJDA 2E4HA 2RN8A 1JQKA 4JRIA 4IM3A 1TSFA 1QKWA 1N9SA 2HQEA 4EZPA 1VQMT 3MO8A 2E64A 3VS0A 3AT1B 1VQKT 3Q1JA 4J6YA 5KYXA 2K3XA 5FWBA 2X51A 4PO2A 1Q82U 3PMIA 2EJ9A 1N8RU 4FW2A 2RAKA 4FM4B 2GF7A 3GLXA 5L23A 5HK0A 5KYUA 3C7NA 2FZCB 1MMNA 1GXIE 2E3HA 4B6MA 3OMCA 3TEEA 4XTVA 2XKOC 2X4JA 2P4RA 2X3WA 1QQJA 3GNFB 3CCUQ 4JN4A 3SD4A 5HKCA 2QQAA 2DIQA 4XAXB 3PIPA 4E7KA 2CH4W 2DL4A 2DTHA 1TOVA 2Z8YA 2J05A 4F14A 4KUIA 1X69A 1YCYA 4NOYA 4AG1C 3REAB 2DL5A 2LQWA 4HYBA 2VKNA 1FX7A 2DERA 2YHTA 5GAOp 2ABLA 2ECZA 3CCLQ 4LDVA 1Y71A 2LNVA 2COYA 1H3ZA 1NBEB 2LDMA 3OYDA 2EYQA 1X04A 4AZCB 3BUQA 4KT0E 2E5KA 2CREA 1X01A 4FT4A 3PE0A 1S72T 1NEBA 4BE0A 4M75E 3M59A 2KXDA 1X43A 2CUBA 3EH1A 3OYEA 5CKFA 4KGZB 2OW6A 3QZ9B 2X4WA 1OOTA 4MMKA 2ROTA 2XHCA 2RF0A 2RQWA 4J5YA 4X1VA 1VQ7A 1WXBA 1TUGB 2D9TA 4EMKA 2HL3A 2F7QA 1ZSZC 1W70A 1UE9A 1K73R 2O9SA 2ZCFB 4JS5A 2HAXA 3MHXA 1ABOA 3QHSA 2PUOB 2V8JA 3JCMc 1YHQA 5LJ3h 3HRUA 3QWYA 1D3BB 2DO3A 3PIOA 4F7UA 3CCRT 2DJZA 2LJ3A 3FJPA 1G3SA 4DBQA 3CCJA 1TS9A 4M78B 3A5ZB 3DPPA 4C92B 1VQMQ 1M1KU 2MIOA 1PCXA 2LXYA 1OAOA 2HNIA 3L1AA 3LGLA 1D09B 3SHWA 1NZ9A 1AZGB 1VQKQ 1VQNA 1NLPC 2L3SA 2NUTA 1YITA 3FEOA 4KGVB 3CCSA 1DJ7B 1SU6A 2RHIA 4LD6A 1WGSA 4IIOA 5LJ5g 4IWQA 2O88A 2JT4A 2OTJA 3G71A 2QA4A 2YIAA 4FT2A 1K9AA 4JPBW 3VUZA 3OYNA 3JSCA 3CC7A 2BZYA 3CXCS 3L2VA 3M4GA 5GAMh 3VU3C 3GIBA 4XTUA 1UGRB 4M4ZA 2LQNA 3GPLA 1PC0A 2CP0A 5GAN6 4JLIA 1M8VA 2DXUA 4XU1A 4JNEA 4E47A 3T47A 4CC3A 2YUNA 1FMWA 2XK0A 1URUA 3SFMA 1R8OB 3MP6A 2YRVA 4RTZA 3V7CA 1VA7A 2LCLA 4ANJA 1M3CA 2V8KA 2JTFA 2RK2A 4E7JA 1X6BA 3VS6A 2LCSA 4D8KA 3GNGA 1C0MA 1VUBA 1AD5A 4Q5WA 2LNHB 1VQ8T 3M4YA 2CP3A 2L3PA 1T3SA 2OBLA 1S72Q 3ZEHA 5GAOm 1MMAA 1WQ7A 1IGUA 3QA8A 3CMEA 2L3QA 1G3YA 2WYHA 1XOVA 2W0ZA 3ZEDA 1D1AA 4I1QA 2L8DA 4ZTJA 4M7DE 1YJWT 4C8QE 1MHNA 2X35A 1HXKA 2LMJA 3S3OA 2QTVA 2H3JA 3CVRA 4PLIA 4KIKB 4UDXX 2A0FB 1YWOA 2HKNA 4M75G 1N9RA 1RACB 5GAN3 1PRMC 8AT1B 3NGPA 4Y28E 1U00A 2DXTA 4FIBA 1RADB 4E7LA 1YJNT 1VQ4A 2JW4A 7AT1B 1QCNA 2AZSA 4BDZA
chains in the Genus database with same CATH topology
2OBMA 1X6GA 3EG2A 2D0NA 2DE0X 1W1FA 3RV1A 1S1NA 1GFDA 2DJQA 2JM8A 3PVQA 4R5IA 2EYYA 2G6FX 2SRCA 1ZYLA 2LX7A 4ZNXA 4HVWA 4E6RA 1PKTA 2F2VA 2A37A 4IW0A 1E2UA 4B9QA 1AWWA 1BB9A 2DL3A 1M8MA 1U06A 2YUPA 2O9VA 3EG1A 3QNJA 4D8JA 4RTTA 3VRYA 2FEIA 2D8HA 1E6HA 1SSHA 2WINM 5IHIA 1E7OA 1AEYA 4EZWA 1QWFA 1E6GA 3B51X 2GTJA 3VS2A 1UECA 3O3MB 5IHNA 2V1QA 4R5GA 2AZVA 2QXLA 2D8JA 1H3HA 1IO6A 3JV3A 1VYVA 3H41A 4JWEA 4JLCA 3QWXX 2FRWA 2L0AA 4R0KA 3ULRB 3SEMA 3EHQA 4H6HA 3ER8C 1HD3A 2LM0A 3L3OM 3T46A 1KSWA 2JS0A 4E81A 4LN2A 1JQQA 3REBB 3T49A 4GBQA 2A36A 4IM0A 4KRTA 2EW3A 4OMPA 1M27C 1OPKA 3NHNA 2GAFD 1SHGA 2EX3B 1Y0MA 5EC7A 3DPQA 2KXCA 2LJ0A 1FYNA 2L2PA 2X3XD 2EYXA 2PTKA 4LUDA 2EQIA 2J7IA 5IXFA 1ZLMA 1WDXA 4EZXA 1BK2A 2DBMA 3M0RA 5FW9A 1WYXA 3ER9B 1PHTA 1HSQA 1CKAA 1QLYA 3TSWA 2EBPA 2K6DA 2QFFA 1JO8A 2KHOA 1UTIA 3I9QA 2EWFA 2DNUA 3EGUA 1E1DA 5I22A 4IWOA 2KEAA 2DRMA 4G6QA 1Y57A 1UHCA 1WIEA 1SU8A 2YSQA 3UF4A 4AFUC 1BU1A 1PNJA 2RPNA 1AWOA 2DA9A 2DF6A 4Y92A 2OJ2A 2V1RA 1AZEA 4EZZA 2SEMA 5FWCA 4NPHA 4RUGA 3U23A 3OWGA 2I0NA 1GCPA 2LZ6B 3PVLA 4AFQC 4JJCA 4J9GA 2W10A 1X2QA 1W9MA 3GI7A 4J9DA 1M3AA 3T4AG 2FO0A 4E3CA 1SRLA 2JMCA 4AG2C 1KIKA 2KRNA 4QT7A 2GBQA 1GBRA 1MJGA 4EZQA 2EKHA 2J6OA 2EYZA 4Z8AA 3KAVA 2RNAA 3IQLA 2C0TA 1WLPB 2EGAA 2JS2A 2NCZA 1N5ZA 2FRYA 3FJ5A 5HCKA 1PWTA 2H8HA 1GRIA 5FLEX 2O2OA 1NG2A 1ZSGA 3UA7A 3VS5A 2X3WD 5IHKA 1UPXA 2EPDA 2FPEA 3VS7A 4OMOA 2CT4A 3ZL7C 2KRMA 1JXOA 4J9FA 2J6KA 2KRSA 4J9EA 2HEQA 1OEBA 2DMOA 1WI7A 4OMLA 1Z9ZA 2KYBA 1OV3A 1CSKA 4JJDA 5FIGA 1VYTA 2BTTA 1E9VA 2GNCA 1ZUYA 2EYWA 2GGRA 4JWIA 2NUZA 4Z89A 2CT3A 3VS4A 4DEYA 2FG0A 3CQTA 4F01A 1GBQA 1AWXA 1UGVA 3H0IA 1UJ0A 2NWMA 1DKZA 3F7WA 1YWPA 1RLQC 1ARKA 4JWCA 1UDLA 3UITA 2KT1A 1DKYA 2VVKA 4EZSA 2DL7A 1EFNA 1AOJA 2YIBA 4M0MA 3O3OB 1JU5C 1MUZA 3NPFA 1QCFA 2LP5A 1SU7A 3THKA 1GN9A 1TUDA 2DILA 1OA1A 1QWEA 4F00A 4LE9A 4GLMA 1T0HA 2OI3A 1ZX6A 3O5ZA 4FSSA 1OPLA 2HDAA 4WCIA 1T3LA 2FPDA 4OMMA 2ED1A 3M0QA 2CDTA 3O3NB 4EZVA 1UFFA 4IM2A 1V1CA 3R6NA 4EZNA 1HJDA 2KGTA 1JQKA 2RN8A 1LCKA 4JZ4A 2YIVX 4IM3A 2CSQA 1QKWA 1QKXA 4EZPA 2YI8A 2K2MA 3C0CA 1AVZC 1CKBA 3VS0A 5GJWB 1RLPC 1YP5A 2RMOA 1JEGA 2A08A 5FWBA 1UHFA 4PO2A 4EZYA 2K7AA 2D1XA 3A98A 1GNTA 1YN8A 5L23A 4A63B 3DPOA 2DVJA 3VEBA 3C7NA 1GCQA 2ND1A 4JNFA 4OMNA 2VWFA 2P4RA 3RV0A 1H92A 3TSZA 4JN4A 2GQIA 5I11A 2M51A 3RBBB 4LUEA 5ECAA 2CH4W 2DL4A 1PRLC 1UJYA 3B52X 3D2FA 3LH5A 3M0SA 2Z8YA 1MV0B 2J05A 4Z88A 4F14A 5IXBA 3OHXM 1X69A 1UG1A 2DX1A 4AG1C 3REAB 2IIMA 2DL5A 3VKHA 2LQWA 4HYBA 2VKNA 1NEGA 2F2XA 2ABLA 2ECZA 2X5CA 4HY9A 1KJWA 2JXBA 2PNIA 1GFCA 1I1JA 1NYGA 2YT6A 2HCKA 3EG3A 2O31A 3ERCC 1FMKA 2RQRA 4R5KA 4JL9A 2AKKA 2CREA 2E5KA 4F17A 1W6XA 2PY6A 1WX6A 3PE0A 4EZOA 4EZRA 1NEBA 1VYUA 2N3KA 2JTEA 1SEMA 4HVVA 3UA6A 3I5SA 2KXDA 1GL5A 1X43A 4J9IA 4CC7A 2CUBA 1TG0A 1WA7A 2MOXA 4HVUA 2RQUA 1OA0A 1H8KA 1OOTA 2K79A 2C0OA 2ROTA 3M0UA 1NM7A 2AKLA 2RF0A 2EVRA 2RQWA 1X27A 1DKXA 3B53X 4X1VA 4RTWA 1WXBA 2OAWA 2B86A 1K0SA 2RQVA 3I01A 2ED0A 2KNBB 1W70A 1MV3A 1SHFA 1UE9A 2O9SA 3TVTA 2JNSA 2EGCA 4UDYX 1ABOA 2CUDA 1ZUUA 2YUOA 4RTVA 5IH2A 4JZ3A 2ENMA 4RTYA 1PKSA 3H0FA 1ZBJA 3H0HA 3QWYA 1Z9QA 4H6IA 4OMQA 2JMAA 2LJ3A 1J3TA 2KE9A 1B3QA 2DBKA 1SUFA 1G2BA 4ESRA 2HBWA 1WXTA 2GA9D 2KBTA 3DPPA 2JM9A 4K11A 2MIOA 1TUCA 4J9HA 1OAOA 4JWDA 1SPKA 1I07A 2DYBA 3VS1A 3SHWA 1AZGB 1NLPC 2L3SA 2YI9A 3M0PA 3LMFA 2YDLA 4IIMA 1SU6A 3EHRA 3T48A 4IIOA 2LJ1A 2J06A 4IWQA 4HCKA 2O88A 2JT4A 3VRZA 2BZ8A 1UUEA 2A28A 4RTUA 2DL8A 3D2EA 2YIAA 2RT6A 3FD9A 3KFVA 1K9AA 4R5JA 2HSPA 4JPBW 2BZYA 1X2KA 4D8DA 2KYMA 1M3BA 4KIKA 4HR1A 5E84A 1NYFA 2DM1A 2LQNA 3NMZC 4M4ZA 2RQTA 4LNPA 1B07A 1K4US 2KT8A 4DEXA 5TKYA 2F2WA 3KDRA 4AFZC 4JNEA 2ESWA 3T47A 1WFWA 3I35A 4FM3A 2KR3A 2YUNA 4CC3A 1BBZA 4HXJA 1I0CA 1A0NB 2K3BA 4J9CA 3M0TA 1RI9A 4RTZA 2K9GA 1VA7A 1JXMA 1M3CA 3I04A 4CC2A 2M0YA 2QDLA 4AFSC 1X6BA 2J6FA 3KAWA 2MCNA 3I5RA 1K1ZA 3UATA 2LCSA 3VS6A 2FPFA 1KFZA 2YUQA 1GNLA 2CSIA 4D8KA 3I39X 1AD5A 2PZ1A 1ABQA 2LNHB 3VS3A 2L3PA 1T3SA 2EGEA 2OBLA 1NLOC 1RUWA 2KROA 2XMFA 2BZXA 2CH4A 1AWJA 4CC4B 3QA8A 2GTOA 2L3QA 2DRKA 2DLPA 1XOVA 3RNJA 3ZEDA 2W0ZA 4R5LA 1YCSB 2AK5A 1T0JA 1SRMA 5GJVB 1K0XA 4ORZA 4J9BA 2LMJA 3VEAA 1WXUA 4RTXA 4JJBA 4KIKB 4UDXX 4HR1B 4EZUA 1U3OA 3EG0A 1G83A 1YWOA 2C0IA 4EZTA 3GBQA 1PRMC 1K76A 3NGPA 1YNZA 1U00A 2ROLA 4F16A 1ZUKA 1M30A 4IWPA 2ND0A 2JW4A 4EIKA 2AZSA 1GCQC 1U5SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X6G A;  3EG2 A;  2D0N A;  2DE0 X;  1W1F A;  1S1N A;  1GFD A;  2DJQ A;  2JM8 A;  3PVQ A;  2EYY A;  2G6F X;  2SRC A;  2LX7 A;  4ZNX A;  4HVW A;  4E6R A;  1PKT A;  2F2V A;  2A37 A;  1AWW A;  1BB9 A;  2DL3 A;  1M8M A;  1U06 A;  2YUP A;  2O9V A;  3EG1 A;  4RTT A;  3VRY A;  2FEI A;  2D8H A;  1E6H A;  1SSH A;  5IHI A;  1E7O A;  1AEY A;  1QWF A;  1E6G A;  2GTJ A;  3VS2 A;  1UEC A;  5IHN A;  2V1Q A;  2AZV A;  2D8J A;  1H3H A;  1IO6 A;  3JV3 A;  1VYV A;  3H41 A;  3QWX X;  2FRW A;  2L0A A;  4R0K A;  3ULR B;  3SEM A;  3EHQ A;  1HD3 A;  1KSW A;  2JS0 A;  4LN2 A;  1JQQ A;  3REB B;  4GBQ A;  2A36 A;  4KRT A;  2EW3 A;  4OMP A;  1M27 C;  1OPK A;  3NHN A;  1SHG A;  1Y0M A;  5EC7 A;  2KXC A;  2LJ0 A;  1FYN A;  2L2P A;  2X3X D;  2EYX A;  2PTK A;  4LUD A;  2EQI A;  2J7I A;  5IXF A;  1ZLM A;  1BK2 A;  1WDX A;  2DBM A;  3M0R A;  5FW9 A;  1WYX A;  1PHT A;  1HSQ A;  1CKA A;  1QLY A;  3TSW A;  2EBP A;  2K6D A;  1JO8 A;  1UTI A;  3I9Q A;  2DNU A;  3EGU A;  5I22 A;  2KEA A;  2DRM A;  1Y57 A;  1UHC A;  1WIE A;  2YSQ A;  3UF4 A;  4AFU C;  1BU1 A;  1PNJ A;  2RPN A;  1AWO A;  2DA9 A;  2DF6 A;  4Y92 A;  2OJ2 A;  2V1R A;  1AZE A;  2SEM A;  5FWC A;  4RUG A;  3U23 A;  2I0N A;  1GCP A;  2LZ6 B;  3PVL A;  4AFQ C;  4JJC A;  4J9G A;  2W10 A;  1X2Q A;  4J9D A;  1M3A A;  2FO0 A;  1SRL A;  2JMC A;  4AG2 C;  1KIK A;  2KRN A;  4QT7 A;  2GBQ A;  1GBR A;  2EKH A;  2J6O A;  2EYZ A;  4Z8A A;  2RNA A;  3IQL A;  2C0T A;  1WLP B;  2EGA A;  2JS2 A;  1N5Z A;  2FRY A;  3FJ5 A;  5HCK A;  1PWT A;  2H8H A;  1GRI A;  2O2O A;  1NG2 A;  1ZSG A;  3UA7 A;  3VS5 A;  2X3W D;  5IHK A;  2EPD A;  2FPE A;  3VS7 A;  4OMO A;  2CT4 A;  3ZL7 C;  2KRM A;  1JXO A;  4J9F A;  2J6K A;  2KRS A;  4J9E A;  2HEQ A;  1OEB A;  2DMO A;  1WI7 A;  4OML A;  1Z9Z A;  2KYB A;  1OV3 A;  1CSK A;  4JJD A;  1VYT A;  2BTT A;  2GNC A;  1ZUY A;  2EYW A;  2GGR A;  2NUZ A;  4Z89 A;  2CT3 A;  3VS4 A;  4DEY A;  2FG0 A;  3CQT A;  1GBQ A;  1AWX A;  1UGV A;  3H0I A;  1UJ0 A;  2NWM A;  1YWP A;  1RLQ C;  1ARK A;  1UDL A;  2KT1 A;  2VVK A;  2DL7 A;  1EFN A;  1AOJ A;  1JU5 C;  1MUZ A;  3NPF A;  1QCF A;  2LP5 A;  3THK A;  1TUD A;  2DIL A;  1QWE A;  4LE9 A;  4GLM A;  1T0H A;  2OI3 A;  1ZX6 A;  3O5Z A;  4FSS A;  1OPL A;  2HDA A;  4WCI A;  1T3L A;  2FPD A;  4OMM A;  2ED1 A;  3M0Q A;  2CDT A;  1UFF A;  1V1C A;  3R6N A;  1HJD A;  2KGT A;  2RN8 A;  1LCK A;  4JZ4 A;  2CSQ A;  1QKW A;  1QKX A;  2K2M A;  3C0C A;  1AVZ C;  1CKB A;  3VS0 A;  5GJW B;  1RLP C;  1YP5 A;  2RMO A;  1JEG A;  2A08 A;  5FWB A;  1UHF A;  2K7A A;  2D1X A;  3A98 A;  1YN8 A;  5L23 A;  4A63 B;  2DVJ A;  1GCQ A;  4OMN A;  2VWF A;  2P4R A;  1H92 A;  3TSZ A;  2GQI A;  5I11 A;  2M51 A;  3RBB B;  4LUE A;  5ECA A;  2CH4 W;  2DL4 A;  1PRL C;  1UJY A;  3LH5 A;  3M0S A;  1MV0 B;  2J05 A;  4Z88 A;  4F14 A;  5IXB A;  1X69 A;  1UG1 A;  2DX1 A;  4AG1 C;  3REA B;  2IIM A;  2DL5 A;  2LQW A;  2VKN A;  1NEG A;  2F2X A;  2ABL A;  2ECZ A;  1KJW A;  2JXB A;  2PNI A;  1GFC A;  1I1J A;  1NYG A;  2YT6 A;  2HCK A;  3EG3 A;  2O31 A;  1FMK A;  2RQR A;  2AKK A;  2E5K A;  2CRE A;  4F17 A;  1W6X A;  1WX6 A;  3PE0 A;  1NEB A;  1VYU A;  2JTE A;  1SEM A;  4HVV A;  3UA6 A;  3I5S A;  2KXD A;  1GL5 A;  1X43 A;  4J9I A;  4CC7 A;  2CUB A;  1TG0 A;  1WA7 A;  2MOX A;  4HVU A;  2RQU A;  1H8K A;  1OOT A;  2K79 A;  2C0O A;  2ROT A;  3M0U A;  1NM7 A;  2AKL A;  2RF0 A;  2EVR A;  2RQW A;  1X27 A;  4X1V A;  4RTW A;  1WXB A;  2OAW A;  2B86 A;  1K0S A;  2RQV A;  2KNB B;  2ED0 A;  1W70 A;  1MV3 A;  1SHF A;  1UE9 A;  2O9S A;  3TVT A;  2EGC A;  1ABO A;  2CUD A;  1ZUU A;  2YUO A;  4RTV A;  5IH2 A;  4JZ3 A;  2ENM A;  4RTY A;  1PKS A;  3H0F A;  1ZBJ A;  3H0H A;  3QWY A;  1Z9Q A;  4OMQ A;  2JMA A;  2LJ3 A;  1J3T A;  2KE9 A;  1B3Q A;  2DBK A;  1G2B A;  4ESR A;  2HBW A;  1WXT A;  2KBT A;  2JM9 A;  4K11 A;  2MIO A;  1TUC A;  4J9H A;  2DYB A;  1SPK A;  1I07 A;  3VS1 A;  3SHW A;  1AZG B;  1NLP C;  2L3S A;  3M0P A;  2YDL A;  4IIM A;  3EHR A;  4IIO A;  2LJ1 A;  2J06 A;  4HCK A;  2O88 A;  2JT4 A;  3VRZ A;  2BZ8 A;  1UUE A;  2A28 A;  4RTU A;  2DL8 A;  3KFV A;  1K9A A;  2HSP A;  4JPB W;  2BZY A;  1X2K A;  4D8D A;  2KYM A;  1M3B A;  1NYF A;  2DM1 A;  2LQN A;  3NMZ C;  4M4Z A;  2RQT A;  4LNP A;  1B07 A;  1K4U S;  2KT8 A;  4DEX A;  2F2W A;  4AFZ C;  2ESW A;  1WFW A;  4CC3 A;  3I35 A;  2KR3 A;  2YUN A;  1BBZ A;  4HXJ A;  1I0C A;  1A0N B;  2K3B A;  4J9C A;  3M0T A;  1RI9 A;  4RTZ A;  2K9G A;  1VA7 A;  1JXM A;  1M3C A;  4CC2 A;  2M0Y A;  2QDL A;  4AFS C;  1X6B A;  2J6F A;  2MCN A;  3UAT A;  3I5R A;  1K1Z A;  3VS6 A;  2LCS A;  2FPF A;  1KFZ A;  2YUQ A;  4D8K A;  2CSI A;  1AD5 A;  2PZ1 A;  1ABQ A;  2LNH B;  3VS3 A;  2L3P A;  1T3S A;  2EGE A;  1NLO C;  1RUW A;  2KRO A;  2XMF A;  2BZX A;  2CH4 A;  1AWJ A;  4CC4 B;  2GTO A;  2L3Q A;  2DRK A;  2DLP A;  1XOV A;  3RNJ A;  2W0Z A;  1YCS B;  2AK5 A;  1T0J A;  1SRM A;  5GJV B;  1K0X A;  4ORZ A;  4J9B A;  2LMJ A;  1WXU A;  4RTX A;  4JJB A;  3EG0 A;  1U3O A;  1G83 A;  1YWO A;  2C0I A;  3GBQ A;  1PRM C;  1K76 A;  3NGP A;  1YNZ A;  2ROL A;  4F16 A;  1ZUK A;  1M30 A;  2JW4 A;  4EIK A;  2AZS A;  1GCQ C;  1U5S A; 
#chains in the Genus database with same CATH topology
 2OBM A;  1QVF P;  2ZPI B;  3CCR Q;  2D0N A;  4O5V A;  3CCU A;  1S1N A;  4A4H A;  4DOW A;  1VQ5 T;  2F7P A;  2OO2 A;  1RL2 A;  2DJQ A;  2EYY A;  2G6F X;  2LT4 A;  1D0Z A;  3A8H B;  4M77 C;  1PKT A;  4E6R A;  4IW0 A;  2PQW A;  1BB9 A;  1OZ2 A;  3EG1 A;  2MAM A;  5DLQ E;  2D8H A;  3OYI A;  2IPO B;  1SSH A;  1Q81 U;  2FZK B;  4JDS A;  4ZN1 A;  4FYW B;  3NTK A;  5GAN 4;  3CCL A;  3LLR A;  2VYT A;  4F04 B;  4A4K A;  2CZ6 B;  3OS1 A;  1UEC A;  1D1B A;  3O3M B;  5IHN A;  2F7O A;  2V1Q A;  2EFK A;  2AZV A;  4AZH A;  1VQ9 T;  2QXL A;  5GAN g;  5GMK i;  2DIG A;  2GFA A;  2DAQ A;  4F7U E;  2NUP A;  4JLC A;  2XU8 A;  3EFR A;  3RKX A;  2XDB A;  4NL3 A;  3EHQ A;  5GAN j;  4H6H A;  1PSF A;  2A3L A;  4AVM A;  3CD6 A;  3DLM A;  4LN2 A;  1U1T A;  3OSV A;  2A36 A;  2X4Y A;  4KRT A;  1PM3 A;  5AT1 B;  2GAF D;  4J7F A;  3OYH A;  2ZPE B;  4PJO C;  4BNE A;  4BAC A;  3FLG A;  4C5H A;  2EYX A;  2J7I A;  3L2Z A;  5IXF A;  5GMK h;  1TQW A;  5GAN 7;  2DBM A;  3EJP A;  1ZA2 B;  3EGX B;  3OYB A;  1QLY A;  2P0Q A;  1VQ8 Q;  5C5B B;  2KHO A;  3I9Q A;  2EWF A;  4MZP A;  4LDY A;  1I8F A;  1Y57 A;  1WQW A;  3P8B B;  1SU8 A;  2HQX A;  4XU2 A;  1QVG A;  3D51 A;  1RAF B;  1PNJ A;  4M75 F;  1YJW Q;  1XQH A;  4Y92 A;  1PS3 A;  2LQK A;  2OJ2 A;  1VQK A;  5IN1 A;  3OWG A;  1GCP A;  2LZ6 B;  3LH0 A;  3PVL A;  2Z0W A;  3CC2 T;  1M3A A;  3H9N A;  4IUT A;  2GF4 A;  2JMC A;  1HTY A;  1YJN Q;  3V7S A;  4AG2 C;  1KIK A;  2ELB A;  2F5K A;  3ZFJ A;  4M7D G;  4OB3 B;  2EKH A;  4C8Q G;  2EYZ A;  3KAV A;  3AHU A;  3L2W A;  1VQ5 Q;  2JS2 A;  4PFO A;  1PWT A;  3JCM J;  2EFI A;  3FDR A;  2O2O A;  3JB9 J;  4QQG A;  3MP8 A;  3TQ7 P;  3EFS A;  2K57 A;  1YHQ T;  2D1L A;  2YRC A;  4N4I A;  2FPE A;  5KCO A;  4OMO A;  2CT4 A;  2WSE E;  5CR2 A;  2K5L A;  2KRM A;  4J9E A;  2MWP A;  2H3E B;  3CCJ T;  4M7A B;  1WI7 A;  1BYM A;  1TQS A;  4C5E A;  3HRS A;  2BUD A;  5LJ5 h;  3OYA A;  1CSK A;  1VQ9 Q;  2CP7 A;  2F1B A;  3OYJ A;  5CO7 A;  1W2B S;  5GMK m;  1VYT A;  1I4L A;  3E1S A;  3EGD B;  2DET A;  1VQN T;  3TCJ A;  2GGR A;  2NUZ A;  3CCS T;  5GMK e;  3HFN A;  2HKQ B;  2Q13 A;  2XIC A;  4B9W A;  4F01 A;  4C0D C;  2QQB A;  1UGV A;  2NWM A;  1OYX A;  3M5A A;  9ATC B;  2OTJ T;  3G71 T;  1KQS P;  2RI2 A;  4F7U G;  3L3P A;  1EFN A;  2EIF A;  1JU5 C;  4E7I A;  4M75 B;  1QCF A;  4PJO D;  4PK4 A;  1GN9 A;  4F00 A;  4GLM A;  1T0H A;  4E2F B;  5CAI A;  4C0Z A;  5CQY A;  3O5Z A;  1O75 A;  3CCR A;  1IZ6 A;  1KQ2 A;  3RIR A;  3DDF A;  4NQI A;  2ZPH B;  3M9Q A;  2DVE A;  1LCK A;  1G5V A;  2E10 A;  1W2B A;  2E3I A;  2YI8 A;  3TRE A;  1AVZ C;  4OF1 A;  5GAO n;  5LJ3 j;  1YP5 A;  4M7D F;  4C8Q F;  1K73 C;  5IT9 E;  5KYW B;  2YKT A;  4EZY A;  3CC2 Q;  3A98 A;  3CME T;  3CPW S;  1OQK A;  3J7A F;  1G3T A;  4QVZ A;  4R56 A;  2DTO A;  2JUF A;  2R58 A;  2K5I A;  4DCN C;  3RV0 A;  2CP2 A;  4KBM B;  3BDU A;  4O6J A;  2YL6 A;  1D0Y A;  2O4X B;  4OB0 B;  3M55 A;  3A8M B;  1RAG B;  5DM7 R;  3D2F A;  5KYY A;  3OYK A;  1YHQ Q;  4AZG A;  1MV0 B;  5IXB A;  1VQ4 T;  2DX1 A;  1TQT A;  3OYG A;  2RHZ A;  2IIM A;  1IRE B;  1NEG A;  2F2X A;  3A8L B;  3CCJ Q;  5GAM j;  1GFC A;  1M2V A;  2HCK A;  1VIF A;  3UPU A;  1VQ8 A;  2WAC A;  1WHM A;  4R5K A;  2D0Q B;  1XJW B;  3C4S A;  1KG1 A;  1IB8 A;  1VQN Q;  1ACM B;  3M53 A;  4WPC A;  3OW2 P;  5KYX B;  2JTE A;  4HVV A;  3UA6 A;  3CPW A;  4F7U F;  3CCS Q;  3S3N A;  2EKO A;  4J9I A;  4QQ6 A;  4M7D D;  1KC8 R;  3L2Q A;  2MOX A;  3CBM A;  4HVU A;  4C8Q D;  1OA0 A;  3VYH B;  1MMD A;  2OTJ Q;  2K79 A;  5KYU B;  3G71 Q;  2DK3 A;  3M0U A;  4PJO A;  1R77 A;  5DY9 A;  1DKX A;  3B53 X;  3V7R A;  3CC7 Q;  3KXT A;  2ZPG B;  1WPY A;  2RK1 A;  2F7R A;  2B86 A;  1KHI A;  2KNB B;  1MV3 A;  3TVT A;  4AMC A;  2CUD A;  1ZUU A;  1R34 A;  4JZ3 A;  2ENM A;  4PL6 A;  1PKS A;  4RG8 A;  2DPP B;  3S6W A;  2CS7 A;  1ZBJ A;  4OMQ A;  2QEX A;  2JNG A;  4B9X A;  1J3T A;  1R0B G;  2KE9 A;  3DX2 A;  3ME9 A;  1G2B A;  1AT1 B;  4ZN3 A;  1MND A;  2HMA A;  4J9H A;  4C92 C;  3LWI A;  2DYB A;  4JWD A;  1I07 A;  2VV5 A;  2M1H A;  5CK9 A;  4FYX B;  4ZTF A;  3JCM d;  2QGF B;  4AZB A;  2DYI A;  1M9S A;  3CEY A;  3CME Q;  4QQD A;  2D4C A;  2YLC A;  2PVG B;  1G8X A;  1IHV A;  1KD1 C;  4RCC A;  1VQ9 A;  1JJ2 P;  3VRZ A;  1UUE A;  3D52 A;  2V0O A;  4PFZ A;  3D2E A;  1UB4 A;  1X2K A;  4L6V 5;  4D8D A;  1VQP A;  3JCM b;  4HR1 A;  2DM1 A;  3NMZ C;  3OS5 A;  1K4U S;  5TKY A;  4AFZ C;  2ESW A;  2CKK A;  3R6O A;  1B7T A;  3C95 A;  2OAU A;  1VQ4 Q;  3EJT A;  4OVA A;  1O9S A;  1A0N B;  4J9C A;  2E6N A;  2K9G A;  1OX9 A;  4F7U B;  3X20 B;  3I2W A;  3RMS A;  2KK4 A;  3EJU A;  1BCO A;  4AFS C;  1I5L A;  2RHX A;  3KAW A;  3UAT A;  2GFU A;  4OGC A;  2CSI A;  2PZ1 A;  1ABQ A;  3VS3 A;  4M7D A;  4AZ6 A;  4C8Q A;  4NSW A;  1OUL A;  4N0A C;  2XMF A;  2NUT B;  1WNL A;  3PNW C;  2YWW A;  1AWJ A;  4M77 E;  4ME7 A;  2KAF A;  2IG0 A;  4CC4 B;  2GTO A;  1BI0 A;  2VXE A;  2QXF A;  3RNJ A;  5GMK j;  4FL6 A;  3HP9 A;  2JVV A;  3VEA A;  3CV5 A;  1MMG A;  1RAB B;  4JJB A;  3DB3 A;  1U3O A;  3CC2 A;  3CD6 Q;  2C0I A;  4EZT A;  1X75 C;  4WPE A;  4MZM A;  3RKY A;  3SWN C;  2MPX C;  1M30 A;  3P8D A;  4EIK A;  4QVD A;  1GCQ C;  5FU6 C;  4H8S A;  3EG2 A;  1LJO A;  2JM8 A;  3PVQ A;  1I4D A;  4R5I A;  4LDW A;  2SRC A;  5KH6 A;  4ZNX A;  3VJP A;  4PJO E;  4BDY A;  5I21 A;  1AWW A;  2DL3 A;  1M8M A;  2YUP A;  2QK0 A;  4D8J A;  1QP2 A;  5J3B A;  3OYF A;  1WHJ A;  1Y96 A;  2QDY B;  3MEA A;  1E7O A;  5FU7 B;  4EZW A;  1QWF A;  4C92 D;  2KMT A;  1E6G A;  4ZGJ B;  3DX4 A;  5GAO q;  3LVT A;  1FWZ A;  3JV3 A;  1VYV A;  4JWE A;  2FRW A;  3DDG A;  4R0K A;  3ULR B;  5CIU A;  3ER8 C;  1HD3 A;  5CKD A;  3T46 A;  2JS0 A;  5M9O A;  2DTI A;  3REB B;  3DKM A;  1K73 U;  1W4S A;  1YBY A;  4OMP A;  1OPK A;  5LJ5 j;  5D6W A;  5D7U A;  1B34 A;  4BI8 B;  3DPQ A;  4AZ5 A;  3UWN A;  2LJ0 A;  3GP8 A;  1SSF A;  3BVT A;  2PTK A;  3V8K A;  3DX0 A;  1QMC A;  4PLL A;  2LVM A;  3V8L A;  3M0R A;  4XQ3 A;  4A4F A;  5GMK l;  2QFF A;  3LW5 E;  3QXE B;  5FRN A;  4BY6 B;  4PJM A;  4AZC A;  1UTI A;  4XTX A;  2RD1 A;  4BI3 A;  2DNU A;  2RO0 A;  1E1D A;  4IWO A;  2DRM A;  2CP5 A;  4AZ7 A;  2YSQ A;  1IRX A;  2VUB A;  4AFU C;  1BU1 A;  2RPN A;  1AWO A;  2DD5 A;  2KY9 A;  3DX1 A;  3FB9 A;  1ZBX A;  3CBO A;  2V1R A;  2NUP B;  4EZZ A;  2Y4X A;  3U23 A;  2I0N A;  2Z0N A;  4JJC A;  4M77 G;  1LVK A;  1EIF A;  1X2Q A;  3CBP A;  4YTL A;  4E3C A;  1M90 C;  3CXC A;  1GBR A;  2LRQ A;  4DOV A;  3QO3 A;  2DEU A;  4EZQ A;  4XK8 E;  4CRI A;  3I56 T;  3WXM B;  2NCZ A;  2FRY A;  3FJ5 A;  1SG5 A;  3G1J A;  4II1 A;  4PJN A;  4IKF A;  4C92 A;  1ZSG A;  3UA7 A;  3VS5 A;  2E5Q A;  3OYC A;  1KD1 R;  1VQO T;  4OB2 B;  3E19 A;  3OK8 A;  2J6K A;  2KRS A;  2HEQ A;  2ZAE A;  2QEX T;  1QVF S;  1UGP B;  3OYY A;  3D50 A;  3QYH B;  1VQL T;  1OV3 A;  4M7A C;  3RKW A;  3HAH A;  3UT1 A;  4PJO G;  5FIG A;  1BI1 A;  1HK9 A;  5FRO A;  1WHL A;  1E9V A;  2GNC A;  4JWI A;  2VB6 A;  4Z89 A;  3VS4 A;  2FL7 A;  3M54 A;  2ZZD A;  3CQT A;  1AWX A;  2F5T X;  1YWP A;  2FYV A;  4AZI A;  4JWC A;  3CCE T;  3UIT A;  1ARK A;  2KT1 A;  1DKY A;  2VVK A;  4EZS A;  3GOX A;  2RJD A;  2YIB A;  4X34 A;  1VQP T;  4C0F A;  6AT1 B;  1YWM A;  1Q7Y R;  3ZBD A;  1MUZ A;  3NPF A;  2DXC A;  2K3Y A;  1QVG P;  2ALW A;  1OA1 A;  4LE9 A;  4QVC A;  2OI3 A;  2OZN B;  4FSS A;  4N0A A;  3D4Z A;  4PFP A;  1OPL A;  4WCI A;  1T3L A;  2FPD A;  1Q86 R;  2ED1 A;  3CCQ T;  4C5G A;  1KC8 C;  2CDT A;  3O3N B;  3RUX A;  2C08 A;  1UFF A;  1LQ7 A;  3R6N A;  2KGT A;  5FRM A;  3CCM A;  4JZ4 A;  2YIV X;  2CSQ A;  4M77 F;  1U8R A;  4IUU A;  1K9M R;  2K2M A;  1CKB A;  3MEW A;  3EH2 A;  2YL8 A;  5GAN d;  5GJW B;  1RLP C;  3HHT B;  3JCM e;  1UHF A;  3BDL A;  3LGF A;  2D1X A;  3CMA A;  2Q12 A;  3INZ A;  1GNT A;  3SWN A;  2Y4Y A;  1P92 A;  1YN8 A;  3G4S A;  4A63 B;  3DPO A;  2DVJ A;  3VEB A;  2VGM A;  1GCQ A;  1UEB A;  1H64 1;  1K8A R;  3JB9 H;  5KBP A;  4JNF A;  4OMN A;  1ZSZ A;  1H92 A;  2QGG A;  2F18 A;  5KCH A;  3JCM Q;  4HCC A;  2GQI A;  3JB9 I;  5I11 A;  2M51 A;  5KYN A;  3BVU A;  5ECA A;  1UJY A;  4IUP A;  3M0S A;  2CZ0 B;  3JAM E;  1UG1 A;  1IHW A;  2HBP A;  4A54 A;  4PJO F;  4Z02 A;  2KI7 A;  2QEX Q;  3VKH A;  1BI2 A;  1VQL Q;  4HY9 A;  2JXB A;  3QSU A;  2PNI A;  1NYG A;  3EG3 A;  2O31 A;  3JB9 F;  4FZS A;  2WSC E;  2RQR A;  3CC4 T;  4EPC A;  2PY6 A;  2MI7 A;  1M1G A;  3EFO A;  4M77 D;  3QDF A;  3I5S A;  1FXX A;  3OS2 A;  1GL5 A;  2EJG A;  3DLL A;  1ZQ1 A;  4CC7 A;  4C92 E;  3JCM X;  1JB0 E;  1WA7 A;  1OI1 A;  4RCB A;  5J26 A;  3OB9 A;  4JLG A;  1YIJ A;  1EX4 A;  1KQ1 A;  3CCE Q;  1WHK A;  4OB1 B;  1X27 A;  2OTL T;  4KH0 B;  2BKD N;  1Q95 G;  4RTW A;  2OAW A;  1VQP Q;  1WZO A;  1WHG A;  4EDU A;  1BKB A;  1AHJ B;  4J6X A;  4RTV A;  4E7H A;  2P84 A;  5KYY B;  3MEU A;  1WDZ A;  1Z9Q A;  3L2R A;  2JMA A;  3CCQ Q;  4N4H A;  2M16 A;  1KQS S;  1O7D B;  1B3Q A;  2DBK A;  2LTO A;  2LX9 A;  1SUF A;  1RAA B;  4ESR A;  1QP3 A;  1WXT A;  2GA9 D;  4NL2 A;  1M2V B;  2JM9 A;  3MJX A;  4K11 A;  4BE1 A;  4GLK A;  1SPK A;  3VS1 A;  5CKE A;  2CP6 A;  2LC4 A;  4D6W A;  1M90 R;  3EG9 A;  3JB9 D;  2DKG A;  2YI9 A;  4GY5 A;  3M0P A;  3LMF A;  5A0D A;  3EHR A;  1KHC A;  2LJ1 A;  3CZN A;  3MCA B;  2A28 A;  2DL8 A;  3C12 A;  4PJO B;  3FD9 A;  2HSP A;  3PLT A;  2KYM A;  2FB7 A;  4HT8 A;  1SKU B;  2QKW A;  5E84 A;  1WJS A;  1NYF A;  2VAS A;  4ZGD B;  4LNP A;  2ZGW A;  5KE3 A;  4DEX A;  1TQV A;  2F2W A;  4J6W A;  1WFW A;  3I35 A;  4FM3 A;  1TXQ A;  4KUL A;  1BBZ A;  1YI2 T;  1I81 A;  4WF2 A;  3EJS A;  4KUD K;  1JXM A;  3I04 A;  2M0Y A;  2QDL A;  4M77 A;  2J6F A;  1PD1 A;  3QUI A;  2MCN A;  3V8J A;  3I5R A;  4M7A A;  1GNL A;  5I2M A;  3M58 A;  3CC4 Q;  3QPH A;  5LJ3 d;  1YJ9 T;  2KRO A;  2F1A A;  4X9D A;  2CH4 A;  2M9U A;  4A4E A;  2CZ7 B;  2FHD A;  2DRK A;  4LDX A;  1ZHI A;  2X4X A;  2AK5 A;  3PMT A;  1T0J A;  1SRM A;  1U1S A;  2L89 A;  4ORZ A;  3QJY A;  4J9B A;  4RTX A;  4FYV B;  2DEQ A;  4C0G A;  4LD9 K;  3PTA A;  4HR1 B;  4EZU A;  3S3M A;  2HQH A;  3GBQ A;  3OW2 S;  1K76 A;  2O01 E;  3BUI A;  4C92 G;  2E41 A;  2RM4 A;  2ND0 A;  1OU9 A;  3I56 A;  4C5I A;  3QG1 A;  2LP5 A;  1SF9 A;  1X6G A;  4A53 A;  5GAM d;  1W1F A;  3RV1 A;  2P4T A;  1VOM A;  3A8O B;  3L42 A;  2BE7 D;  2DD4 A;  1GFD A;  3J80 E;  4XTY A;  3OS0 A;  3M3W A;  5HK3 A;  2RH2 A;  4MML A;  3VV0 A;  3L2U A;  3MEV A;  5GAO l;  4M7D B;  1LOJ A;  3BUD A;  1U06 A;  2E6Z A;  3KBG A;  4C8Q B;  3BVW A;  3QNJ A;  1VQO A;  3JCM g;  1E6H A;  1VQL A;  4OMF B;  2WIN M;  2PMR A;  1TWB A;  1QWU A;  4C0D B;  2AHJ B;  5A2Q E;  3VS2 A;  5FU7 C;  2X9H A;  4M78 C;  1VQ6 A;  3HPW A;  3CCM T;  4R5G A;  1KC8 U;  1N6A A;  2D8J A;  1H3H A;  2VC8 A;  1I4K 1;  3H41 A;  3QWX X;  2L0A A;  1G3W A;  3X25 B;  1Q82 R;  1D0X A;  3OW2 A;  3L3O M;  2NYS A;  3CKD A;  3HRT A;  4E81 A;  1TU0 B;  3CMA T;  1MGQ A;  3T49 A;  2E1H A;  1YI2 Q;  3CCE A;  3G4S T;  2X3V A;  1M27 C;  3NHN A;  5GAN 8;  1SHG A;  5L8R E;  3ACO A;  2EX3 B;  1JJ2 S;  5KE2 A;  5EC7 A;  2K4Y A;  4EMK B;  2DFU A;  3QE6 A;  3BVX A;  2ZXQ A;  3LWH A;  4LUD A;  3D7S B;  1X6O A;  4EZX A;  2R5M A;  5FW9 A;  1HSQ A;  3FRN A;  3BY7 A;  2JJ9 A;  3RPM A;  1YJ9 Q;  3FC3 A;  2MI6 A;  3CCQ A;  5FLX E;  4BY6 C;  1IGQ A;  3EGU A;  1R0C B;  1Y96 B;  4G6Q A;  1UHC A;  1WIE A;  1Y07 A;  2KVQ G;  3UF4 A;  4DBF A;  3H6Z A;  4M78 F;  2EWN A;  3RR6 A;  4C92 F;  3CZS A;  2WSF E;  3G6E T;  1AZE A;  1Q7Y C;  4DA4 A;  5GAN e;  4L59 A;  2SEM A;  4RKU E;  4FZO A;  4NPH A;  3HTR A;  4M7A E;  1HYO A;  4AFQ C;  1KK7 A;  3ASK A;  2DZC A;  3MPU B;  1V29 B;  1W9M A;  4J9D A;  3T4A G;  1SRL A;  1JJ2 A;  4IUQ A;  2KRN A;  4QT7 A;  3MKD A;  1YIJ T;  5LJ3 f;  1Q86 C;  1C6V X;  1MJG A;  1I5O B;  3P8H A;  1B34 B;  3RER A;  1HXD A;  2J6O A;  2CZ1 B;  4DBH A;  3IQL A;  2C0T A;  2RJE A;  5HCK A;  2YRD A;  1K9M C;  2H8H A;  3DB4 A;  3EJQ A;  3BUP A;  1BCM A;  2K5F A;  1V76 A;  1NPP A;  3OQ5 A;  1ZA1 B;  1UPX A;  2EPD A;  3VS7 A;  2LT1 A;  4J9F A;  3RMQ A;  3E9G A;  2ZPB B;  4IUV A;  5CCA A;  3HKS A;  3QJ6 A;  1OEB A;  2DMO A;  3Q84 A;  1K8A C;  3CCM Q;  1M1K R;  3KUF A;  5IAY A;  5GAN 2;  3CC4 A;  3QKJ A;  3JCM W;  4ELZ C;  2L3R A;  8ATC B;  1JBM A;  3EJR A;  5GAM f;  2R5A A;  4M78 D;  4FU6 A;  1OU8 A;  2EYW A;  2BIV A;  2CT3 A;  3CMA Q;  5A0G A;  2RHU A;  3X26 B;  2FG0 A;  4L5G A;  1GBQ A;  3H0I A;  3G4S Q;  4XU3 A;  2XDD A;  1DKZ A;  2OTL A;  3F7W A;  1RLQ C;  3PGG A;  1UDL A;  5CKH A;  1NJI C;  2DL7 A;  4M0M A;  3VKI A;  3ABH A;  3C94 A;  1QWN A;  1RAE B;  3THK A;  1XNI A;  1QWE A;  1ZX6 A;  1QX1 A;  5GAO r;  2Z0O A;  3JCM f;  4FSX A;  3VUB A;  2XG8 D;  3OYM A;  4IM2 A;  1V1C A;  4EZN A;  2RA2 A;  1D1C A;  1YFN A;  1QKX A;  3CXC P;  2D6F A;  3G6E Q;  3C0C A;  3I55 T;  2P0P A;  2RMO A;  1JEG A;  2A08 A;  3BUB A;  2YLA A;  3DX3 A;  2K7A A;  3SYV A;  3OA6 A;  2DZ9 A;  4V2S A;  5LJ5 d;  1YIJ Q;  1M1F A;  2HSE B;  3HAI A;  2ND1 A;  2VWF A;  4HT9 A;  3QNI A;  1QCO A;  3TSZ A;  4M7A G;  3RBB B;  4LUE A;  1YI2 A;  1PRL C;  3TU4 K;  2G3R A;  3B52 X;  3LH5 A;  4Z88 A;  5LL6 S;  1D3B A;  3OHX M;  3BE3 A;  3M56 A;  2CYZ B;  2VGN A;  1M2O A;  4N4G A;  4BE2 A;  3JCM h;  4MDX A;  2PU9 B;  2X5C A;  3G7Z A;  4M78 A;  1KJW A;  1LNX A;  2HZY A;  3HL8 A;  1I1J A;  2YT6 A;  2PVO B;  3ERC C;  2RJC A;  1FMK A;  1YJ9 A;  5LJ3 e;  3X24 B;  4JL9 A;  3QWE A;  2AKK A;  2QQR A;  3CPF A;  4F17 A;  1Q81 R;  1W6X A;  4LDU A;  4EMH A;  1WX6 A;  3HFO A;  4MDW A;  4EZO A;  3QII A;  4EZR A;  1VYU A;  2N3K A;  1SEM A;  2QAZ A;  2XI9 A;  2XDP A;  5D6X A;  3SWN B;  1TG0 A;  1WJR A;  2LCC A;  2RQU A;  3RES A;  1H8K A;  2JTM A;  5HY6 A;  2C0O A;  1VQ6 T;  2XD0 A;  5FU6 B;  1NM7 A;  2AKL A;  3M57 A;  1RAI B;  1Y2O A;  2EVR A;  4J83 A;  4JRQ A;  2YLL A;  1ZSZ B;  1R33 A;  3CCV T;  1K0S A;  4AKV A;  3PFS A;  2PUK B;  2RQV A;  2RI5 A;  4BUG A;  3JB9 G;  4PNO A;  5C0M A;  3I01 A;  2ED0 A;  1SHF A;  4JRK A;  2JNS A;  2EGC A;  4UDY X;  2YL9 A;  2MF2 A;  2YUO A;  5IH2 A;  4RTY A;  3HAJ A;  3H0F A;  2AIR B;  3BW1 A;  2QTX A;  3E2U A;  3H0H A;  4H6I A;  1KD1 U;  5GAM e;  2RI3 A;  1NPR A;  2JNK A;  2M02 A;  1O7D C;  2HBW A;  5CKB A;  1M5Q 1;  2KBT A;  3BVV A;  4HCB A;  5CVI A;  4M75 C;  3OYL A;  3SDZ A;  2IVW A;  1I4T A;  4HA8 A;  3I55 Q;  3QYG B;  4J8O A;  1QVG S;  1TUC A;  2F69 A;  3H8Z A;  1FMV A;  4ATO A;  1QVF A;  2LQ8 A;  3EFO B;  1NE8 A;  2QQ9 A;  2YDL A;  4IIM A;  1TQU A;  3FIF A;  3T48 A;  2J06 A;  3G9G A;  4HCK A;  4M7A F;  4E7S A;  2BZ8 A;  4RTU A;  2RB6 A;  2YLB A;  2YL5 A;  2RT6 A;  3KFV A;  3LX7 A;  4FW1 A;  4CI0 C;  4R5J A;  2DXB A;  3MP1 A;  1M3B A;  4P5N A;  4KIK A;  2A7Y A;  2RQT A;  2EQJ A;  1B07 A;  2KT8 A;  4BD3 A;  4PKC C;  1Q7Y U;  1UGQ B;  3KDR A;  4BB7 A;  2KR3 A;  2JOY A;  4HXJ A;  2V26 A;  3I56 Q;  1I0C A;  2XID A;  4RG2 A;  2K3B A;  2QAS A;  3M0T A;  1RI9 A;  2EQM A;  3OY9 A;  2FZG B;  3D4Y A;  2ZPF B;  4CC2 A;  1Q86 U;  1K1Z A;  1R5E A;  2FPF A;  1KFZ A;  2YUQ A;  5LJ5 f;  1VQM A;  3I39 X;  3QDR B;  3OBW A;  3OBY A;  1Q82 C;  1N8R C;  2QYZ A;  4JRP A;  2EGE A;  1VQO Q;  1K9M U;  1NLO C;  1RUW A;  3WVE B;  3EG9 B;  2KQW A;  1PSE A;  2BZX A;  5A0L A;  2PVD B;  3LLL A;  1PG5 B;  1NJI R;  4HKE A;  1ZWW A;  2DLP A;  2FVU A;  4TVR A;  2COW A;  2QG9 B;  4R5L A;  1YCS B;  1VQ6 Q;  4QW2 A;  3G6E A;  3SOG A;  5GJV B;  4JJN K;  2E65 A;  2F1L A;  1WHH A;  1K0X A;  1WXU A;  3JCM V;  1K8A U;  3A1P A;  3CCV Q;  2CGH A;  4M7A D;  1VQ7 T;  5GAN 5;  4A4G A;  4M78 E;  1G83 A;  2RHY A;  3RDV A;  1BIB A;  4UC4 A;  1RAH B;  1YNZ A;  2EJF A;  4WTO B;  3BLB A;  4FCY A;  2ROL A;  4F16 A;  1ZUK A;  4QKU A;  4IWP A;  2FIC A;  2K2V A;  4DBR A;  4J7I A;  3EG0 A;  1U5S A;  2ATC B;  2R57 A;  2HD0 A;  4LXC A;  2DE0 X;  5C6S A;  3O8V A;  4M77 B;  4IUR A;  1ZYL A;  3T9N A;  2LX7 A;  3EGX A;  1W2B P;  1NJI U;  4HVW A;  2F2V A;  2A37 A;  4FYY B;  1E2U A;  4B9Q A;  5C5B A;  1PD0 A;  2O9V A;  4RTT A;  1S72 A;  3VRY A;  2FEI A;  4M7D C;  1WJQ A;  2VXF A;  4C8Q C;  4M75 D;  3JRZ A;  2MYS A;  5IHI A;  1AEY A;  1YIT T;  3B51 X;  4FZP A;  2GTJ A;  3N5B B;  1VIE A;  1UGS B;  4E7Z A;  3NTI A;  1IO6 A;  2QA4 T;  2HL5 C;  4PJL A;  1LPL A;  2GQV A;  2KDS A;  4XTW A;  3SEM A;  5I2S A;  2RAJ A;  3CC7 T;  1X03 A;  3A8G B;  4PJJ A;  2LM0 A;  1KSW A;  3VYG A;  3UDC A;  1JQQ A;  1EZZ B;  4JUV A;  3X28 B;  4GBQ A;  2E70 A;  4IM0 A;  1M4Z A;  2NLU A;  2EW3 A;  1C1A A;  4AT1 B;  1Y0M A;  2KXC A;  1FYN A;  2L2P A;  5CQX A;  2X3X D;  1M1K C;  1BIA A;  2EQI A;  4EMK C;  2EQK A;  4R55 A;  1ZLM A;  1BK2 A;  1QW1 A;  1WDX A;  1WYX A;  3ER9 B;  1PHT A;  1TTH B;  2BE9 B;  1CKA A;  3PT9 A;  5LJ3 g;  3HSB A;  3TSW A;  2EBP A;  2K6D A;  3NFC A;  4X9C A;  5AYF A;  1JO8 A;  2QQS A;  5D6Y A;  1KQS A;  5GAN f;  4ZGE B;  4XU0 A;  2EAY A;  4DQ2 A;  1F1B B;  5I22 A;  3CPW P;  2KEA A;  3EAE A;  1M90 U;  2MMP A;  3SB2 A;  2OW7 A;  4KH1 B;  3J81 E;  2I2L A;  3OSS C;  2DA9 A;  2DF6 A;  3I55 A;  4EMG A;  2C06 A;  2GCX A;  3E9F A;  1N27 A;  2B8A A;  2Y90 A;  3EGD A;  5FWC A;  1VQ7 Q;  4RUG A;  4VUB A;  3JCM P;  2JZ2 A;  4HCZ A;  2QI2 A;  4J9G A;  2W10 A;  4RMO A;  3DYT A;  3GI7 A;  3ER0 A;  2Z0V A;  2FO0 A;  5LJ5 e;  2GBQ A;  1OZ3 A;  2OTL Q;  3CAZ A;  2V8I A;  3QZ5 B;  4XTZ A;  5GAM g;  1I49 A;  4Z8A A;  2AT1 B;  2RNA A;  3F70 A;  2MK5 A;  4OP0 A;  3NTH A;  2FYK A;  1JRI A;  1WLP B;  2EGA A;  4BI4 A;  1N5Z A;  4M78 G;  5J39 A;  3CCU T;  4M75 A;  1GRI A;  5FLE X;  3WVD B;  2YXY A;  4NS5 A;  4MZT A;  1NG2 A;  2X3W D;  1TH7 A;  3LYI A;  5IHK A;  4OGE A;  5GAN h;  3ZL7 C;  3MET A;  1JXO A;  2KSS A;  1HWW A;  1YIT Q;  5EG2 A;  1BI3 A;  1QVP A;  3GF5 A;  3CCL T;  4OML A;  1Y7X A;  1Z9Z A;  2MWO A;  2KYB A;  1YJW A;  3BFM A;  4JJD A;  2O0I 1;  2EQU A;  2QA4 Q;  4KGX B;  2BTT A;  2E12 A;  1MNE A;  1ZUY A;  2JN0 A;  2RAI A;  2WYI A;  5KYW A;  2L5Q A;  2RJF A;  4DYL A;  4DEY A;  2X3X A;  3CD6 T;  2OX7 A;  3QBY A;  1OX8 A;  4ATM A;  1YJN A;  1UJ0 A;  5DLO A;  3URG A;  1IXD A;  3CCV A;  1N8R R;  1AOJ A;  1VQ5 A;  1XTD A;  2P0K A;  3O3O B;  2COZ A;  2O4X A;  4Y91 A;  1SU7 A;  1TUD A;  1Q81 C;  2DIL A;  2M0O A;  1RI0 A;  2HDA A;  4JS4 A;  3Q0K A;  4ELY C;  3OMG A;  4OMM A;  2EFL A;  3M0Q A;  4EZV A;  1HJD A;  2E4H A;  2RN8 A;  1JQK A;  4JRI A;  4IM3 A;  1TSF A;  1QKW A;  1N9S A;  2HQE A;  4EZP A;  1VQM T;  3MO8 A;  2E64 A;  3VS0 A;  3AT1 B;  1VQK T;  3Q1J A;  4J6Y A;  5KYX A;  2K3X A;  5FWB A;  2X51 A;  4PO2 A;  1Q82 U;  3PMI A;  2EJ9 A;  1N8R U;  4FW2 A;  2RAK A;  4FM4 B;  2GF7 A;  3GLX A;  5L23 A;  5HK0 A;  5KYU A;  3C7N A;  2FZC B;  1MMN A;  1GXI E;  2E3H A;  4B6M A;  3OMC A;  3TEE A;  4XTV A;  2XKO C;  2X4J A;  2P4R A;  2X3W A;  1QQJ A;  3GNF B;  3CCU Q;  4JN4 A;  3SD4 A;  5HKC A;  2QQA A;  2DIQ A;  4XAX B;  3PIP A;  4E7K A;  2CH4 W;  2DL4 A;  2DTH A;  1TOV A;  2Z8Y A;  2J05 A;  4F14 A;  4KUI A;  1X69 A;  1YCY A;  4NOY A;  4AG1 C;  3REA B;  2DL5 A;  2LQW A;  4HYB A;  2VKN A;  1FX7 A;  2DER A;  2YHT A;  5GAO p;  2ABL A;  2ECZ A;  3CCL Q;  4LDV A;  1Y71 A;  2LNV A;  2COY A;  1H3Z A;  1NBE B;  2LDM A;  3OYD A;  2EYQ A;  1X04 A;  4AZC B;  3BUQ A;  4KT0 E;  2E5K A;  2CRE A;  1X01 A;  4FT4 A;  3PE0 A;  1S72 T;  1NEB A;  4BE0 A;  4M75 E;  3M59 A;  2KXD A;  1X43 A;  2CUB A;  3EH1 A;  3OYE A;  5CKF A;  4KGZ B;  2OW6 A;  3QZ9 B;  2X4W A;  1OOT A;  4MMK A;  2ROT A;  2XHC A;  2RF0 A;  2RQW A;  4J5Y A;  4X1V A;  1VQ7 A;  1WXB A;  1TUG B;  2D9T A;  4EMK A;  2HL3 A;  2F7Q A;  1ZSZ C;  1W70 A;  1UE9 A;  1K73 R;  2O9S A;  2ZCF B;  4JS5 A;  2HAX A;  3MHX A;  1ABO A;  3QHS A;  2PUO B;  2V8J A;  3JCM c;  1YHQ A;  5LJ3 h;  3HRU A;  3QWY A;  1D3B B;  2DO3 A;  3PIO A;  4F7U A;  3CCR T;  2DJZ A;  2LJ3 A;  3FJP A;  1G3S A;  4DBQ A;  3CCJ A;  1TS9 A;  4M78 B;  3A5Z B;  3DPP A;  4C92 B;  1VQM Q;  1M1K U;  2MIO A;  1PCX A;  2LXY A;  1OAO A;  2HNI A;  3L1A A;  3LGL A;  1D09 B;  3SHW A;  1NZ9 A;  1AZG B;  1VQK Q;  1VQN A;  1NLP C;  2L3S A;  2NUT A;  1YIT A;  3FEO A;  4KGV B;  3CCS A;  1DJ7 B;  1SU6 A;  2RHI A;  4LD6 A;  1WGS A;  4IIO A;  5LJ5 g;  4IWQ A;  2O88 A;  2JT4 A;  2OTJ A;  3G71 A;  2QA4 A;  2YIA A;  4FT2 A;  1K9A A;  4JPB W;  3VUZ A;  3OYN A;  3JSC A;  3CC7 A;  2BZY A;  3CXC S;  3L2V A;  3M4G A;  5GAM h;  3VU3 C;  3GIB A;  4XTU A;  1UGR B;  4M4Z A;  2LQN A;  3GPL A;  1PC0 A;  2CP0 A;  5GAN 6;  4JLI A;  1M8V A;  2DXU A;  4XU1 A;  4JNE A;  4E47 A;  3T47 A;  4CC3 A;  2YUN A;  1FMW A;  2XK0 A;  1URU A;  3SFM A;  1R8O B;  3MP6 A;  2YRV A;  4RTZ A;  3V7C A;  1VA7 A;  2LCL A;  4ANJ A;  1M3C A;  2V8K A;  2JTF A;  2RK2 A;  4E7J A;  1X6B A;  3VS6 A;  2LCS A;  4D8K A;  3GNG A;  1C0M A;  1VUB A;  1AD5 A;  4Q5W A;  2LNH B;  1VQ8 T;  3M4Y A;  2CP3 A;  2L3P A;  1T3S A;  2OBL A;  1S72 Q;  3ZEH A;  5GAO m;  1MMA A;  1WQ7 A;  1IGU A;  3QA8 A;  3CME A;  2L3Q A;  1G3Y A;  2WYH A;  1XOV A;  2W0Z A;  3ZED A;  1D1A A;  4I1Q A;  2L8D A;  4ZTJ A;  4M7D E;  1YJW T;  4C8Q E;  1MHN A;  2X35 A;  1HXK A;  2LMJ A;  3S3O A;  2QTV A;  2H3J A;  3CVR A;  4PLI A;  4KIK B;  4UDX X;  2A0F B;  1YWO A;  2HKN A;  4M75 G;  1N9R A;  1RAC B;  5GAN 3;  1PRM C;  8AT1 B;  3NGP A;  4Y28 E;  1U00 A;  2DXT A;  4FIB A;  1RAD B;  4E7L A;  1YJN T;  1VQ4 A;  2JW4 A;  7AT1 B;  1QCN A;  2AZS A;  4BDZ A; 
#chains in the Genus database with same CATH homology
 2OBM A;  1X6G A;  3EG2 A;  2D0N A;  2DE0 X;  1W1F A;  3RV1 A;  1S1N A;  1GFD A;  2DJQ A;  2JM8 A;  3PVQ A;  4R5I A;  2EYY A;  2G6F X;  2SRC A;  1ZYL A;  2LX7 A;  4ZNX A;  4HVW A;  4E6R A;  1PKT A;  2F2V A;  2A37 A;  4IW0 A;  1E2U A;  4B9Q A;  1AWW A;  1BB9 A;  2DL3 A;  1M8M A;  1U06 A;  2YUP A;  2O9V A;  3EG1 A;  3QNJ A;  4D8J A;  4RTT A;  3VRY A;  2FEI A;  2D8H A;  1E6H A;  1SSH A;  2WIN M;  5IHI A;  1E7O A;  1AEY A;  4EZW A;  1QWF A;  1E6G A;  3B51 X;  2GTJ A;  3VS2 A;  1UEC A;  3O3M B;  5IHN A;  2V1Q A;  4R5G A;  2AZV A;  2QXL A;  2D8J A;  1H3H A;  1IO6 A;  3JV3 A;  1VYV A;  3H41 A;  4JWE A;  4JLC A;  3QWX X;  2FRW A;  2L0A A;  4R0K A;  3ULR B;  3SEM A;  3EHQ A;  4H6H A;  3ER8 C;  1HD3 A;  2LM0 A;  3L3O M;  3T46 A;  1KSW A;  2JS0 A;  4E81 A;  4LN2 A;  1JQQ A;  3REB B;  3T49 A;  4GBQ A;  2A36 A;  4IM0 A;  4KRT A;  2EW3 A;  4OMP A;  1M27 C;  1OPK A;  3NHN A;  2GAF D;  1SHG A;  2EX3 B;  1Y0M A;  5EC7 A;  3DPQ A;  2KXC A;  2LJ0 A;  1FYN A;  2L2P A;  2X3X D;  2EYX A;  2PTK A;  4LUD A;  2EQI A;  2J7I A;  5IXF A;  1ZLM A;  1WDX A;  4EZX A;  1BK2 A;  2DBM A;  3M0R A;  5FW9 A;  1WYX A;  3ER9 B;  1PHT A;  1HSQ A;  1CKA A;  1QLY A;  3TSW A;  2EBP A;  2K6D A;  2QFF A;  1JO8 A;  2KHO A;  1UTI A;  3I9Q A;  2EWF A;  2DNU A;  3EGU A;  1E1D A;  5I22 A;  4IWO A;  2KEA A;  2DRM A;  4G6Q A;  1Y57 A;  1UHC A;  1WIE A;  1SU8 A;  2YSQ A;  3UF4 A;  4AFU C;  1BU1 A;  1PNJ A;  2RPN A;  1AWO A;  2DA9 A;  2DF6 A;  4Y92 A;  2OJ2 A;  2V1R A;  1AZE A;  4EZZ A;  2SEM A;  5FWC A;  4NPH A;  4RUG A;  3U23 A;  3OWG A;  2I0N A;  1GCP A;  2LZ6 B;  3PVL A;  4AFQ C;  4JJC A;  4J9G A;  2W10 A;  1X2Q A;  1W9M A;  3GI7 A;  4J9D A;  1M3A A;  3T4A G;  2FO0 A;  4E3C A;  1SRL A;  2JMC A;  4AG2 C;  1KIK A;  2KRN A;  4QT7 A;  2GBQ A;  1GBR A;  1MJG A;  4EZQ A;  2EKH A;  2J6O A;  2EYZ A;  4Z8A A;  3KAV A;  2RNA A;  3IQL A;  2C0T A;  1WLP B;  2EGA A;  2JS2 A;  2NCZ A;  1N5Z A;  2FRY A;  3FJ5 A;  5HCK A;  1PWT A;  2H8H A;  1GRI A;  5FLE X;  2O2O A;  1NG2 A;  1ZSG A;  3UA7 A;  3VS5 A;  2X3W D;  5IHK A;  1UPX A;  2EPD A;  2FPE A;  3VS7 A;  4OMO A;  2CT4 A;  3ZL7 C;  2KRM A;  1JXO A;  4J9F A;  2J6K A;  2KRS A;  4J9E A;  2HEQ A;  1OEB A;  2DMO A;  1WI7 A;  4OML A;  1Z9Z A;  2KYB A;  1OV3 A;  1CSK A;  4JJD A;  5FIG A;  1VYT A;  2BTT A;  1E9V A;  2GNC A;  1ZUY A;  2EYW A;  2GGR A;  4JWI A;  2NUZ A;  4Z89 A;  2CT3 A;  3VS4 A;  4DEY A;  2FG0 A;  3CQT A;  4F01 A;  1GBQ A;  1AWX A;  1UGV A;  3H0I A;  1UJ0 A;  2NWM A;  1DKZ A;  3F7W A;  1YWP A;  1RLQ C;  1ARK A;  4JWC A;  1UDL A;  3UIT A;  2KT1 A;  1DKY A;  2VVK A;  4EZS A;  2DL7 A;  1EFN A;  1AOJ A;  2YIB A;  4M0M A;  3O3O B;  1JU5 C;  1MUZ A;  3NPF A;  1QCF A;  2LP5 A;  1SU7 A;  3THK A;  1GN9 A;  1TUD A;  2DIL A;  1OA1 A;  1QWE A;  4F00 A;  4LE9 A;  4GLM A;  1T0H A;  2OI3 A;  1ZX6 A;  3O5Z A;  4FSS A;  1OPL A;  2HDA A;  4WCI A;  1T3L A;  2FPD A;  4OMM A;  2ED1 A;  3M0Q A;  2CDT A;  3O3N B;  4EZV A;  1UFF A;  4IM2 A;  1V1C A;  3R6N A;  4EZN A;  1HJD A;  2KGT A;  1JQK A;  2RN8 A;  1LCK A;  4JZ4 A;  2YIV X;  4IM3 A;  2CSQ A;  1QKW A;  1QKX A;  4EZP A;  2YI8 A;  2K2M A;  3C0C A;  1AVZ C;  1CKB A;  3VS0 A;  5GJW B;  1RLP C;  1YP5 A;  2RMO A;  1JEG A;  2A08 A;  5FWB A;  1UHF A;  4PO2 A;  4EZY A;  2K7A A;  2D1X A;  3A98 A;  1GNT A;  1YN8 A;  5L23 A;  4A63 B;  3DPO A;  2DVJ A;  3VEB A;  3C7N A;  1GCQ A;  2ND1 A;  4JNF A;  4OMN A;  2VWF A;  2P4R A;  3RV0 A;  1H92 A;  3TSZ A;  4JN4 A;  2GQI A;  5I11 A;  2M51 A;  3RBB B;  4LUE A;  5ECA A;  2CH4 W;  2DL4 A;  1PRL C;  1UJY A;  3B52 X;  3D2F A;  3LH5 A;  3M0S A;  2Z8Y A;  1MV0 B;  2J05 A;  4Z88 A;  4F14 A;  5IXB A;  3OHX M;  1X69 A;  1UG1 A;  2DX1 A;  4AG1 C;  3REA B;  2IIM A;  2DL5 A;  3VKH A;  2LQW A;  4HYB A;  2VKN A;  1NEG A;  2F2X A;  2ABL A;  2ECZ A;  2X5C A;  4HY9 A;  1KJW A;  2JXB A;  2PNI A;  1GFC A;  1I1J A;  1NYG A;  2YT6 A;  2HCK A;  3EG3 A;  2O31 A;  3ERC C;  1FMK A;  2RQR A;  4R5K A;  4JL9 A;  2AKK A;  2CRE A;  2E5K A;  4F17 A;  1W6X A;  2PY6 A;  1WX6 A;  3PE0 A;  4EZO A;  4EZR A;  1NEB A;  1VYU A;  2N3K A;  2JTE A;  1SEM A;  4HVV A;  3UA6 A;  3I5S A;  2KXD A;  1GL5 A;  1X43 A;  4J9I A;  4CC7 A;  2CUB A;  1TG0 A;  1WA7 A;  2MOX A;  4HVU A;  2RQU A;  1OA0 A;  1H8K A;  1OOT A;  2K79 A;  2C0O A;  2ROT A;  3M0U A;  1NM7 A;  2AKL A;  2RF0 A;  2EVR A;  2RQW A;  1X27 A;  1DKX A;  3B53 X;  4X1V A;  4RTW A;  1WXB A;  2OAW A;  2B86 A;  1K0S A;  2RQV A;  3I01 A;  2ED0 A;  2KNB B;  1W70 A;  1MV3 A;  1SHF A;  1UE9 A;  2O9S A;  3TVT A;  2JNS A;  2EGC A;  4UDY X;  1ABO A;  2CUD A;  1ZUU A;  2YUO A;  4RTV A;  5IH2 A;  4JZ3 A;  2ENM A;  4RTY A;  1PKS A;  3H0F A;  1ZBJ A;  3H0H A;  3QWY A;  1Z9Q A;  4H6I A;  4OMQ A;  2JMA A;  2LJ3 A;  1J3T A;  2KE9 A;  1B3Q A;  2DBK A;  1SUF A;  1G2B A;  4ESR A;  2HBW A;  1WXT A;  2GA9 D;  2KBT A;  3DPP A;  2JM9 A;  4K11 A;  2MIO A;  1TUC A;  4J9H A;  1OAO A;  4JWD A;  1SPK A;  1I07 A;  2DYB A;  3VS1 A;  3SHW A;  1AZG B;  1NLP C;  2L3S A;  2YI9 A;  3M0P A;  3LMF A;  2YDL A;  4IIM A;  1SU6 A;  3EHR A;  3T48 A;  4IIO A;  2LJ1 A;  2J06 A;  4IWQ A;  4HCK A;  2O88 A;  2JT4 A;  3VRZ A;  2BZ8 A;  1UUE A;  2A28 A;  4RTU A;  2DL8 A;  3D2E A;  2YIA A;  2RT6 A;  3FD9 A;  3KFV A;  1K9A A;  4R5J A;  2HSP A;  4JPB W;  2BZY A;  1X2K A;  4D8D A;  2KYM A;  1M3B A;  4KIK A;  4HR1 A;  5E84 A;  1NYF A;  2DM1 A;  2LQN A;  3NMZ C;  4M4Z A;  2RQT A;  4LNP A;  1B07 A;  1K4U S;  2KT8 A;  4DEX A;  5TKY A;  2F2W A;  3KDR A;  4AFZ C;  4JNE A;  2ESW A;  3T47 A;  1WFW A;  3I35 A;  4FM3 A;  2KR3 A;  2YUN A;  4CC3 A;  1BBZ A;  4HXJ A;  1I0C A;  1A0N B;  2K3B A;  4J9C A;  3M0T A;  1RI9 A;  4RTZ A;  2K9G A;  1VA7 A;  1JXM A;  1M3C A;  3I04 A;  4CC2 A;  2M0Y A;  2QDL A;  4AFS C;  1X6B A;  2J6F A;  3KAW A;  2MCN A;  3I5R A;  1K1Z A;  3UAT A;  2LCS A;  3VS6 A;  2FPF A;  1KFZ A;  2YUQ A;  1GNL A;  2CSI A;  4D8K A;  3I39 X;  1AD5 A;  2PZ1 A;  1ABQ A;  2LNH B;  3VS3 A;  2L3P A;  1T3S A;  2EGE A;  2OBL A;  1NLO C;  1RUW A;  2KRO A;  2XMF A;  2BZX A;  2CH4 A;  1AWJ A;  4CC4 B;  3QA8 A;  2GTO A;  2L3Q A;  2DRK A;  2DLP A;  1XOV A;  3RNJ A;  3ZED A;  2W0Z A;  4R5L A;  1YCS B;  2AK5 A;  1T0J A;  1SRM A;  5GJV B;  1K0X A;  4ORZ A;  4J9B A;  2LMJ A;  3VEA A;  1WXU A;  4RTX A;  4JJB A;  4KIK B;  4UDX X;  4HR1 B;  4EZU A;  1U3O A;  3EG0 A;  1G83 A;  1YWO A;  2C0I A;  4EZT A;  3GBQ A;  1PRM C;  1K76 A;  3NGP A;  1YNZ A;  1U00 A;  2ROL A;  4F16 A;  1ZUK A;  1M30 A;  4IWP A;  2ND0 A;  2JW4 A;  4EIK A;  2AZS A;  1GCQ C;  1U5S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...