3A98A

Crystal structure of the complex of the interacting regions of dock2 and elmo1
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
168
structure length
157
Chain Sequence
GMAPWRKADKERHGVAIYNFQGSGAPQLSLQIGDVVRIQETCGDWYRGYLIKHKMLQGIFPKSFIHIKEVIPAEIPLAQEVTTTLWEWGSIWKQLYVASKKERFLQVQSMMYDLMEWRSQLLSGTLPKDELKELKQKVTSKIDYGNKILELDLIVRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of functional complex formation between DOCK2 and ELMO1 for Rac activation in lymphocyte chemotaxis
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Dedicator of cytokinesis protein 2
total genus 45
structure length 157
sequence length 168
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-10-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.350 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3a98A02
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3a98A01
1AZEA 1NYFA 5I22A 2KROA 2EKHA 2HEQA 2KR3A 1LCKA 2JTEA 2K3BA 3EHRA 2YUNA 1PHTA 4RTVA 1ZUKA 1I07A 2CDTA 2AZSA 4HVVA 2O2OA 2LQNA 2DM1A 3FJ5A 3GBQA 2AKKA 1Z9QA 2DVJA 1UHCA 3NMZC 2DNUA 4A63B 2JW4A 4LE9A 2ABLA 1N5ZA 1NEBA 5GJVB 3EG2A 1JXOA 4OMNA 3LH5A 2EW3A 1V1CA 1Z9ZA 3VS4A 2C0TA 1M30A 1GBRA 2E5KA 3U23A 1E6GA 2D0NA 2K6DA 3KFVA 2C0IA 2SEMA 1X43A 2YSQA 1X27A 3M0UA 2DBMA 3M0SA 1HD3A 1S1NA 1GL5A 2RQVA 2W10A 1PRMC 3I9QA 1AD5A 3RNJA 3R6NA 4EIKA 3EHQA 2K79A 2FPFA 1WXBA 2MOXA 1KSWA 1CSKA 1RLQC 1X6BA 3VS3A 3H0HA 4ORZA 2BTTA 3THKA 4AFSC 2LJ3A 2EVRA 2KYMA 4FSSA 1X2QA 2FO0A 1NG2A 1ARKA 1H3HA 1K0XA 1AWXA 1QWFA 1ABOA 1PNJA 1M8MA 1YNZA 4IIMA 2KEAA 5ECAA 1UHFA 1XOVA 1AWWA 4RTUA 2HBWA 1JQQA 1NYGA 1W6XA 1T0HA 4E6RA 2J06A 1UJYA 1ABQA 4GLMA 3PVLA 1TG0A 2HDAA 1JU5C 2CSQA 4DEYA 3TSZA 2J6OA 2BZYA 4JZ4A 2X3XD 2CSIA 1GFDA 2F2VA 1VA7A 2L2PA 3VS5A 3VS6A 4JJBA 4D8KA 3VRYA 1G83A 4GBQA 1WYXA 2DF6A 2RMOA 4J9HA 2V1QA 2XMFA 2DILA 2EYZA 4KRTA 2KT8A 4K11A 1TUCA 2KXDA 2FRYA 2RN8A 2JMAA 1IO6A 2OI3A 2DBKA 3TVTA 4ZNXA 2DRKA 2DA9A 2MIOA 2QDLA 4Y92A 2ROLA 1UFFA 1K0SA 2CH4A 2V1RA 1VYTA 1WFWA 2K2MA 2HSPA 1RLPC 1X2KA 2NUZA 2W0ZA 3NGPA 1QCFA 2GQIA 2PTKA 2EBPA 1UE9A 2JXBA 2RPNA 4AFZC 2LZ6B 4OMQA 4Z88A 2YUQA 1TUDA 1YCSB 1UTIA 1ZBJA 1SEMA 1PKSA 1ZLMA 2EGEA 2CT3A 1OV3A 2G6FX 1EFNA 2GBQA 3VS7A 1YWPA 1GCPA 4J9FA 2M0YA 4RTTA 2A36A 2FPEA 2O88A 2CUBA 1I0CA 3M0TA 4RUGA 2LP5A 3EG1A 1OEBA 1VYUA 3VS2A 3REBB 3EG3A 1NM7A 1Y57A 4RTZA 2K7AA 2RQTA 1H92A 2FRWA 4RTXA 5I11A 1CKAA 1AOJA 1WX6A 3EG0A 2GTJA 1Y0MA 2OAWA 4CC4B 2AK5A 2ENMA 1ZSGA 3EGUA 2L3PA 2PNIA 2NWMA 1PKTA 5IXFA 2CREA 4RTYA 2A28A 1MV0B 5IHNA 2SRCA 2KNBB 1GCQA 1JXMA 1AVZC 1NLOC 2KE9A 4CC2A 2CUDA 2F2XA 2AZVA 1ZUYA 3CQTA 3SHWA 4F14A 5L23A 2J6KA 1PRLC 2P4RA 3VS0A 2A37A 2GNCA 2OJ2A 2RNAA 1M3CA 4HXJA 4HCKA 1BU1A 1OPLA 2KRMA 2AKLA 1WA7A 4J9IA 2FEIA 2D1XA 4QT7A 2DX1A 2EPDA 3I5RA 4LNPA 2LNHB 4J9GA 4RTWA 1QKWA 1A0NB 2VVKA 2X3WD 2ED0A 1JEGA 2YUOA 1WXTA 2C0OA 1ZUUA 1T0JA 1RUWA 3NHNA 2GGRA 3I35A 1M27C 1BB9A 4AFQC 2RQRA 4ESRA 4CC7A 3VS1A 4AG1C 2CT4A 2YT6A 1RI9A 2VKNA 3IQLA 4M4ZA 2MCNA 2FPDA 2FG0A 2BZ8A 1E6HA 1UG1A 3QWYA 2J7IA 2KYBA 1M3BA 2RQWA 1QLYA 1WXUA 1CKBA 1T3LA 4JZ3A 2VWFA 4D8DA 2DL8A 2DL4A 5FWBA 2CH4W 5IHKA 1UDLA 2EYWA 1UJ0A 4Z8AA 3UF4A 2A08A 3ULRB 1YN8A 4X1VA 2KRNA 2O31A 1GFCA 4AG2C 4JPBW 2YUPA 1ZX6A 2L3QA 2KT1A 2J05A 4J9DA 4JJDA 3VRZA 1AEYA 2RQUA 5IH2A 2DL7A 2BZXA 2KBTA 1YP5A 2ECZA 5IXBA 3M0QA 3PE0A 2EQIA 1QKXA 1FYNA 2LJ1A 1UUEA 4IIOA 1K9AA 2I0NA 1U5SA 2EGAA 3C0CA 1K76A 1M3AA 3RBBB 4OMLA 2RF0A 2DRMA 2LCSA 2F2WA 2L0AA 4JJCA 2YDLA 3M0RA 4J9EA 2KXCA 2H8HA 1VYVA 2DL3A 2JT4A 3M0PA 1X69A 3JV3A 2D8JA 5FWCA 2DMOA 5IHIA 2L3SA 1G2BA 4OMPA 3I5SA 1SPKA 1SRMA 1W1FA 1MUZA 2O9SA 3REAB 1AWJA 4LUEA 3PVQA 2LQWA 1MV3A 1WI7A 2JM9A 2K9GA 3H41A 1BBZA 1KFZA 3O5ZA 4HVWA 5HCKA 4F16A 1GRIA 1JO8A 1SHGA 5GJWB 1NLPC 2EGCA 1FMKA 4OMMA 1T3SA 1UECA 4CC3A 2GTOA 2DYBA 2ESWA 1GCQC 1WLPB 2DLPA 3SEMA 2O9VA 1UGVA 2JS0A 1H8KA 1SRLA 2D8HA 2DE0X 2M51A 1I1JA 1NEGA 1X6GA 1HJDA 1SHFA 4J9CA 2LX7A 2EYYA 1PWTA 1HSQA 2EYXA 1U06A 2LJ0A 5EC7A 1W70A 2DJQA 2JMCA 3UA6A 3UA7A 3UATA 2PZ1A 3A98A 3ZL7C 4WCIA 4HVUA 2IIMA 3TSWA 4Z89A 1OOTA 1B07A 4LN2A 1OPKA 3NPFA 2ED1A 2J6FA 5FW9A 4R0KA 3QWXX 4F17A 1K4US 1WIEA 4AFUC 2LMJA 1YWOA 2KGTA 1B3QA 4OMOA 1K1ZA 2JS2A 2B86A 1AZGB 2DL5A 2ROTA 2JM8A 4J9BA 1E7OA 4LUDA 1U3OA 1WDXA 4DEXA 1QWEA 3H0FA 2KRSA 3H0IA 1KJWA 1AWOA 1SSHA 1J3TA 1GBQA 2HCKA 1KIKA 1BK2A
chains in the Genus database with same CATH superfamily
1AZEA 1W9MA 3OYLA 5I22A 2F5TX 5KBPA 2KROA 3G4SA 2KR3A 1LCKA 1NJIU 3OYDA 4FM4B 1VQMT 3V8KA 2RHYA 4EZNA 1IHVA 4IWOA 2MAMA 4OGCA 3EH1A 2GQVA 2AZSA 4DBHA 2K2VA 3L2UA 1NE8A 3CPFA 2LNVA 3FJ5A 4Z02A 3EJQA 1O75A 4AMCA 1D0XA 2AKKA 1Z9QA 2DVJA 4JS5A 5GAN2 1FX7A 3CZSA 2LT4A 3OYAA 2JW4A 3GI7A 3EG2A 1MJGA 1JXOA 3FLGA 4IM3A 3HRSA 3SOGA 2HD0A 3LH5A 2E5QA 3VS4A 2DD5A 1V76A 2E4HA 4M7AB 5GAMe 2K6DA 4LDUA 2SEMA 3FEOA 4BUGA 2PUOB 1S72A 1NJIC 4M7DA 3ZBDA 2OTLT 2Z0NA 1M1KC 2PVDB 5EG2A 3WXMB 4QVZA 4PJOE 2FPFA 5HK3A 4BDZA 4OVAA 1N8RC 1VQ7T 3VUBA 4AFSC 2EVRA 1EX4A 2Z8YA 3OSVA 5LL6S 1X2QA 2QG9B 1BCMA 2X4YA 1K0XA 4FYXB 3EFOB 1YNZA 2AIRB 4J6WA 3EFSA 2KEAA 3RIRA 3PTAA 4XTZA 5HK0A 1AWWA 3OYFA 2GF4A 5DY9A 3CD6Q 1YJNA 4D8JA 3BVTA 1NYGA 4E7SA 3H9NA 5LJ5h 3PVLA 5D7UA 4KBMB 4GY5A 4MZMA 4M78F 4BD3A 5FLXE 3L2WA 2BZYA 3KXTA 4JZ4A 1QVFS 2HSEB 2X3XD 4E3CA 2RA2A 1VA7A 2E65A 3EG9A 5KYXA 2YLAA 1G83A 3J81E 1ACMB 2V1QA 2XMFA 2DILA 4A4FA 2NUTB 2KT8A 2F7QA 2RN8A 3DX0A 3M53A 5GANg 2OI3A 3OMCA 1VQPA 1OYXA 4AZGA 3A5ZB 2V8IA 4F7UA 2DRKA 2MIOA 3D52A 4M7DE 4M75E 2EQKA 2ROLA 4X34A 3BFMA 4G6QA 1K0SA 1KHCA 2V1RA 3VKIA 2K2MA 2HSPA 1JJ2A 1TQTA 3CCMQ 3HTRA 2GQIA 4JJNK 5CKBA 2BE9B 2F7PA 4ZGJB 1TUDA 1YCSB 3G6EQ 1UTIA 2JJ9A 4JWCA 1M90R 3MKDA 4FU6A 4PJOC 2F1BA 2CT3A 3BUPA 2G6FX 2O0I1 5CIUA 2M0YA 2B8AA 3C95A 2O88A 2CUBA 3CCJT 3M0TA 2YHTA 2EFIA 4RUGA 4NL3A 2K3YA 1O9SA 1VYUA 1YCYA 2BIVA 3REBB 2KHOA 2JTFA 2A3LA 3QBYA 4B9XA 1NM7A 4OB2B 5GMKi 3CC4A 3SD4A 3E9GA 2RQTA 3G6ET 2FRWA 4MDXA 1QVGA 4C0ZA 1WX6A 3JB9F 4CC4B 1I4TA 2QEXQ 1ZSGA 3JRZA 3BUBA 3P8HA 2YRDA 5I21A 3Q0KA 2NWMA 1PKTA 2MK5A 2D0QB 5GAN7 3OYBA 2GAFD 2M02A 1GCQA 1VQ6Q 1AVZC 2X3WA 1NLOC 8AT1B 2QA4T 1YITA 2NCZA 5GANh 5GANd 5I2SA 2F7OA 4F14A 4M77G 3VS0A 5HKCA 3DDFA 1WNLA 2OJ2A 4C8QC 2DERA 2RNAA 3BW1A 4XQ3A 4HCKA 4FSXA 1OPLA 4OP0A 4J9IA 3T48A 1KK7A 3HHTB 1RAAB 4QT7A 1AHJB 2DX1A 3I5RA 4JNEA 4NSWA 1Q81C 3T9NA 1I4DA 1M2VA 4J9GA 2RAIA 4RTWA 1QKWA 1VQ6T 4PL6A 1A0NB 2JN0A 2CP5A 2EWFA 4C0DB 1JEGA 1VQ4Q 3O3NB 3LGFA 3X28B 1XQHA 2DETA 1S72T 2YUOA 3CC2T 4RCCA 2C0OA 2JTMA 1UGPB 1ZQ1A 3Q84A 2JOYA 2E64A 2CYZB 3MEAA 4JL9A 3M58A 2XKOC 4CC7A 1YJWT 1TQVA 3S3MA 2YT6A 3C4SA 3PNWC 2GFUA 3QUIA 1UB4A 3EGXA 2ZGWA 1TOVA 1YFNA 4EZQA 2J7IA 2KYBA 1M3BA 3ERCC 4M78B 3HKSA 1CKBA 1Q86U 3SYVA 4PJNA 4FCYA 1DKXA 2ZPBB 3UT1A 3EGDA 1C0MA 2QEXA 4C8QD 1UDLA 4HR1B 3GNGA 4Z8AA 4F7UE 4JLIA 2A08A 1UGRB 4X1VA 2KRNA 2O31A 4AG2C 3CPWP 3FC3A 1HYOA 1RAHB 2M1HA 2YLLA 2DIQA 3C12A 2X51A 2KT1A 4M7DB 2XK0A 1PG5B 4J9DA 4JJDA 3VRZA 2LQKA 5GAOm 3M5AA 1AEYA 3OS2A 5IH2A 2KMTA 3Q1JA 2BZXA 5FLEX 4ZN3A 3PIOA 3L1AA 1WGSA 3PE0A 1OX9A 2LJ1A 2ZCFB 2QK0A 1TQWA 2EGAA 4FW2A 8ATCB 3C0CA 3A8LB 1M3AA 4M78G 1VQNA 4OMLA 2CP3A 2OBMA 2QGGA 3M0RA 2O4XB 2JT4A 3CCMA 1U1SA 1OULA 1X69A 3QKJA 3JV3A 4M78C 1K73C 2D8JA 2F1LA 5FWCA 2ZPIB 2VGMA 2PU9B 3SFMA 2K4YA 5LJ5d 4M77F 3OW2S 2QQAA 3JCMW 1G5VA 4RCBA 1TU0B 1QVFP 1MUZA 2CZ7B 2EQJA 1OA0A 3CCQQ 3CCQT 3C94A 3CCLT 1R0BG 2FVUA 2HNIA 1KFZA 1QP2A 3EGDB 3CC7T 3SB2A 5HCKA 2LT1A 1JO8A 2WACA 3L2RA 3E9FA 3URGA 2GFAA 3CPWS 4DOVA 5IN1A 3AHUA 2ESWA 4M0MA 3R6OA 3D2FA 2DLPA 1Q81U 4JN4A 1WHHA 1OZ2A 2P0PA 2ALWA 1BI3A 2VYTA 2DE0X 3A8HB 2M51A 4HCZA 3CCEQ 1SHFA 1R77A 1V29B 1HK9A 1XTDA 3RKYA 5KYYA 3JCMJ 2R5MA 2OTLA 5M9OA 2XG8D 2JMCA 3DPPA 4AZCB 3EJUA 5GAN4 3UATA 3VKHA 2PZ1A 4JRIA 2H3EB 1Y7XA 3D7SB 1IREB 1MMDA 1B34B 1WHMA 3TSWA 4Z89A 1QQJA 2RD1A 2JZ2A 3OYGA 4C5GA 2PVOB 2YL9A 4E7LA 1WIEA 3BUIA 2KGTA 4DBRA 3G71Q 1G3TA 3CVRA 1TTHB 1VQ5T 2F5KA 1DJ7B 1AZGB 4TVRA 1R33A 1K9MR 1E7OA 4LUDA 1QW1A 2RJDA 1QWEA 2P0QA 3V7SA 3QPHA 1AWOA 2RAJA 4JUVA 2CP6A 1J3TA 1GBQA 4V2SA 2HCKA 3CMAA 5LJ3f 3GLXA 1NYFA 3LMFA 3JCMQ 3MJXA 2YXYA 3META 2HEQA 2DIGA 1MMNA 3DX2A 3T4AG 2K3BA 2YUNA 1PHTA 4J7IA 3JB9I 4X9CA 2EWNA 3GPLA 4R5IA 3A8MB 4D6WA 2R57A 3PLTA 3LWIA 4EMKA 1U00A 3JCMV 2RAKA 4N4HA 1KD1C 3P8DA 2MWPA 4Q5WA 1UHCA 3NMZC 1WHGA 2WYIA 5D6XA 2DNUA 3V7CA 1W2BA 1R34A 1LPLA 1N5ZA 1NEBA 1LOJA 4VUBA 3ACOA 2DEUA 3ZFJA 2MI6A 2YI9A 1Z9ZA 1PD0A 2C0TA 1GBRA 5D6YA 2E5KA 3CCVA 1N9SA 3U23A 4H8SA 1E6GA 1NZ9A 4M7DF 4QQDA 1X43A 2QKWA 2YSQA 1JQKA 3RDVA 1WHJA 3CCMT 3LYIA 1VQ9T 2H3JA 2RQVA 2W10A 2MF2A 1PD1A 1Q86C 2CGHA 2CZ0B 2DEQA 3RNJA 1IHWA 1TWBA 4EIKA 4M77E 1M1FA 5CVIA 1AT1B 2DAQA 3EHQA 3CCVT 3D50A 3KAWA 3HSBA 1WXBA 3OYJA 1CSKA 1RLQC 2MMPA 3QHSA 3H0HA 4NS5A 2VC8A 3THKA 3FRNA 3PMIA 1X01A 5CCAA 3LH0A 4JRPA 2KVQG 4P5NA 1M4ZA 1QWUA 1P92A 2WSFE 2XU8A 1H3HA 4XU3A 1PNJA 2Z0OA 1U1TA 3CCLQ 3J80E 4MMLA 1YIJQ 5GAOn 2M9UA 3OYKA 2KK4A 1YWMA 1JQQA 1T0HA 5KYUA 4GLMA 4C5IA 1TG0A 2HQXA 5GAN6 1D3BA 2HDAA 2DD4A 3X25B 3VYGA 3EFOA 2J6OA 2YI8A 1VQOA 3CMAT 5HY6A 1M1KU 3CMAQ 1GFDA 3JCMe 4EZTA 2F2VA 2X35A 3VS6A 2HZYA 3ER9B 2L5QA 3V7RA 3F7WA 2RI2A 1OU9A 2XHCA 1VQLA 1X03A 2F69A 2EYZA 4KRTA 4B9WA 2ZPEB 1PSFA 1TUCA 2KXDA 2FZGB 5L8RE 4WF2A 5KYUB 2X5CA 5FU6B 4XTUA 7AT1B 4PLIA 3V8JA 3TVTA 1Q81R 3QDFA 1VUBA 2EAYA 4Y92A 3DX3A 4M75G 3MP8A 3QZ5B 5GAMj 2PTKA 1IGUA 4EMHA 1QVGP 4MDWA 2JXBA 4F00A 2LZ6B 4Z88A 5CKDA 5KH6A 1NJIR 1M9SA 4Y91A 2DXTA 3VUZA 3OYIA 2OTLQ 5CR2A 1PKSA 1ZLMA 3M56A 5J3BA 1YITT 1GCPA 4QVCA 3QJ6A 4RTTA 2EX3B 2A36A 3BVWA 1TH7A 1Y07A 1VQ7Q 2EYQA 2YRCA 3RKXA 3CMEA 3BVUA 3VEBA 1FMVA 2LP5A 4QVDA 2QFFA 2DKGA 4PJOB 3PMTA 2YIVX 2E6ZA 4JRQA 2OZNB 1H92A 5CQXA 4RTXA 1AOJA 1W4SA 2GTJA 2COZA 1KC8U 2AK5A 5CKHA 3ZEDA 3OSSC 1YJWQ 1KQSA 1YI2Q 3I01A 4A4EA 5IXFA 3UITA 1QP3A 1K73R 2A28A 3TQ7P 2SRCA 2EQMA 4M77D 5LJ5e 4BE2A 2X3VA 1YHQQ 2DJZA 4DYLA 1GN9A 2KE9A 5IAYA 1YJ9T 3CCSA 2F2XA 4PJOG 4HT8A 2OTJQ 1WDZA 1R5EA 3CQTA 3E19A 4QQ6A 1D1AA 1Y96B 3I56A 4ATMA 1VQNT 1VQNQ 3I55Q 2HL5C 2IVWA 2KRMA 3GP8A 3QNJA 2FEIA 5LJ3j 2D1XA 4F7UG 2EPDA 1JB0E 1VIFA 2YKTA 1B7TA 3QO3A 3HL8A 3TREA 2DTIA 1VQPT 5C5BA 2YLCA 4M75A 4BI4A 3EH2A 5GAOr 3MEUA 1ZUUA 3TU4K 2LM0A 3RV1A 4E47A 3MP6A 3I35A 1ZBXA 1BB9A 4GLKA 2RQRA 3CCSQ 2QEXT 1YJ9A 3LW5E 1YHQA 4M4ZA 2MCNA 1UG1A 4X9DA 2PUKB 1IZ6A 1I8FA 2CZ1B 2YL5A 1WXUA 1VQ8T 4JZ3A 3JCMX 4XK8E 4R5LA 5FWBA 1TQSA 1YI2A 1HWWA 1YJWA 2CH4W 1BI0A 3UF4A 3CZNA 1ZSZC 2DFUA 1TSFA 3HAHA 1WHKA 3DB3A 4JPBW 3CXCS 4KGXB 2X4WA 2YUPA 4B9QA 2DXCA 4M7DG 2MPXC 3DLMA 2NUPB 2RB6A 2J05A 3LWHA 2RQUA 2K5FA 3SDZA 1OQKA 2DL7A 2KBTA 3CMET 2MI7A 3BUDA 1YP5A 2ECZA 3WVEB 1VQ7A 2P0KA 3M0QA 1N6AA 2EQIA 2PVGB 4JDSA 1OI1A 2I0NA 2QXLA 2K57A 3UPUA 3CC2Q 3X24B 1FMWA 2RF0A 1URUA 2F2WA 1GNLA 2VB6A 4EZPA 2D9TA 5LJ5j 1UPXA 3DX1A 4M77A 2I2LA 4EZRA 3MEVA 5I2MA 3M0PA 1YITQ 3M9QA 3ME9A 3QXEB 4ATOA 4FZPA 1G2BA 2D4CA 2RJFA 2VV5A 1SPKA 4J5YA 2LC4A 2ATCB 3X26B 1W1FA 4XU2A 2LCCA 1TQUA 5CKFA 2IG0A 5GMKh 1AWJA 2BE7D 2LQ8A 2RHXA 3VV0A 3DPOA 1WI7A 3G1JA 3H41A 3V8LA 3O5ZA 4HVWA 1DKZA 1RAFB 4F16A 3L2ZA 1SHGA 5GJWB 1VQLQ 2RJEA 3A1PA 3CD6T 2EGCA 4OMMA 4A4GA 1T3SA 1H641 1UECA 9ATCB 1K8AR 1G3WA 4C8QF 2GTOA 3NTKA 2RK1A 1WLPB 3GIBA 1PS3A 1VQOQ 3BDLA 2WINM 4J8OA 3SEMA 3ABHA 5TKYA 4F01A 3T47A 2QTXA 1OX8A 4ZGDB 1M90C 4BDYA 1HSQA 4LDXA 5GAN8 2D6FA 5DM7R 2LJ0A 5EC7A 2DJQA 3UA6A 3EAEA 4IUTA 3UA7A 5GAN5 3WVDB 1SSFA 4M7DC 4E7IA 3ZL7C 2OTJT 4KGVB 2IIMA 2OW6A 3FIFA 1OOTA 4LN2A 3ER8C 1OPKA 2O01E 1IXDA 4XTVA 4BB7A 4R0KA 3QWXX 3CXCA 2YLBA 3H6ZA 4Y28E 1PM3A 2QYZA 2L89A 5GMKl 4MZTA 4M7AC 1B3QA 1R8OB 4DQ2A 5FRNA 2B86A 4PJMA 4LDWA 4UDXX 3RERA 3PT9A 5DLQE 3OYNA 3I56T 4ZTFA 1D09B 1U3OA 1K73U 3RV0A 3EG9B 4M7AG 1Q82C 1KJWA 4PJOF 5CO7A 4FYWB 1MNDA 4AVMA 4MZPA 4M7DD 4BNEA 3CCUQ 1RL2A 4PJJA 1XNIA 3MPUB 2X4XA 3CCVQ 4C8QA 2KSSA 5GANj 4HR1A 2IPOB 2JTEA 4M75B 2CP0A 3EHRA 4RTVA 2LX9A 2GF7A 1K8AC 1YJNQ 1ZUKA 1Q7YR 1I07A 3OW2P 1HTYA 2O2OA 2M0OA 1MMGA 2LQNA 2OAUA 2RI3A 3GBQA 3L2VA 1MMAA 4BY6B 4LE9A 4OF1A 2ABLA 3D2EA 2XIDA 5C0MA 4OMNA 4AZ6A 2EW3A 1RACB 4H6HA 2YWWA 4JRKA 1M30A 3S6WA 4AZHA 5KE2A 5GAOq 1I81A 2D0NA 3KDRA 1VQKQ 2LRQA 1I4K1 1BYMA 3M0UA 2DBMA 3M0SA 2ZPGB 4PJOD 1S1NA 5GMKj 1S72Q 2F7RA 1KHIA 2JUFA 1M2VB 1AD5A 3JCMh 4O5VA 4BE1A 3R6NA 2DYIA 2WSCE 4M75F 3M3WA 1VQKA 3MCAB 3P8BB 1UEBA 2DK3A 2ELBA 2MOXA 3DKMA 3VS3A 1X6BA 2CS7A 2BTTA 3KAVA 3QSUA 3L3PA 2KYMA 1QCNA 2K5IA 4FSSA 4PFZA 1N8RU 1M1GA 1ARKA 3HRUA 1WJQA 1AWXA 4EZOA 4EZVA 1M8MA 4E7KA 1I5LA 3OY9A 4M75C 4RG2A 1I5OB 3BE3A 2GCXA 4EPCA 1W6XA 1VQMA 3DDGA 3JCMb 2NUPA 4BE0A 2YL8A 1UJYA 4R5KA 5CKEA 1ABQA 1BI1A 4WTOB 2QDYB 4J6YA 3CCEA 3G4SQ 5KYYB 1JU5C 4IKFA 5FU6C 3TSZA 4HKEA 2P4TA 3SWNC 3OMGA 2L2PA 3VS5A 4JJBA 3CCUA 4D8KA 3VRYA 1WYXA 3DX4A 1JJ2S 3ASKA 3SWNA 5LJ3g 5A0LA 1OU8A 1M2OA 2E1HA 3QWEA 3OK8A 3I39X 5GAOl 4K11A 3I55T 2FRYA 3BUQA 3CCQA 3RUXA 2HBPA 2DBKA 3RMSA 3QNIA 4ZNXA 2DZCA 4BI3A 2DA9A 2XI9A 3KUFA 2QDLA 2PQWA 4ANJA 3B53X 3A8OB 3OYHA 5KYNA 2CH4A 3BLBA 3JB9G 5FIGA 3FDRA 1QCFA 2EBPA 1JJ2P 1VQ9A 2JVVA 4AFZC 4F7UB 4OMQA 4BY6C 3NTIA 2HKNA 1PCXA 1QWNA 1ZBJA 2L8DA 5GANe 1SEMA 3LVTA 2A7YA 4A54A 4AZIA 3VS7A 2GBQA 1YWPA 2KI7A 4J9FA 4OB1B 3QA8A 3AT1B 1SU7A 2EKOA 2NUTA 2RI5A 4JWIA 1OAOA 1MHNA 4M7AF 1X75C 2NYSA 3CC7Q 1Y57A 4E7ZA 4A4HA 5A0DA 4IUPA 1RAGB 3DLLA 2E70A 1F1BB 3OS1A 1CKAA 4NL2A 1Y0MA 3OYMA 2MWOA 3M57A 2LDMA 3EGUA 2FYVA 3I04A 3OYCA 2CP7A 2PNIA 3MP1A 2VXFA 4RTYA 2ZPHB 2Q13A 1MV0B 2ZZDA 2XDBA 3TEEA 4DA4A 2ND0A 2QI2A 1SG5A 2COYA 2QAZA 4JLCA 4CC2A 3O3MB 4E81A 3LGLA 3OBYA 2F1AA 1VQ5Q 1M5Q1 2AZVA 1ZHIA 4LXCA 4JNFA 5L23A 4RKUE 2J6KA 1PRLC 3FJPA 1M3CA 3CC2A 4HXJA 5AT1B 1K9MC 4O6JA 4AT1B 2VXEA 1W2BP 4AZ7A 2AKLA 1WA7A 4II1A 1VQ4A 5CK9A 4N4IA 3SWNB 3CCRA 4LNPA 4C8QG 2QGFB 2LNHB 4C92C 4EMKB 4LD6A 3FB9A 1VQKT 3LLRA 4ELYC 1TUGB 2VVKA 2X3WD 2ED0A 1YBYA 1FXXA 4AZCA 4FYVB 1QCOA 1E1DA 2K5LA 1VIEA 4C92E 1RUWA 2EQUA 4M7AA 4NQIA 1WHLA 2GGRA 1M27C 1X04A 3JB9H 4AFQC 4A53A 3C7NA 3VS1A 4KIKA 4AG1C 2CT4A 2QA4A 2VKNA 1DKYA 2FPDA 2XDPA 4IW0A 4BI8B 1PC0A 4M78D 2RQWA 2EJGA 4C0GA 1QLYA 1RI0A 1SF9A 2DL4A 4ZN1A 3PIPA 2LVMA 1YJ9Q 3HFOA 3JB9D 2EYWA 2HMAA 3RR6A 1UJ0A 2HKQB 4WPCA 3RPMA 4CI0C 3BDUA 4EZSA 3CKDA 4FZSA 1E2UA 1QVPA 2QQRA 1LNXA 5CQYA 3CC4T 3O3OB 3OBWA 2L3QA 1YI2T 5C6SA 1KG1A 4EMGA 4J83A 2HQHA 2OBLA 1MGQA 1X6OA 2HQEA 3M4GA 1OZ3A 2O4XA 1QKXA 1FYNA 4IIOA 1UUEA 1YHQT 2KDSA 2AHJB 3RBBB 3I55A 3DYTA 3I56Q 2XD0A 6AT1B 1VOMA 4JJCA 2YDLA 4CRIA 1VQ9Q 4QW2A 3QYGB 1I49A 2OTJA 2F18A 4IWQA 2XDDA 3CCUT 2DMOA 4XU0A 3VEAA 2L3SA 4C92A 3I5SA 4N0AA 3HAJA 3CCET 1EZZB 3DB4A 4AZBA 5LJ3d 2O9SA 4QKUA 3REAB 5C5BB 2KQWA 2AT1B 2LQWA 1MV3A 2JM9A 2K9GA 2R58A 3QZ9B 1BCOA 1ZYLA 2BUDA 1KQSP 1YIJT 5FROA 2DYBA 2MYSA 4JWDA 1GCQC 2VUBA 4B6MA 1BIAA 4M7AD 1WJSA 2O9VA 1UGVA 2JS0A 1H8KA 3CMEQ 1SRLA 4KH0B 3JB9J 1NEGA 4EZUA 1X6GA 1N27A 1WQWA 1ZSZA 2LX7A 1PWTA 3OS5A 2EYXA 2A0FB 1VQMQ 2PMRA 3CD6A 1W70A 1JRIA 2V8JA 3T46A 4KUDK 3B51X 1UGSB 2R5AA 4XU1A 5IT9E 3O8VA 3OWGA 3CPWA 1G3YA 4QQGA 1B07A 3NPFA 4YTLA 4C92D 2ED1A 2J6FA 5FW9A 2YIBA 3D51A 3VU3C 4F17A 2DXBA 4R55A 1K4US 1I4LA 2LMJA 4JLGA 1D0ZA 3L2QA 3CBOA 4OMOA 3G71T 4IWPA 2YIAA 1K1ZA 3CV5A 3JCMg 1Y2OA 4PJOA 2FZCB 4C92F 4EDUA 5FRMA 5J39A 1SU6A 2DL5A 3EFRA 2ROTA 3M55A 3CBPA 5LJ3h 1WDXA 4M78E 5FU7B 3MHXA 1D1CA 2E10A 3H0FA 2KRSA 2N3KA 3H0IA 4ME7A 1Q95G 1C6VX 1SSHA 3B52X 5GAMd 4PFOA 1SKUB 2JNGA 4N0AC 1KIKA 4C0DC 1BK2A 2FHDA 5A0GA 4UC4A 2EKHA 4XTWA 4OMFB 2RHUA 5A2QE 4AKVA 2WYHA 4FYYB 2VASA 1GXIE 4HA8A 4PK4A 2HL3A 2CDTA 1UGQB 4HVVA 4OB0B 1YIJA 3RMQA 2DM1A 2DVEA 4PKCC 5DLOA 1QMCA 4FL6A 4A63B 3GNFB 1VQ8A 5GJVB 1NBEB 2V8KA 1MNEA 4C5EA 4R5GA 1V1CA 3CCJA 3OQ5A 3T49A 1Y71A 1KD1U 2X9HA 2GA9D 4N4GA 2EFLA 1Q86R 1H3ZA 1RAIB 3KFVA 1QX1A 5E84A 2C0IA 4ZTJA 4C8QE 4M75D 2DO3A 1X27A 3JCMd 1HD3A 1GL5A 1K9MU 2DZ9A 3I9QA 1PRMC 1C1AA 3CBMA 4EZXA 2DTOA 4IUQA 1Y96A 2RO0A 3CCST 2ZAEA 4PNOA 2K79A 4KIKB 1KSWA 4IM2A 2EJFA 3JCMP 5GAMg 1IB8A 3CCJQ 1KC8R 4ORZA 1K8AU 3JCMf 2LJ3A 2C06A 2Y4XA 1VQ8Q 4R56A 1KD1R 3G9GA 2FO0A 1NG2A 1NPRA 5LJ5f 1QWFA 1ABOA 3QYHB 4KT0E 4J6XA 4LD9K 4RG8A 2X3XA 4IIMA 5ECAA 1UHFA 3JCMc 5GMKm 2V0OA 1XOVA 1O7DB 1EIFA 4HYBA 3RESA 4RTUA 2HBWA 4E6RA 2J06A 3KBGA 2COWA 2ND1A 1TS9A 3MEWA 2CSQA 4DEYA 1M8VA 2EIFA 2CSIA 3X20B 1YJNT 3HAIA 3BVXA 3PGGA 2YRVA 4GBQA 4M78A 1KQ1A 1RABB 2DF6A 2RMOA 4J9HA 4NOYA 1QVGS 2FYKA 3E1SA 2OO2A 4IM0A 3EGXB 3BY7A 2Y90A 3HP9A 2E41A 1PSEA 3E2UA 2M16A 2FL7A 2JMAA 1ZA2B 1IO6A 3QDRB 4L5GA 3A8GB 3G71A 2CP2A 4KUIA 2Z0VA 3QG1A 4C0FA 4XTXA 4LDVA 1UFFA 3CCRT 3JSCA 1VYTA 1WFWA 5KYWB 1VQ4T 1RLPC 1X2KA 2NUZA 2W0ZA 3OW2A 3NGPA 1ZSZB 1UE9A 4EZZA 2RPNA 4E7JA 2LXYA 2YUQA 5AYFA 3GOXA 2QXFA 3EJPA 1WJRA 2EGEA 1OV3A 3HPWA 1EFNA 3UDCA 4HCCA 4M77B 4JWEA 2RT6A 4DBQA 2FPEA 4A4KA 2JNKA 1I0CA 4DBFA 4JS4A 1O7DC 1G8XA 2D1LA 3L3OM 3PFSA 3EG1A 1OEBA 3VS2A 3EG3A 4LDYA 5LJ5g 5KCHA 4RTZA 2K7AA 4XAXB 3EJRA 2ZXQA 1M90U 5I11A 3D4ZA 4IUUA 3EG0A 4HT9A 4H6IA 1BI2A 2OAWA 4NPHA 3CXCP 3M4YA 2ENMA 4FT2A 1SU8A 4KGZB 5GANf 3G4ST 2L3PA 3FD9A 3MO8A 2CREA 2QQ9A 2E12A 3HFNA 3ER0A 1LJOA 5KYWA 5IHNA 4OB3B 1TXQA 1D0YA 2RHZA 2KNBB 4PJLA 1BIBA 1JXMA 2NLUA 3TCJA 4EMKC 1LQ7A 2CUDA 2K3XA 3L42A 1WPYA 2JNSA 1ZUYA 3D4YA 3SHWA 2Q12A 3DPQA 2P4RA 2A37A 1Q82R 2GNCA 4I1QA 3BVVA 1GNTA 1D1BA 1BU1A 1KQSS 4ELZC 3G7ZA 1ZA1B 4UDYX 2Z0WA 4L59A 2BKDN 4IUVA 1LVKA 1N9RA 2HAXA 4MMKA 1HXKA 1OA1A 2X4JA 5GAMf 2E6NA 4M77C 1D3BB 3VJPA 1WXTA 1T0JA 5LJ3e 3F70A 2G3RA 5FU7C 3NHNA 2LCLA 5GMKe 3LLLA 2YL6A 4ESRA 3UWNA 2FB7A 1RI9A 3IQLA 2L3RA 4C92G 4E7HA 3OHXM 2FG0A 2BZ8A 1KQ2A 1E6HA 3QWYA 2CKKA 1RAEB 4L6V5 4WPEA 4IURA 4OGEA 1T3LA 2VWFA 3M59A 4D8DA 2DL8A 4DCNC 1BKBA 2QA4Q 4PLLA 5KYXB 5IHKA 4DOWA 4FZOA 3ULRB 1YN8A 1GFCA 3OS0A 2DPPB 4AZ5A 2KY9A 3J7AF 2OX7A 2QQBA 3EJTA 1SUFA 1JBMA 3JAME 3QIIA 1Q82U 1ZX6A 2E3HA 4M7AE 2RK2A 1N8RR 3RKWA 1XJWB 3I2WA 3M54A 5IXBA 3CCRQ 3LX7A 2QQSA 1K9AA 1U5SA 1IRXA 1M1KR 4PO2A 1K76A 3ZEHA 2VGNA 2DRMA 2C08A 2LCSA 2P84A 2L0AA 4F7UF 3EJSA 1VQLT 4HY9A 4J9EA 2KXCA 1VYVA 2H8HA 1VQ5A 2DL3A 4C92B 5IHIA 5D6WA 1VQ6A 1VQOT 1B34A 2EFKA 4OMPA 1W2BS 2FICA 4XTYA 1WQ7A 1R0CB 1WZOA 1SRMA 5J26A 4ZGEB 2QTVA 4J7FA 4LUEA 3VYHB 3PVQA 2FZKB 4HCBA 4E2FB 1BBZA 3CEYA 4EZYA 3GF5A 1GRIA 1NLPC 1ZWWA 1FMKA 2RJCA 3S3OA 1Q7YC 3CC4Q 5GAOp 4CC3A 3CC7A 4BACA 4R5JA 3QE6A 2V26A 3S3NA 5GAN3 2QASA 4PFPA 2DXUA 3CAZA 2EJ9A 4F04B 5GAMh 2D8HA 1I1JA 3OYYA 3NFCA 1HJDA 4J9CA 2EYYA 1U8RA 1QVFA 1Q7YU 3QJYA 2PY6A 4FW1A 1U06A 2ZPFB 1HXDA 3G6EA 2KAFA 2LTOA 4C8QB 3A98A 4WCIA 3OA6A 3CCLA 4HVUA 1NPPA 2DTHA 2E3IA 4FM3A 4KULA 3INZA 4EZWA 1G3SA 4KH1B 1FWZA 4FT4A 2OW7A 4AFUC 1RADB 1YWOA 1IGQA 5CAIA 1VQPQ 2JS2A 4FIBA 4C5HA 1KC8C 2RM4A 5KE3A 2CZ6B 2JM8A 4J9BA 4DEXA 2WSEE 3OYEA 2RHIA 3HRTA 2Y4YA 2RH2A 3N5BB 1E9VA 3H8ZA 3NTHA 2XICA 5KCOA 4RMOA 3OB9A
chains in the Genus database with same CATH topology
1AZEA 1W9MA 1NYFA 3LMFA 5I22A 2KROA 2EKHA 2HEQA 4HR1A 2KR3A 1LCKA 2JTEA 3T4AG 2K3BA 3EHRA 2YUNA 1PHTA 4RTVA 4EZNA 4R5IA 4IWOA 1ZUKA 1I07A 2CDTA 2AZSA 4HVVA 2O2OA 2LQNA 2DM1A 1U00A 3FJ5A 3GBQA 2AKKA 1Z9QA 2DVJA 1UHCA 3NMZC 2DNUA 4A63B 2JW4A 4LE9A 3GI7A 2ABLA 1N5ZA 1NEBA 5GJVB 3D2EA 3EG2A 1MJGA 1JXOA 4IM3A 4OMNA 2YI9A 3LH5A 4R5GA 1V1CA 2EW3A 1Z9ZA 4H6HA 3VS4A 2C0TA 1M30A 1GBRA 3T49A 2E5KA 3U23A 1E6GA 2D0NA 2GA9D 3KDRA 2K6DA 3KFVA 5E84A 2C0IA 2SEMA 1X43A 2YSQA 1JQKA 1X27A 3M0UA 2DBMA 3M0SA 1HD3A 1S1NA 1GL5A 2RQVA 2W10A 1PRMC 3I9QA 1AD5A 4EZXA 3RNJA 3R6NA 4EIKA 3EHQA 3KAWA 4KIKB 2K79A 2FPFA 1WXBA 2MOXA 1KSWA 4IM2A 1CSKA 1RLQC 1X6BA 3VS3A 3H0HA 4ORZA 2BTTA 3THKA 4AFSC 2LJ3A 3KAVA 2EVRA 2KYMA 2Z8YA 4FSSA 1X2QA 2FO0A 1NG2A 1ARKA 1H3HA 1K0XA 1AWXA 4EZOA 1QWFA 1ABOA 4EZVA 1PNJA 1M8MA 1YNZA 4IIMA 2KEAA 5ECAA 1UHFA 1XOVA 1AWWA 4HYBA 4RTUA 2HBWA 1JQQA 4D8JA 1NYGA 1T0HA 1W6XA 4E6RA 2J06A 1UJYA 4R5KA 1ABQA 4GLMA 3PVLA 2ND1A 1TG0A 2HDAA 1JU5C 2CSQA 4DEYA 3TSZA 2J6OA 2BZYA 4JZ4A 2YI8A 2X3XD 2CSIA 4E3CA 1GFDA 4EZTA 2F2VA 1VA7A 2L2PA 3VS5A 3VS6A 4JJBA 4D8KA 3ER9B 3VRYA 3F7WA 1G83A 1WYXA 4GBQA 2DF6A 2RMOA 4J9HA 4IM0A 2V1QA 2XMFA 2DILA 2EYZA 4KRTA 3I39X 2KT8A 4K11A 1TUCA 2KXDA 2FRYA 2RN8A 2JMAA 1IO6A 2X5CA 2OI3A 2DBKA 3TVTA 4ZNXA 2DRKA 2DA9A 2MIOA 2QDLA 4Y92A 2ROLA 3B53X 1UFFA 4G6QA 1K0SA 2CH4A 2V1RA 1VYTA 1WFWA 2K2MA 2HSPA 5FIGA 1RLPC 1X2KA 2NUZA 2W0ZA 3NGPA 1QCFA 2GQIA 2PTKA 2EBPA 1UE9A 4EZZA 2JXBA 2RPNA 4AFZC 4F00A 2LZ6B 4OMQA 4Z88A 2YUQA 1TUDA 1YCSB 1UTIA 4JWCA 1ZBJA 1SEMA 1PKSA 1ZLMA 2EGEA 2CT3A 1OV3A 2G6FX 1EFNA 2GBQA 3VS7A 1YWPA 1GCPA 4J9FA 3QA8A 1SU7A 2M0YA 4JWEA 2EX3B 2RT6A 2A36A 4RTTA 2FPEA 2O88A 2CUBA 1I0CA 3M0TA 4JWIA 3VEBA 1OAOA 3L3OM 2LP5A 4RUGA 3EG1A 2QFFA 1OEBA 1VYUA 3VS2A 3REBB 2KHOA 2YIVX 3EG3A 1NM7A 1Y57A 4RTZA 2K7AA 2RQTA 1H92A 2FRWA 4RTXA 5I11A 1CKAA 1AOJA 1WX6A 3EG0A 2GTJA 4H6IA 1Y0MA 2OAWA 2AK5A 4CC4B 4NPHA 3ZEDA 2ENMA 1ZSGA 3I01A 3I04A 3EGUA 1SU8A 2L3PA 2PNIA 3FD9A 2NWMA 1PKTA 5IXFA 2CREA 3UITA 4RTYA 2A28A 1MV0B 5IHNA 2SRCA 2GAFD 2KNBB 1GCQA 2ND0A 1AVZC 1JXMA 1NLOC 1GN9A 2KE9A 4JLCA 4CC2A 3O3MB 4E81A 2CUDA 2F2XA 2NCZA 2AZVA 2JNSA 1ZUYA 3CQTA 4JNFA 3SHWA 4F14A 5L23A 3DPQA 1PRLC 2J6KA 2P4RA 2A37A 3VS0A 2GNCA 2OJ2A 2RNAA 1M3CA 1GNTA 4HXJA 4HCKA 1BU1A 1OPLA 2KRMA 2AKLA 1WA7A 4J9IA 3QNJA 3T48A 2FEIA 2D1XA 4UDYX 4QT7A 2DX1A 2EPDA 3I5RA 4JNEA 4LNPA 2LNHB 4J9GA 4RTWA 1QKWA 1A0NB 2VVKA 2X3WD 2ED0A 2EWFA 1OA1A 1JEGA 3O3NB 1E1DA 2YUOA 1WXTA 2C0OA 1ZUUA 1T0JA 1RUWA 3NHNA 2LM0A 3RV1A 2GGRA 3I35A 1M27C 1BB9A 4AFQC 4JL9A 2RQRA 4ESRA 3C7NA 4CC7A 3VS1A 4KIKA 4AG1C 2CT4A 2YT6A 1RI9A 2VKNA 3IQLA 1DKYA 4M4ZA 2MCNA 3OHXM 2FG0A 2BZ8A 2FPDA 1E6HA 4IW0A 1UG1A 3QWYA 4EZQA 2J7IA 2KYBA 1M3BA 3ERCC 2RQWA 1QLYA 1WXUA 1CKBA 1T3LA 4JZ3A 2VWFA 4D8DA 2DL8A 1DKXA 4R5LA 2DL4A 5FWBA 2CH4W 5IHKA 1UDLA 2EYWA 4HR1B 1UJ0A 4Z8AA 3UF4A 2A08A 3ULRB 1YN8A 4X1VA 2KRNA 4EZSA 1GFCA 2O31A 4AG2C 1E2UA 4JPBW 2YUPA 1SUFA 4B9QA 1ZX6A 3O3OB 2L3QA 2KT1A 2J05A 2OBLA 4J9DA 4JJDA 3VRZA 1AEYA 2RQUA 5IH2A 2DL7A 2BZXA 5FLEX 2KBTA 1YP5A 2ECZA 5IXBA 3M0QA 3PE0A 2EQIA 1QKXA 1FYNA 2LJ1A 1UUEA 4IIOA 1K9AA 2I0NA 1U5SA 2QXLA 2EGAA 3C0CA 4PO2A 1K76A 1M3AA 3RBBB 4OMLA 2RF0A 2DRMA 2OBMA 2LCSA 2F2WA 1GNLA 2L0AA 4JJCA 2YDLA 4EZPA 4HY9A 3M0RA 1UPXA 4J9EA 2KXCA 1VYVA 2H8HA 4EZRA 4IWQA 2DL3A 2JT4A 3M0PA 1X69A 3JV3A 2D8JA 5FWCA 2DMOA 5IHIA 3VEAA 2L3SA 1G2BA 4OMPA 3I5SA 1SPKA 1SRMA 1W1FA 1MUZA 2O9SA 3REAB 1OA0A 1AWJA 4LUEA 3PVQA 2LQWA 1MV3A 3DPOA 1WI7A 2JM9A 2K9GA 3H41A 1BBZA 1KFZA 3O5ZA 4HVWA 1DKZA 4EZYA 5HCKA 4F16A 1GRIA 1JO8A 1SHGA 5GJWB 1NLPC 2EGCA 1FMKA 4OMMA 1T3SA 1UECA 1ZYLA 4CC3A 2GTOA 2DYBA 2ESWA 4JWDA 1GCQC 4M0MA 4R5JA 1WLPB 3D2FA 2DLPA 4JN4A 2WINM 3SEMA 2O9VA 5TKYA 1UGVA 4F01A 3T47A 2JS0A 1H8KA 1SRLA 2D8HA 2DE0X 2M51A 1I1JA 1NEGA 4EZUA 1X6GA 1HJDA 1SHFA 4J9CA 2LX7A 2EYYA 1PWTA 1HSQA 2EYXA 2PY6A 1U06A 2LJ0A 5EC7A 1W70A 2DJQA 2JMCA 3UA6A 3DPPA 3UA7A 3T46A 3B51X 3UATA 3VKHA 2PZ1A 3A98A 3ZL7C 4WCIA 4HVUA 3OWGA 2IIMA 4FM3A 3TSWA 4Z89A 1OOTA 1B07A 4LN2A 3ER8C 4EZWA 1OPKA 3NPFA 2ED1A 2J6FA 5FW9A 2YIBA 4R0KA 3QWXX 4F17A 1K4US 1WIEA 4AFUC 2LMJA 1YWOA 2KGTA 1B3QA 4OMOA 4IWPA 2YIAA 1K1ZA 2JS2A 2B86A 1AZGB 4UDXX 1SU6A 2DL5A 2ROTA 2JM8A 4J9BA 1E7OA 4LUDA 1U3OA 1WDXA 4DEXA 3RV0A 1QWEA 3H0FA 2KRSA 2N3KA 3H0IA 1KJWA 1AWOA 1E9VA 1SSHA 3B52X 1J3TA 1GBQA 2HCKA 1KIKA 1BK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AZE A;  1NYF A;  5I22 A;  2KRO A;  2EKH A;  2HEQ A;  2KR3 A;  1LCK A;  2JTE A;  2K3B A;  3EHR A;  2YUN A;  1PHT A;  4RTV A;  1ZUK A;  1I07 A;  2CDT A;  2AZS A;  4HVV A;  2O2O A;  2LQN A;  2DM1 A;  3FJ5 A;  3GBQ A;  2AKK A;  1Z9Q A;  2DVJ A;  1UHC A;  3NMZ C;  2DNU A;  4A63 B;  2JW4 A;  4LE9 A;  2ABL A;  1N5Z A;  1NEB A;  5GJV B;  3EG2 A;  1JXO A;  4OMN A;  3LH5 A;  2EW3 A;  1V1C A;  1Z9Z A;  3VS4 A;  2C0T A;  1M30 A;  1GBR A;  2E5K A;  3U23 A;  1E6G A;  2D0N A;  2K6D A;  3KFV A;  2C0I A;  2SEM A;  1X43 A;  2YSQ A;  1X27 A;  3M0U A;  2DBM A;  3M0S A;  1HD3 A;  1S1N A;  1GL5 A;  2RQV A;  2W10 A;  1PRM C;  3I9Q A;  1AD5 A;  3RNJ A;  3R6N A;  4EIK A;  3EHQ A;  2K79 A;  2FPF A;  1WXB A;  2MOX A;  1KSW A;  1CSK A;  1RLQ C;  1X6B A;  3VS3 A;  3H0H A;  4ORZ A;  2BTT A;  3THK A;  4AFS C;  2LJ3 A;  2EVR A;  2KYM A;  4FSS A;  1X2Q A;  2FO0 A;  1NG2 A;  1ARK A;  1H3H A;  1K0X A;  1AWX A;  1QWF A;  1ABO A;  1PNJ A;  1M8M A;  1YNZ A;  4IIM A;  2KEA A;  5ECA A;  1UHF A;  1XOV A;  1AWW A;  4RTU A;  2HBW A;  1JQQ A;  1NYG A;  1W6X A;  1T0H A;  4E6R A;  2J06 A;  1UJY A;  1ABQ A;  4GLM A;  3PVL A;  1TG0 A;  2HDA A;  1JU5 C;  2CSQ A;  4DEY A;  3TSZ A;  2J6O A;  2BZY A;  4JZ4 A;  2X3X D;  2CSI A;  1GFD A;  2F2V A;  1VA7 A;  2L2P A;  3VS5 A;  3VS6 A;  4JJB A;  4D8K A;  3VRY A;  1G83 A;  4GBQ A;  1WYX A;  2DF6 A;  2RMO A;  4J9H A;  2V1Q A;  2XMF A;  2DIL A;  2EYZ A;  4KRT A;  2KT8 A;  4K11 A;  1TUC A;  2KXD A;  2FRY A;  2RN8 A;  2JMA A;  1IO6 A;  2OI3 A;  2DBK A;  3TVT A;  4ZNX A;  2DRK A;  2DA9 A;  2MIO A;  2QDL A;  4Y92 A;  2ROL A;  1UFF A;  1K0S A;  2CH4 A;  2V1R A;  1VYT A;  1WFW A;  2K2M A;  2HSP A;  1RLP C;  1X2K A;  2NUZ A;  2W0Z A;  3NGP A;  1QCF A;  2GQI A;  2PTK A;  2EBP A;  1UE9 A;  2JXB A;  2RPN A;  4AFZ C;  2LZ6 B;  4OMQ A;  4Z88 A;  2YUQ A;  1TUD A;  1YCS B;  1UTI A;  1ZBJ A;  1SEM A;  1PKS A;  1ZLM A;  2EGE A;  2CT3 A;  1OV3 A;  2G6F X;  1EFN A;  2GBQ A;  3VS7 A;  1YWP A;  1GCP A;  4J9F A;  2M0Y A;  4RTT A;  2A36 A;  2FPE A;  2O88 A;  2CUB A;  1I0C A;  3M0T A;  4RUG A;  2LP5 A;  3EG1 A;  1OEB A;  1VYU A;  3VS2 A;  3REB B;  3EG3 A;  1NM7 A;  1Y57 A;  4RTZ A;  2K7A A;  2RQT A;  1H92 A;  2FRW A;  4RTX A;  5I11 A;  1CKA A;  1AOJ A;  1WX6 A;  3EG0 A;  2GTJ A;  1Y0M A;  2OAW A;  4CC4 B;  2AK5 A;  2ENM A;  1ZSG A;  3EGU A;  2L3P A;  2PNI A;  2NWM A;  1PKT A;  5IXF A;  2CRE A;  4RTY A;  2A28 A;  1MV0 B;  5IHN A;  2SRC A;  2KNB B;  1GCQ A;  1JXM A;  1AVZ C;  1NLO C;  2KE9 A;  4CC2 A;  2CUD A;  2F2X A;  2AZV A;  1ZUY A;  3CQT A;  3SHW A;  4F14 A;  5L23 A;  2J6K A;  1PRL C;  2P4R A;  3VS0 A;  2A37 A;  2GNC A;  2OJ2 A;  2RNA A;  1M3C A;  4HXJ A;  4HCK A;  1BU1 A;  1OPL A;  2KRM A;  2AKL A;  1WA7 A;  4J9I A;  2FEI A;  2D1X A;  4QT7 A;  2DX1 A;  2EPD A;  3I5R A;  4LNP A;  2LNH B;  4J9G A;  4RTW A;  1QKW A;  1A0N B;  2VVK A;  2X3W D;  2ED0 A;  1JEG A;  2YUO A;  1WXT A;  2C0O A;  1ZUU A;  1T0J A;  1RUW A;  3NHN A;  2GGR A;  3I35 A;  1M27 C;  1BB9 A;  4AFQ C;  2RQR A;  4ESR A;  4CC7 A;  3VS1 A;  4AG1 C;  2CT4 A;  2YT6 A;  1RI9 A;  2VKN A;  3IQL A;  4M4Z A;  2MCN A;  2FPD A;  2FG0 A;  2BZ8 A;  1E6H A;  1UG1 A;  3QWY A;  2J7I A;  2KYB A;  1M3B A;  2RQW A;  1QLY A;  1WXU A;  1CKB A;  1T3L A;  4JZ3 A;  2VWF A;  4D8D A;  2DL8 A;  2DL4 A;  5FWB A;  2CH4 W;  5IHK A;  1UDL A;  2EYW A;  1UJ0 A;  4Z8A A;  3UF4 A;  2A08 A;  3ULR B;  1YN8 A;  4X1V A;  2KRN A;  2O31 A;  1GFC A;  4AG2 C;  4JPB W;  2YUP A;  1ZX6 A;  2L3Q A;  2KT1 A;  2J05 A;  4J9D A;  4JJD A;  3VRZ A;  1AEY A;  2RQU A;  5IH2 A;  2DL7 A;  2BZX A;  2KBT A;  1YP5 A;  2ECZ A;  5IXB A;  3M0Q A;  3PE0 A;  2EQI A;  1QKX A;  1FYN A;  2LJ1 A;  1UUE A;  4IIO A;  1K9A A;  2I0N A;  1U5S A;  2EGA A;  3C0C A;  1K76 A;  1M3A A;  3RBB B;  4OML A;  2RF0 A;  2DRM A;  2LCS A;  2F2W A;  2L0A A;  4JJC A;  2YDL A;  3M0R A;  4J9E A;  2KXC A;  2H8H A;  1VYV A;  2DL3 A;  2JT4 A;  3M0P A;  1X69 A;  3JV3 A;  2D8J A;  5FWC A;  2DMO A;  5IHI A;  2L3S A;  1G2B A;  4OMP A;  3I5S A;  1SPK A;  1SRM A;  1W1F A;  1MUZ A;  2O9S A;  3REA B;  1AWJ A;  4LUE A;  3PVQ A;  2LQW A;  1MV3 A;  1WI7 A;  2JM9 A;  2K9G A;  3H41 A;  1BBZ A;  1KFZ A;  3O5Z A;  4HVW A;  5HCK A;  4F16 A;  1GRI A;  1JO8 A;  1SHG A;  5GJW B;  1NLP C;  2EGC A;  1FMK A;  4OMM A;  1T3S A;  1UEC A;  4CC3 A;  2GTO A;  2DYB A;  2ESW A;  1GCQ C;  1WLP B;  2DLP A;  3SEM A;  2O9V A;  1UGV A;  2JS0 A;  1H8K A;  1SRL A;  2D8H A;  2DE0 X;  2M51 A;  1I1J A;  1NEG A;  1X6G A;  1HJD A;  1SHF A;  4J9C A;  2LX7 A;  2EYY A;  1PWT A;  1HSQ A;  2EYX A;  1U06 A;  2LJ0 A;  5EC7 A;  1W70 A;  2DJQ A;  2JMC A;  3UA6 A;  3UA7 A;  3UAT A;  2PZ1 A;  3A98 A;  3ZL7 C;  4WCI A;  4HVU A;  2IIM A;  3TSW A;  4Z89 A;  1OOT A;  1B07 A;  4LN2 A;  1OPK A;  3NPF A;  2ED1 A;  2J6F A;  5FW9 A;  4R0K A;  3QWX X;  4F17 A;  1K4U S;  1WIE A;  4AFU C;  2LMJ A;  1YWO A;  2KGT A;  1B3Q A;  4OMO A;  1K1Z A;  2JS2 A;  2B86 A;  1AZG B;  2DL5 A;  2ROT A;  2JM8 A;  4J9B A;  1E7O A;  4LUD A;  1U3O A;  1WDX A;  4DEX A;  1QWE A;  3H0F A;  2KRS A;  3H0I A;  1KJW A;  1AWO A;  1SSH A;  1J3T A;  1GBQ A;  2HCK A;  1KIK A;  1BK2 A; 
#chains in the Genus database with same CATH topology
 1AZE A;  1W9M A;  3OYL A;  5I22 A;  2F5T X;  5KBP A;  2KRO A;  3G4S A;  2KR3 A;  1LCK A;  1NJI U;  3OYD A;  4FM4 B;  1VQM T;  3V8K A;  2RHY A;  4EZN A;  1IHV A;  4IWO A;  2MAM A;  4OGC A;  3EH1 A;  2GQV A;  2AZS A;  4DBH A;  2K2V A;  3L2U A;  1NE8 A;  3CPF A;  2LNV A;  3FJ5 A;  4Z02 A;  3EJQ A;  1O75 A;  4AMC A;  1D0X A;  2AKK A;  1Z9Q A;  2DVJ A;  4JS5 A;  5GAN 2;  1FX7 A;  3CZS A;  2LT4 A;  3OYA A;  2JW4 A;  3GI7 A;  3EG2 A;  1MJG A;  1JXO A;  3FLG A;  4IM3 A;  3HRS A;  3SOG A;  2HD0 A;  3LH5 A;  2E5Q A;  3VS4 A;  2DD5 A;  1V76 A;  2E4H A;  4M7A B;  5GAM e;  2K6D A;  4LDU A;  2SEM A;  3FEO A;  4BUG A;  2PUO B;  1S72 A;  1NJI C;  4M7D A;  3ZBD A;  2OTL T;  2Z0N A;  1M1K C;  2PVD B;  5EG2 A;  3WXM B;  4QVZ A;  4PJO E;  2FPF A;  5HK3 A;  4BDZ A;  4OVA A;  1N8R C;  1VQ7 T;  3VUB A;  4AFS C;  2EVR A;  1EX4 A;  2Z8Y A;  3OSV A;  5LL6 S;  1X2Q A;  2QG9 B;  1BCM A;  2X4Y A;  1K0X A;  4FYX B;  3EFO B;  1YNZ A;  2AIR B;  4J6W A;  3EFS A;  2KEA A;  3RIR A;  3PTA A;  4XTZ A;  5HK0 A;  1AWW A;  3OYF A;  2GF4 A;  5DY9 A;  3CD6 Q;  1YJN A;  4D8J A;  3BVT A;  1NYG A;  4E7S A;  3H9N A;  5LJ5 h;  3PVL A;  5D7U A;  4KBM B;  4GY5 A;  4MZM A;  4M78 F;  4BD3 A;  5FLX E;  3L2W A;  2BZY A;  3KXT A;  4JZ4 A;  1QVF S;  2HSE B;  2X3X D;  4E3C A;  2RA2 A;  1VA7 A;  2E65 A;  3EG9 A;  5KYX A;  2YLA A;  1G83 A;  3J81 E;  1ACM B;  2V1Q A;  2XMF A;  2DIL A;  4A4F A;  2NUT B;  2KT8 A;  2F7Q A;  2RN8 A;  3DX0 A;  3M53 A;  5GAN g;  2OI3 A;  3OMC A;  1VQP A;  1OYX A;  4AZG A;  3A5Z B;  2V8I A;  4F7U A;  2DRK A;  2MIO A;  3D52 A;  4M7D E;  4M75 E;  2EQK A;  2ROL A;  4X34 A;  3BFM A;  4G6Q A;  1K0S A;  1KHC A;  2V1R A;  3VKI A;  2K2M A;  2HSP A;  1JJ2 A;  1TQT A;  3CCM Q;  3HTR A;  2GQI A;  4JJN K;  5CKB A;  2BE9 B;  2F7P A;  4ZGJ B;  1TUD A;  1YCS B;  3G6E Q;  1UTI A;  2JJ9 A;  4JWC A;  1M90 R;  3MKD A;  4FU6 A;  4PJO C;  2F1B A;  2CT3 A;  3BUP A;  2G6F X;  2O0I 1;  5CIU A;  2M0Y A;  2B8A A;  3C95 A;  2O88 A;  2CUB A;  3CCJ T;  3M0T A;  2YHT A;  2EFI A;  4RUG A;  4NL3 A;  2K3Y A;  1O9S A;  1VYU A;  1YCY A;  2BIV A;  3REB B;  2KHO A;  2JTF A;  2A3L A;  3QBY A;  4B9X A;  1NM7 A;  4OB2 B;  5GMK i;  3CC4 A;  3SD4 A;  3E9G A;  2RQT A;  3G6E T;  2FRW A;  4MDX A;  1QVG A;  4C0Z A;  1WX6 A;  3JB9 F;  4CC4 B;  1I4T A;  2QEX Q;  1ZSG A;  3JRZ A;  3BUB A;  3P8H A;  2YRD A;  5I21 A;  3Q0K A;  2NWM A;  1PKT A;  2MK5 A;  2D0Q B;  5GAN 7;  3OYB A;  2GAF D;  2M02 A;  1GCQ A;  1VQ6 Q;  1AVZ C;  2X3W A;  1NLO C;  8AT1 B;  2QA4 T;  1YIT A;  2NCZ A;  5GAN h;  5GAN d;  5I2S A;  2F7O A;  4F14 A;  4M77 G;  3VS0 A;  5HKC A;  3DDF A;  1WNL A;  2OJ2 A;  4C8Q C;  2DER A;  2RNA A;  3BW1 A;  4XQ3 A;  4HCK A;  4FSX A;  1OPL A;  4OP0 A;  4J9I A;  3T48 A;  1KK7 A;  3HHT B;  1RAA B;  4QT7 A;  1AHJ B;  2DX1 A;  3I5R A;  4JNE A;  4NSW A;  1Q81 C;  3T9N A;  1I4D A;  1M2V A;  4J9G A;  2RAI A;  4RTW A;  1QKW A;  1VQ6 T;  4PL6 A;  1A0N B;  2JN0 A;  2CP5 A;  2EWF A;  4C0D B;  1JEG A;  1VQ4 Q;  3O3N B;  3LGF A;  3X28 B;  1XQH A;  2DET A;  1S72 T;  2YUO A;  3CC2 T;  4RCC A;  2C0O A;  2JTM A;  1UGP B;  1ZQ1 A;  3Q84 A;  2JOY A;  2E64 A;  2CYZ B;  3MEA A;  4JL9 A;  3M58 A;  2XKO C;  4CC7 A;  1YJW T;  1TQV A;  3S3M A;  2YT6 A;  3C4S A;  3PNW C;  2GFU A;  3QUI A;  1UB4 A;  3EGX A;  2ZGW A;  1TOV A;  1YFN A;  4EZQ A;  2J7I A;  2KYB A;  1M3B A;  3ERC C;  4M78 B;  3HKS A;  1CKB A;  1Q86 U;  3SYV A;  4PJN A;  4FCY A;  1DKX A;  2ZPB B;  3UT1 A;  3EGD A;  1C0M A;  2QEX A;  4C8Q D;  1UDL A;  4HR1 B;  3GNG A;  4Z8A A;  4F7U E;  4JLI A;  2A08 A;  1UGR B;  4X1V A;  2KRN A;  2O31 A;  4AG2 C;  3CPW P;  3FC3 A;  1HYO A;  1RAH B;  2M1H A;  2YLL A;  2DIQ A;  3C12 A;  2X51 A;  2KT1 A;  4M7D B;  2XK0 A;  1PG5 B;  4J9D A;  4JJD A;  3VRZ A;  2LQK A;  5GAO m;  3M5A A;  1AEY A;  3OS2 A;  5IH2 A;  2KMT A;  3Q1J A;  2BZX A;  5FLE X;  4ZN3 A;  3PIO A;  3L1A A;  1WGS A;  3PE0 A;  1OX9 A;  2LJ1 A;  2ZCF B;  2QK0 A;  1TQW A;  2EGA A;  4FW2 A;  8ATC B;  3C0C A;  3A8L B;  1M3A A;  4M78 G;  1VQN A;  4OML A;  2CP3 A;  2OBM A;  2QGG A;  3M0R A;  2O4X B;  2JT4 A;  3CCM A;  1U1S A;  1OUL A;  1X69 A;  3QKJ A;  3JV3 A;  4M78 C;  1K73 C;  2D8J A;  2F1L A;  5FWC A;  2ZPI B;  2VGM A;  2PU9 B;  3SFM A;  2K4Y A;  5LJ5 d;  4M77 F;  3OW2 S;  2QQA A;  3JCM W;  1G5V A;  4RCB A;  1TU0 B;  1QVF P;  1MUZ A;  2CZ7 B;  2EQJ A;  1OA0 A;  3CCQ Q;  3CCQ T;  3C94 A;  3CCL T;  1R0B G;  2FVU A;  2HNI A;  1KFZ A;  1QP2 A;  3EGD B;  3CC7 T;  3SB2 A;  5HCK A;  2LT1 A;  1JO8 A;  2WAC A;  3L2R A;  3E9F A;  3URG A;  2GFA A;  3CPW S;  4DOV A;  5IN1 A;  3AHU A;  2ESW A;  4M0M A;  3R6O A;  3D2F A;  2DLP A;  1Q81 U;  4JN4 A;  1WHH A;  1OZ2 A;  2P0P A;  2ALW A;  1BI3 A;  2VYT A;  2DE0 X;  3A8H B;  2M51 A;  4HCZ A;  3CCE Q;  1SHF A;  1R77 A;  1V29 B;  1HK9 A;  1XTD A;  3RKY A;  5KYY A;  3JCM J;  2R5M A;  2OTL A;  5M9O A;  2XG8 D;  2JMC A;  3DPP A;  4AZC B;  3EJU A;  5GAN 4;  3UAT A;  3VKH A;  2PZ1 A;  4JRI A;  2H3E B;  1Y7X A;  3D7S B;  1IRE B;  1MMD A;  1B34 B;  1WHM A;  3TSW A;  4Z89 A;  1QQJ A;  2RD1 A;  2JZ2 A;  3OYG A;  4C5G A;  2PVO B;  2YL9 A;  4E7L A;  1WIE A;  3BUI A;  2KGT A;  4DBR A;  3G71 Q;  1G3T A;  3CVR A;  1TTH B;  1VQ5 T;  2F5K A;  1DJ7 B;  1AZG B;  4TVR A;  1R33 A;  1K9M R;  1E7O A;  4LUD A;  1QW1 A;  2RJD A;  1QWE A;  2P0Q A;  3V7S A;  3QPH A;  1AWO A;  2RAJ A;  4JUV A;  2CP6 A;  1J3T A;  1GBQ A;  4V2S A;  2HCK A;  3CMA A;  5LJ3 f;  3GLX A;  1NYF A;  3LMF A;  3JCM Q;  3MJX A;  2YXY A;  3MET A;  2HEQ A;  2DIG A;  1MMN A;  3DX2 A;  3T4A G;  2K3B A;  2YUN A;  1PHT A;  4J7I A;  3JB9 I;  4X9C A;  2EWN A;  3GPL A;  4R5I A;  3A8M B;  4D6W A;  2R57 A;  3PLT A;  3LWI A;  4EMK A;  1U00 A;  3JCM V;  2RAK A;  4N4H A;  1KD1 C;  3P8D A;  2MWP A;  4Q5W A;  1UHC A;  3NMZ C;  1WHG A;  2WYI A;  5D6X A;  2DNU A;  3V7C A;  1W2B A;  1R34 A;  1LPL A;  1N5Z A;  1NEB A;  1LOJ A;  4VUB A;  3ACO A;  2DEU A;  3ZFJ A;  2MI6 A;  2YI9 A;  1Z9Z A;  1PD0 A;  2C0T A;  1GBR A;  5D6Y A;  2E5K A;  3CCV A;  1N9S A;  3U23 A;  4H8S A;  1E6G A;  1NZ9 A;  4M7D F;  4QQD A;  1X43 A;  2QKW A;  2YSQ A;  1JQK A;  3RDV A;  1WHJ A;  3CCM T;  3LYI A;  1VQ9 T;  2H3J A;  2RQV A;  2W10 A;  2MF2 A;  1PD1 A;  1Q86 C;  2CGH A;  2CZ0 B;  2DEQ A;  3RNJ A;  1IHW A;  1TWB A;  4EIK A;  4M77 E;  1M1F A;  5CVI A;  1AT1 B;  2DAQ A;  3EHQ A;  3CCV T;  3D50 A;  3KAW A;  3HSB A;  1WXB A;  3OYJ A;  1CSK A;  1RLQ C;  2MMP A;  3QHS A;  3H0H A;  4NS5 A;  2VC8 A;  3THK A;  3FRN A;  3PMI A;  1X01 A;  5CCA A;  3LH0 A;  4JRP A;  2KVQ G;  4P5N A;  1M4Z A;  1QWU A;  1P92 A;  2WSF E;  2XU8 A;  1H3H A;  4XU3 A;  1PNJ A;  2Z0O A;  1U1T A;  3CCL Q;  3J80 E;  4MML A;  1YIJ Q;  5GAO n;  2M9U A;  3OYK A;  2KK4 A;  1YWM A;  1JQQ A;  1T0H A;  5KYU A;  4GLM A;  4C5I A;  1TG0 A;  2HQX A;  5GAN 6;  1D3B A;  2HDA A;  2DD4 A;  3X25 B;  3VYG A;  3EFO A;  2J6O A;  2YI8 A;  1VQO A;  3CMA T;  5HY6 A;  1M1K U;  3CMA Q;  1GFD A;  3JCM e;  4EZT A;  2F2V A;  2X35 A;  3VS6 A;  2HZY A;  3ER9 B;  2L5Q A;  3V7R A;  3F7W A;  2RI2 A;  1OU9 A;  2XHC A;  1VQL A;  1X03 A;  2F69 A;  2EYZ A;  4KRT A;  4B9W A;  2ZPE B;  1PSF A;  1TUC A;  2KXD A;  2FZG B;  5L8R E;  4WF2 A;  5KYU B;  2X5C A;  5FU6 B;  4XTU A;  7AT1 B;  4PLI A;  3V8J A;  3TVT A;  1Q81 R;  3QDF A;  1VUB A;  2EAY A;  4Y92 A;  3DX3 A;  4M75 G;  3MP8 A;  3QZ5 B;  5GAM j;  2PTK A;  1IGU A;  4EMH A;  1QVG P;  4MDW A;  2JXB A;  4F00 A;  2LZ6 B;  4Z88 A;  5CKD A;  5KH6 A;  1NJI R;  1M9S A;  4Y91 A;  2DXT A;  3VUZ A;  3OYI A;  2OTL Q;  5CR2 A;  1PKS A;  1ZLM A;  3M56 A;  5J3B A;  1YIT T;  1GCP A;  4QVC A;  3QJ6 A;  4RTT A;  2EX3 B;  2A36 A;  3BVW A;  1TH7 A;  1Y07 A;  1VQ7 Q;  2EYQ A;  2YRC A;  3RKX A;  3CME A;  3BVU A;  3VEB A;  1FMV A;  2LP5 A;  4QVD A;  2QFF A;  2DKG A;  4PJO B;  3PMT A;  2YIV X;  2E6Z A;  4JRQ A;  2OZN B;  1H92 A;  5CQX A;  4RTX A;  1AOJ A;  1W4S A;  2GTJ A;  2COZ A;  1KC8 U;  2AK5 A;  5CKH A;  3ZED A;  3OSS C;  1YJW Q;  1KQS A;  1YI2 Q;  3I01 A;  4A4E A;  5IXF A;  3UIT A;  1QP3 A;  1K73 R;  2A28 A;  3TQ7 P;  2SRC A;  2EQM A;  4M77 D;  5LJ5 e;  4BE2 A;  2X3V A;  1YHQ Q;  2DJZ A;  4DYL A;  1GN9 A;  2KE9 A;  5IAY A;  1YJ9 T;  3CCS A;  2F2X A;  4PJO G;  4HT8 A;  2OTJ Q;  1WDZ A;  1R5E A;  3CQT A;  3E19 A;  4QQ6 A;  1D1A A;  1Y96 B;  3I56 A;  4ATM A;  1VQN T;  1VQN Q;  3I55 Q;  2HL5 C;  2IVW A;  2KRM A;  3GP8 A;  3QNJ A;  2FEI A;  5LJ3 j;  2D1X A;  4F7U G;  2EPD A;  1JB0 E;  1VIF A;  2YKT A;  1B7T A;  3QO3 A;  3HL8 A;  3TRE A;  2DTI A;  1VQP T;  5C5B A;  2YLC A;  4M75 A;  4BI4 A;  3EH2 A;  5GAO r;  3MEU A;  1ZUU A;  3TU4 K;  2LM0 A;  3RV1 A;  4E47 A;  3MP6 A;  3I35 A;  1ZBX A;  1BB9 A;  4GLK A;  2RQR A;  3CCS Q;  2QEX T;  1YJ9 A;  3LW5 E;  1YHQ A;  4M4Z A;  2MCN A;  1UG1 A;  4X9D A;  2PUK B;  1IZ6 A;  1I8F A;  2CZ1 B;  2YL5 A;  1WXU A;  1VQ8 T;  4JZ3 A;  3JCM X;  4XK8 E;  4R5L A;  5FWB A;  1TQS A;  1YI2 A;  1HWW A;  1YJW A;  2CH4 W;  1BI0 A;  3UF4 A;  3CZN A;  1ZSZ C;  2DFU A;  1TSF A;  3HAH A;  1WHK A;  3DB3 A;  4JPB W;  3CXC S;  4KGX B;  2X4W A;  2YUP A;  4B9Q A;  2DXC A;  4M7D G;  2MPX C;  3DLM A;  2NUP B;  2RB6 A;  2J05 A;  3LWH A;  2RQU A;  2K5F A;  3SDZ A;  1OQK A;  2DL7 A;  2KBT A;  3CME T;  2MI7 A;  3BUD A;  1YP5 A;  2ECZ A;  3WVE B;  1VQ7 A;  2P0K A;  3M0Q A;  1N6A A;  2EQI A;  2PVG B;  4JDS A;  1OI1 A;  2I0N A;  2QXL A;  2K57 A;  3UPU A;  3CC2 Q;  3X24 B;  1FMW A;  2RF0 A;  1URU A;  2F2W A;  1GNL A;  2VB6 A;  4EZP A;  2D9T A;  5LJ5 j;  1UPX A;  3DX1 A;  4M77 A;  2I2L A;  4EZR A;  3MEV A;  5I2M A;  3M0P A;  1YIT Q;  3M9Q A;  3ME9 A;  3QXE B;  4ATO A;  4FZP A;  1G2B A;  2D4C A;  2RJF A;  2VV5 A;  1SPK A;  4J5Y A;  2LC4 A;  2ATC B;  3X26 B;  1W1F A;  4XU2 A;  2LCC A;  1TQU A;  5CKF A;  2IG0 A;  5GMK h;  1AWJ A;  2BE7 D;  2LQ8 A;  2RHX A;  3VV0 A;  3DPO A;  1WI7 A;  3G1J A;  3H41 A;  3V8L A;  3O5Z A;  4HVW A;  1DKZ A;  1RAF B;  4F16 A;  3L2Z A;  1SHG A;  5GJW B;  1VQL Q;  2RJE A;  3A1P A;  3CD6 T;  2EGC A;  4OMM A;  4A4G A;  1T3S A;  1H64 1;  1UEC A;  9ATC B;  1K8A R;  1G3W A;  4C8Q F;  2GTO A;  3NTK A;  2RK1 A;  1WLP B;  3GIB A;  1PS3 A;  1VQO Q;  3BDL A;  2WIN M;  4J8O A;  3SEM A;  3ABH A;  5TKY A;  4F01 A;  3T47 A;  2QTX A;  1OX8 A;  4ZGD B;  1M90 C;  4BDY A;  1HSQ A;  4LDX A;  5GAN 8;  2D6F A;  5DM7 R;  2LJ0 A;  5EC7 A;  2DJQ A;  3UA6 A;  3EAE A;  4IUT A;  3UA7 A;  5GAN 5;  3WVD B;  1SSF A;  4M7D C;  4E7I A;  3ZL7 C;  2OTJ T;  4KGV B;  2IIM A;  2OW6 A;  3FIF A;  1OOT A;  4LN2 A;  3ER8 C;  1OPK A;  2O01 E;  1IXD A;  4XTV A;  4BB7 A;  4R0K A;  3QWX X;  3CXC A;  2YLB A;  3H6Z A;  4Y28 E;  1PM3 A;  2QYZ A;  2L89 A;  5GMK l;  4MZT A;  4M7A C;  1B3Q A;  1R8O B;  4DQ2 A;  5FRN A;  2B86 A;  4PJM A;  4LDW A;  4UDX X;  3RER A;  3PT9 A;  5DLQ E;  3OYN A;  3I56 T;  4ZTF A;  1D09 B;  1U3O A;  1K73 U;  3RV0 A;  3EG9 B;  4M7A G;  1Q82 C;  1KJW A;  4PJO F;  5CO7 A;  4FYW B;  1MND A;  4AVM A;  4MZP A;  4M7D D;  4BNE A;  3CCU Q;  1RL2 A;  4PJJ A;  1XNI A;  3MPU B;  2X4X A;  3CCV Q;  4C8Q A;  2KSS A;  5GAN j;  4HR1 A;  2IPO B;  2JTE A;  4M75 B;  2CP0 A;  3EHR A;  4RTV A;  2LX9 A;  2GF7 A;  1K8A C;  1YJN Q;  1ZUK A;  1Q7Y R;  1I07 A;  3OW2 P;  1HTY A;  2O2O A;  2M0O A;  1MMG A;  2LQN A;  2OAU A;  2RI3 A;  3GBQ A;  3L2V A;  1MMA A;  4BY6 B;  4LE9 A;  4OF1 A;  2ABL A;  3D2E A;  2XID A;  5C0M A;  4OMN A;  4AZ6 A;  2EW3 A;  1RAC B;  4H6H A;  2YWW A;  4JRK A;  1M30 A;  3S6W A;  4AZH A;  5KE2 A;  5GAO q;  1I81 A;  2D0N A;  3KDR A;  1VQK Q;  2LRQ A;  1I4K 1;  1BYM A;  3M0U A;  2DBM A;  3M0S A;  2ZPG B;  4PJO D;  1S1N A;  5GMK j;  1S72 Q;  2F7R A;  1KHI A;  2JUF A;  1M2V B;  1AD5 A;  3JCM h;  4O5V A;  4BE1 A;  3R6N A;  2DYI A;  2WSC E;  4M75 F;  3M3W A;  1VQK A;  3MCA B;  3P8B B;  1UEB A;  2DK3 A;  2ELB A;  2MOX A;  3DKM A;  3VS3 A;  1X6B A;  2CS7 A;  2BTT A;  3KAV A;  3QSU A;  3L3P A;  2KYM A;  1QCN A;  2K5I A;  4FSS A;  4PFZ A;  1N8R U;  1M1G A;  1ARK A;  3HRU A;  1WJQ A;  1AWX A;  4EZO A;  4EZV A;  1M8M A;  4E7K A;  1I5L A;  3OY9 A;  4M75 C;  4RG2 A;  1I5O B;  3BE3 A;  2GCX A;  4EPC A;  1W6X A;  1VQM A;  3DDG A;  3JCM b;  2NUP A;  4BE0 A;  2YL8 A;  1UJY A;  4R5K A;  5CKE A;  1ABQ A;  1BI1 A;  4WTO B;  2QDY B;  4J6Y A;  3CCE A;  3G4S Q;  5KYY B;  1JU5 C;  4IKF A;  5FU6 C;  3TSZ A;  4HKE A;  2P4T A;  3SWN C;  3OMG A;  2L2P A;  3VS5 A;  4JJB A;  3CCU A;  4D8K A;  3VRY A;  1WYX A;  3DX4 A;  1JJ2 S;  3ASK A;  3SWN A;  5LJ3 g;  5A0L A;  1OU8 A;  1M2O A;  2E1H A;  3QWE A;  3OK8 A;  3I39 X;  5GAO l;  4K11 A;  3I55 T;  2FRY A;  3BUQ A;  3CCQ A;  3RUX A;  2HBP A;  2DBK A;  3RMS A;  3QNI A;  4ZNX A;  2DZC A;  4BI3 A;  2DA9 A;  2XI9 A;  3KUF A;  2QDL A;  2PQW A;  4ANJ A;  3B53 X;  3A8O B;  3OYH A;  5KYN A;  2CH4 A;  3BLB A;  3JB9 G;  5FIG A;  3FDR A;  1QCF A;  2EBP A;  1JJ2 P;  1VQ9 A;  2JVV A;  4AFZ C;  4F7U B;  4OMQ A;  4BY6 C;  3NTI A;  2HKN A;  1PCX A;  1QWN A;  1ZBJ A;  2L8D A;  5GAN e;  1SEM A;  3LVT A;  2A7Y A;  4A54 A;  4AZI A;  3VS7 A;  2GBQ A;  1YWP A;  2KI7 A;  4J9F A;  4OB1 B;  3QA8 A;  3AT1 B;  1SU7 A;  2EKO A;  2NUT A;  2RI5 A;  4JWI A;  1OAO A;  1MHN A;  4M7A F;  1X75 C;  2NYS A;  3CC7 Q;  1Y57 A;  4E7Z A;  4A4H A;  5A0D A;  4IUP A;  1RAG B;  3DLL A;  2E70 A;  1F1B B;  3OS1 A;  1CKA A;  4NL2 A;  1Y0M A;  3OYM A;  2MWO A;  3M57 A;  2LDM A;  3EGU A;  2FYV A;  3I04 A;  3OYC A;  2CP7 A;  2PNI A;  3MP1 A;  2VXF A;  4RTY A;  2ZPH B;  2Q13 A;  1MV0 B;  2ZZD A;  2XDB A;  3TEE A;  4DA4 A;  2ND0 A;  2QI2 A;  1SG5 A;  2COY A;  2QAZ A;  4JLC A;  4CC2 A;  3O3M B;  4E81 A;  3LGL A;  3OBY A;  2F1A A;  1VQ5 Q;  1M5Q 1;  2AZV A;  1ZHI A;  4LXC A;  4JNF A;  5L23 A;  4RKU E;  2J6K A;  1PRL C;  3FJP A;  1M3C A;  3CC2 A;  4HXJ A;  5AT1 B;  1K9M C;  4O6J A;  4AT1 B;  2VXE A;  1W2B P;  4AZ7 A;  2AKL A;  1WA7 A;  4II1 A;  1VQ4 A;  5CK9 A;  4N4I A;  3SWN B;  3CCR A;  4LNP A;  4C8Q G;  2QGF B;  2LNH B;  4C92 C;  4EMK B;  4LD6 A;  3FB9 A;  1VQK T;  3LLR A;  4ELY C;  1TUG B;  2VVK A;  2X3W D;  2ED0 A;  1YBY A;  1FXX A;  4AZC A;  4FYV B;  1QCO A;  1E1D A;  2K5L A;  1VIE A;  4C92 E;  1RUW A;  2EQU A;  4M7A A;  4NQI A;  1WHL A;  2GGR A;  1M27 C;  1X04 A;  3JB9 H;  4AFQ C;  4A53 A;  3C7N A;  3VS1 A;  4KIK A;  4AG1 C;  2CT4 A;  2QA4 A;  2VKN A;  1DKY A;  2FPD A;  2XDP A;  4IW0 A;  4BI8 B;  1PC0 A;  4M78 D;  2RQW A;  2EJG A;  4C0G A;  1QLY A;  1RI0 A;  1SF9 A;  2DL4 A;  4ZN1 A;  3PIP A;  2LVM A;  1YJ9 Q;  3HFO A;  3JB9 D;  2EYW A;  2HMA A;  3RR6 A;  1UJ0 A;  2HKQ B;  4WPC A;  3RPM A;  4CI0 C;  3BDU A;  4EZS A;  3CKD A;  4FZS A;  1E2U A;  1QVP A;  2QQR A;  1LNX A;  5CQY A;  3CC4 T;  3O3O B;  3OBW A;  2L3Q A;  1YI2 T;  5C6S A;  1KG1 A;  4EMG A;  4J83 A;  2HQH A;  2OBL A;  1MGQ A;  1X6O A;  2HQE A;  3M4G A;  1OZ3 A;  2O4X A;  1QKX A;  1FYN A;  4IIO A;  1UUE A;  1YHQ T;  2KDS A;  2AHJ B;  3RBB B;  3I55 A;  3DYT A;  3I56 Q;  2XD0 A;  6AT1 B;  1VOM A;  4JJC A;  2YDL A;  4CRI A;  1VQ9 Q;  4QW2 A;  3QYG B;  1I49 A;  2OTJ A;  2F18 A;  4IWQ A;  2XDD A;  3CCU T;  2DMO A;  4XU0 A;  3VEA A;  2L3S A;  4C92 A;  3I5S A;  4N0A A;  3HAJ A;  3CCE T;  1EZZ B;  3DB4 A;  4AZB A;  5LJ3 d;  2O9S A;  4QKU A;  3REA B;  5C5B B;  2KQW A;  2AT1 B;  2LQW A;  1MV3 A;  2JM9 A;  2K9G A;  2R58 A;  3QZ9 B;  1BCO A;  1ZYL A;  2BUD A;  1KQS P;  1YIJ T;  5FRO A;  2DYB A;  2MYS A;  4JWD A;  1GCQ C;  2VUB A;  4B6M A;  1BIA A;  4M7A D;  1WJS A;  2O9V A;  1UGV A;  2JS0 A;  1H8K A;  3CME Q;  1SRL A;  4KH0 B;  3JB9 J;  1NEG A;  4EZU A;  1X6G A;  1N27 A;  1WQW A;  1ZSZ A;  2LX7 A;  1PWT A;  3OS5 A;  2EYX A;  2A0F B;  1VQM Q;  2PMR A;  3CD6 A;  1W70 A;  1JRI A;  2V8J A;  3T46 A;  4KUD K;  3B51 X;  1UGS B;  2R5A A;  4XU1 A;  5IT9 E;  3O8V A;  3OWG A;  3CPW A;  1G3Y A;  4QQG A;  1B07 A;  3NPF A;  4YTL A;  4C92 D;  2ED1 A;  2J6F A;  5FW9 A;  2YIB A;  3D51 A;  3VU3 C;  4F17 A;  2DXB A;  4R55 A;  1K4U S;  1I4L A;  2LMJ A;  4JLG A;  1D0Z A;  3L2Q A;  3CBO A;  4OMO A;  3G71 T;  4IWP A;  2YIA A;  1K1Z A;  3CV5 A;  3JCM g;  1Y2O A;  4PJO A;  2FZC B;  4C92 F;  4EDU A;  5FRM A;  5J39 A;  1SU6 A;  2DL5 A;  3EFR A;  2ROT A;  3M55 A;  3CBP A;  5LJ3 h;  1WDX A;  4M78 E;  5FU7 B;  3MHX A;  1D1C A;  2E10 A;  3H0F A;  2KRS A;  2N3K A;  3H0I A;  4ME7 A;  1Q95 G;  1C6V X;  1SSH A;  3B52 X;  5GAM d;  4PFO A;  1SKU B;  2JNG A;  4N0A C;  1KIK A;  4C0D C;  1BK2 A;  2FHD A;  5A0G A;  4UC4 A;  2EKH A;  4XTW A;  4OMF B;  2RHU A;  5A2Q E;  4AKV A;  2WYH A;  4FYY B;  2VAS A;  1GXI E;  4HA8 A;  4PK4 A;  2HL3 A;  2CDT A;  1UGQ B;  4HVV A;  4OB0 B;  1YIJ A;  3RMQ A;  2DM1 A;  2DVE A;  4PKC C;  5DLO A;  1QMC A;  4FL6 A;  4A63 B;  3GNF B;  1VQ8 A;  5GJV B;  1NBE B;  2V8K A;  1MNE A;  4C5E A;  4R5G A;  1V1C A;  3CCJ A;  3OQ5 A;  3T49 A;  1Y71 A;  1KD1 U;  2X9H A;  2GA9 D;  4N4G A;  2EFL A;  1Q86 R;  1H3Z A;  1RAI B;  3KFV A;  1QX1 A;  5E84 A;  2C0I A;  4ZTJ A;  4C8Q E;  4M75 D;  2DO3 A;  1X27 A;  3JCM d;  1HD3 A;  1GL5 A;  1K9M U;  2DZ9 A;  3I9Q A;  1PRM C;  1C1A A;  3CBM A;  4EZX A;  2DTO A;  4IUQ A;  1Y96 A;  2RO0 A;  3CCS T;  2ZAE A;  4PNO A;  2K79 A;  4KIK B;  1KSW A;  4IM2 A;  2EJF A;  3JCM P;  5GAM g;  1IB8 A;  3CCJ Q;  1KC8 R;  4ORZ A;  1K8A U;  3JCM f;  2LJ3 A;  2C06 A;  2Y4X A;  1VQ8 Q;  4R56 A;  1KD1 R;  3G9G A;  2FO0 A;  1NG2 A;  1NPR A;  5LJ5 f;  1QWF A;  1ABO A;  3QYH B;  4KT0 E;  4J6X A;  4LD9 K;  4RG8 A;  2X3X A;  4IIM A;  5ECA A;  1UHF A;  3JCM c;  5GMK m;  2V0O A;  1XOV A;  1O7D B;  1EIF A;  4HYB A;  3RES A;  4RTU A;  2HBW A;  4E6R A;  2J06 A;  3KBG A;  2COW A;  2ND1 A;  1TS9 A;  3MEW A;  2CSQ A;  4DEY A;  1M8V A;  2EIF A;  2CSI A;  3X20 B;  1YJN T;  3HAI A;  3BVX A;  3PGG A;  2YRV A;  4GBQ A;  4M78 A;  1KQ1 A;  1RAB B;  2DF6 A;  2RMO A;  4J9H A;  4NOY A;  1QVG S;  2FYK A;  3E1S A;  2OO2 A;  4IM0 A;  3EGX B;  3BY7 A;  2Y90 A;  3HP9 A;  2E41 A;  1PSE A;  3E2U A;  2M16 A;  2FL7 A;  2JMA A;  1ZA2 B;  1IO6 A;  3QDR B;  4L5G A;  3A8G B;  3G71 A;  2CP2 A;  4KUI A;  2Z0V A;  3QG1 A;  4C0F A;  4XTX A;  4LDV A;  1UFF A;  3CCR T;  3JSC A;  1VYT A;  1WFW A;  5KYW B;  1VQ4 T;  1RLP C;  1X2K A;  2NUZ A;  2W0Z A;  3OW2 A;  3NGP A;  1ZSZ B;  1UE9 A;  4EZZ A;  2RPN A;  4E7J A;  2LXY A;  2YUQ A;  5AYF A;  3GOX A;  2QXF A;  3EJP A;  1WJR A;  2EGE A;  1OV3 A;  3HPW A;  1EFN A;  3UDC A;  4HCC A;  4M77 B;  4JWE A;  2RT6 A;  4DBQ A;  2FPE A;  4A4K A;  2JNK A;  1I0C A;  4DBF A;  4JS4 A;  1O7D C;  1G8X A;  2D1L A;  3L3O M;  3PFS A;  3EG1 A;  1OEB A;  3VS2 A;  3EG3 A;  4LDY A;  5LJ5 g;  5KCH A;  4RTZ A;  2K7A A;  4XAX B;  3EJR A;  2ZXQ A;  1M90 U;  5I11 A;  3D4Z A;  4IUU A;  3EG0 A;  4HT9 A;  4H6I A;  1BI2 A;  2OAW A;  4NPH A;  3CXC P;  3M4Y A;  2ENM A;  4FT2 A;  1SU8 A;  4KGZ B;  5GAN f;  3G4S T;  2L3P A;  3FD9 A;  3MO8 A;  2CRE A;  2QQ9 A;  2E12 A;  3HFN A;  3ER0 A;  1LJO A;  5KYW A;  5IHN A;  4OB3 B;  1TXQ A;  1D0Y A;  2RHZ A;  2KNB B;  4PJL A;  1BIB A;  1JXM A;  2NLU A;  3TCJ A;  4EMK C;  1LQ7 A;  2CUD A;  2K3X A;  3L42 A;  1WPY A;  2JNS A;  1ZUY A;  3D4Y A;  3SHW A;  2Q12 A;  3DPQ A;  2P4R A;  2A37 A;  1Q82 R;  2GNC A;  4I1Q A;  3BVV A;  1GNT A;  1D1B A;  1BU1 A;  1KQS S;  4ELZ C;  3G7Z A;  1ZA1 B;  4UDY X;  2Z0W A;  4L59 A;  2BKD N;  4IUV A;  1LVK A;  1N9R A;  2HAX A;  4MMK A;  1HXK A;  1OA1 A;  2X4J A;  5GAM f;  2E6N A;  4M77 C;  1D3B B;  3VJP A;  1WXT A;  1T0J A;  5LJ3 e;  3F70 A;  2G3R A;  5FU7 C;  3NHN A;  2LCL A;  5GMK e;  3LLL A;  2YL6 A;  4ESR A;  3UWN A;  2FB7 A;  1RI9 A;  3IQL A;  2L3R A;  4C92 G;  4E7H A;  3OHX M;  2FG0 A;  2BZ8 A;  1KQ2 A;  1E6H A;  3QWY A;  2CKK A;  1RAE B;  4L6V 5;  4WPE A;  4IUR A;  4OGE A;  1T3L A;  2VWF A;  3M59 A;  4D8D A;  2DL8 A;  4DCN C;  1BKB A;  2QA4 Q;  4PLL A;  5KYX B;  5IHK A;  4DOW A;  4FZO A;  3ULR B;  1YN8 A;  1GFC A;  3OS0 A;  2DPP B;  4AZ5 A;  2KY9 A;  3J7A F;  2OX7 A;  2QQB A;  3EJT A;  1SUF A;  1JBM A;  3JAM E;  3QII A;  1Q82 U;  1ZX6 A;  2E3H A;  4M7A E;  2RK2 A;  1N8R R;  3RKW A;  1XJW B;  3I2W A;  3M54 A;  5IXB A;  3CCR Q;  3LX7 A;  2QQS A;  1K9A A;  1U5S A;  1IRX A;  1M1K R;  4PO2 A;  1K76 A;  3ZEH A;  2VGN A;  2DRM A;  2C08 A;  2LCS A;  2P84 A;  2L0A A;  4F7U F;  3EJS A;  1VQL T;  4HY9 A;  4J9E A;  2KXC A;  1VYV A;  2H8H A;  1VQ5 A;  2DL3 A;  4C92 B;  5IHI A;  5D6W A;  1VQ6 A;  1VQO T;  1B34 A;  2EFK A;  4OMP A;  1W2B S;  2FIC A;  4XTY A;  1WQ7 A;  1R0C B;  1WZO A;  1SRM A;  5J26 A;  4ZGE B;  2QTV A;  4J7F A;  4LUE A;  3VYH B;  3PVQ A;  2FZK B;  4HCB A;  4E2F B;  1BBZ A;  3CEY A;  4EZY A;  3GF5 A;  1GRI A;  1NLP C;  1ZWW A;  1FMK A;  2RJC A;  3S3O A;  1Q7Y C;  3CC4 Q;  5GAO p;  4CC3 A;  3CC7 A;  4BAC A;  4R5J A;  3QE6 A;  2V26 A;  3S3N A;  5GAN 3;  2QAS A;  4PFP A;  2DXU A;  3CAZ A;  2EJ9 A;  4F04 B;  5GAM h;  2D8H A;  1I1J A;  3OYY A;  3NFC A;  1HJD A;  4J9C A;  2EYY A;  1U8R A;  1QVF A;  1Q7Y U;  3QJY A;  2PY6 A;  4FW1 A;  1U06 A;  2ZPF B;  1HXD A;  3G6E A;  2KAF A;  2LTO A;  4C8Q B;  3A98 A;  4WCI A;  3OA6 A;  3CCL A;  4HVU A;  1NPP A;  2DTH A;  2E3I A;  4FM3 A;  4KUL A;  3INZ A;  4EZW A;  1G3S A;  4KH1 B;  1FWZ A;  4FT4 A;  2OW7 A;  4AFU C;  1RAD B;  1YWO A;  1IGQ A;  5CAI A;  1VQP Q;  2JS2 A;  4FIB A;  4C5H A;  1KC8 C;  2RM4 A;  5KE3 A;  2CZ6 B;  2JM8 A;  4J9B A;  4DEX A;  2WSE E;  3OYE A;  2RHI A;  3HRT A;  2Y4Y A;  2RH2 A;  3N5B B;  1E9V A;  3H8Z A;  3NTH A;  2XIC A;  5KCO A;  4RMO A;  3OB9 A; 
#chains in the Genus database with same CATH homology
 1AZE A;  1W9M A;  1NYF A;  3LMF A;  5I22 A;  2KRO A;  2EKH A;  2HEQ A;  4HR1 A;  2KR3 A;  1LCK A;  2JTE A;  3T4A G;  2K3B A;  3EHR A;  2YUN A;  1PHT A;  4RTV A;  4EZN A;  4R5I A;  4IWO A;  1ZUK A;  1I07 A;  2CDT A;  2AZS A;  4HVV A;  2O2O A;  2LQN A;  2DM1 A;  1U00 A;  3FJ5 A;  3GBQ A;  2AKK A;  1Z9Q A;  2DVJ A;  1UHC A;  3NMZ C;  2DNU A;  4A63 B;  2JW4 A;  4LE9 A;  3GI7 A;  2ABL A;  1N5Z A;  1NEB A;  5GJV B;  3D2E A;  3EG2 A;  1MJG A;  1JXO A;  4IM3 A;  4OMN A;  2YI9 A;  3LH5 A;  4R5G A;  1V1C A;  2EW3 A;  1Z9Z A;  4H6H A;  3VS4 A;  2C0T A;  1M30 A;  1GBR A;  3T49 A;  2E5K A;  3U23 A;  1E6G A;  2D0N A;  2GA9 D;  3KDR A;  2K6D A;  3KFV A;  5E84 A;  2C0I A;  2SEM A;  1X43 A;  2YSQ A;  1JQK A;  1X27 A;  3M0U A;  2DBM A;  3M0S A;  1HD3 A;  1S1N A;  1GL5 A;  2RQV A;  2W10 A;  1PRM C;  3I9Q A;  1AD5 A;  4EZX A;  3RNJ A;  3R6N A;  4EIK A;  3EHQ A;  3KAW A;  4KIK B;  2K79 A;  2FPF A;  1WXB A;  2MOX A;  1KSW A;  4IM2 A;  1CSK A;  1RLQ C;  1X6B A;  3VS3 A;  3H0H A;  4ORZ A;  2BTT A;  3THK A;  4AFS C;  2LJ3 A;  3KAV A;  2EVR A;  2KYM A;  2Z8Y A;  4FSS A;  1X2Q A;  2FO0 A;  1NG2 A;  1ARK A;  1H3H A;  1K0X A;  1AWX A;  4EZO A;  1QWF A;  1ABO A;  4EZV A;  1PNJ A;  1M8M A;  1YNZ A;  4IIM A;  2KEA A;  5ECA A;  1UHF A;  1XOV A;  1AWW A;  4HYB A;  4RTU A;  2HBW A;  1JQQ A;  4D8J A;  1NYG A;  1T0H A;  1W6X A;  4E6R A;  2J06 A;  1UJY A;  4R5K A;  1ABQ A;  4GLM A;  3PVL A;  2ND1 A;  1TG0 A;  2HDA A;  1JU5 C;  2CSQ A;  4DEY A;  3TSZ A;  2J6O A;  2BZY A;  4JZ4 A;  2YI8 A;  2X3X D;  2CSI A;  4E3C A;  1GFD A;  4EZT A;  2F2V A;  1VA7 A;  2L2P A;  3VS5 A;  3VS6 A;  4JJB A;  4D8K A;  3ER9 B;  3VRY A;  3F7W A;  1G83 A;  1WYX A;  4GBQ A;  2DF6 A;  2RMO A;  4J9H A;  4IM0 A;  2V1Q A;  2XMF A;  2DIL A;  2EYZ A;  4KRT A;  3I39 X;  2KT8 A;  4K11 A;  1TUC A;  2KXD A;  2FRY A;  2RN8 A;  2JMA A;  1IO6 A;  2X5C A;  2OI3 A;  2DBK A;  3TVT A;  4ZNX A;  2DRK A;  2DA9 A;  2MIO A;  2QDL A;  4Y92 A;  2ROL A;  3B53 X;  1UFF A;  4G6Q A;  1K0S A;  2CH4 A;  2V1R A;  1VYT A;  1WFW A;  2K2M A;  2HSP A;  5FIG A;  1RLP C;  1X2K A;  2NUZ A;  2W0Z A;  3NGP A;  1QCF A;  2GQI A;  2PTK A;  2EBP A;  1UE9 A;  4EZZ A;  2JXB A;  2RPN A;  4AFZ C;  4F00 A;  2LZ6 B;  4OMQ A;  4Z88 A;  2YUQ A;  1TUD A;  1YCS B;  1UTI A;  4JWC A;  1ZBJ A;  1SEM A;  1PKS A;  1ZLM A;  2EGE A;  2CT3 A;  1OV3 A;  2G6F X;  1EFN A;  2GBQ A;  3VS7 A;  1YWP A;  1GCP A;  4J9F A;  3QA8 A;  1SU7 A;  2M0Y A;  4JWE A;  2EX3 B;  2RT6 A;  2A36 A;  4RTT A;  2FPE A;  2O88 A;  2CUB A;  1I0C A;  3M0T A;  4JWI A;  3VEB A;  1OAO A;  3L3O M;  2LP5 A;  4RUG A;  3EG1 A;  2QFF A;  1OEB A;  1VYU A;  3VS2 A;  3REB B;  2KHO A;  2YIV X;  3EG3 A;  1NM7 A;  1Y57 A;  4RTZ A;  2K7A A;  2RQT A;  1H92 A;  2FRW A;  4RTX A;  5I11 A;  1CKA A;  1AOJ A;  1WX6 A;  3EG0 A;  2GTJ A;  4H6I A;  1Y0M A;  2OAW A;  2AK5 A;  4CC4 B;  4NPH A;  3ZED A;  2ENM A;  1ZSG A;  3I01 A;  3I04 A;  3EGU A;  1SU8 A;  2L3P A;  2PNI A;  3FD9 A;  2NWM A;  1PKT A;  5IXF A;  2CRE A;  3UIT A;  4RTY A;  2A28 A;  1MV0 B;  5IHN A;  2SRC A;  2GAF D;  2KNB B;  1GCQ A;  2ND0 A;  1AVZ C;  1JXM A;  1NLO C;  1GN9 A;  2KE9 A;  4JLC A;  4CC2 A;  3O3M B;  4E81 A;  2CUD A;  2F2X A;  2NCZ A;  2AZV A;  2JNS A;  1ZUY A;  3CQT A;  4JNF A;  3SHW A;  4F14 A;  5L23 A;  3DPQ A;  1PRL C;  2J6K A;  2P4R A;  2A37 A;  3VS0 A;  2GNC A;  2OJ2 A;  2RNA A;  1M3C A;  1GNT A;  4HXJ A;  4HCK A;  1BU1 A;  1OPL A;  2KRM A;  2AKL A;  1WA7 A;  4J9I A;  3QNJ A;  3T48 A;  2FEI A;  2D1X A;  4UDY X;  4QT7 A;  2DX1 A;  2EPD A;  3I5R A;  4JNE A;  4LNP A;  2LNH B;  4J9G A;  4RTW A;  1QKW A;  1A0N B;  2VVK A;  2X3W D;  2ED0 A;  2EWF A;  1OA1 A;  1JEG A;  3O3N B;  1E1D A;  2YUO A;  1WXT A;  2C0O A;  1ZUU A;  1T0J A;  1RUW A;  3NHN A;  2LM0 A;  3RV1 A;  2GGR A;  3I35 A;  1M27 C;  1BB9 A;  4AFQ C;  4JL9 A;  2RQR A;  4ESR A;  3C7N A;  4CC7 A;  3VS1 A;  4KIK A;  4AG1 C;  2CT4 A;  2YT6 A;  1RI9 A;  2VKN A;  3IQL A;  1DKY A;  4M4Z A;  2MCN A;  3OHX M;  2FG0 A;  2BZ8 A;  2FPD A;  1E6H A;  4IW0 A;  1UG1 A;  3QWY A;  4EZQ A;  2J7I A;  2KYB A;  1M3B A;  3ERC C;  2RQW A;  1QLY A;  1WXU A;  1CKB A;  1T3L A;  4JZ3 A;  2VWF A;  4D8D A;  2DL8 A;  1DKX A;  4R5L A;  2DL4 A;  5FWB A;  2CH4 W;  5IHK A;  1UDL A;  2EYW A;  4HR1 B;  1UJ0 A;  4Z8A A;  3UF4 A;  2A08 A;  3ULR B;  1YN8 A;  4X1V A;  2KRN A;  4EZS A;  1GFC A;  2O31 A;  4AG2 C;  1E2U A;  4JPB W;  2YUP A;  1SUF A;  4B9Q A;  1ZX6 A;  3O3O B;  2L3Q A;  2KT1 A;  2J05 A;  2OBL A;  4J9D A;  4JJD A;  3VRZ A;  1AEY A;  2RQU A;  5IH2 A;  2DL7 A;  2BZX A;  5FLE X;  2KBT A;  1YP5 A;  2ECZ A;  5IXB A;  3M0Q A;  3PE0 A;  2EQI A;  1QKX A;  1FYN A;  2LJ1 A;  1UUE A;  4IIO A;  1K9A A;  2I0N A;  1U5S A;  2QXL A;  2EGA A;  3C0C A;  4PO2 A;  1K76 A;  1M3A A;  3RBB B;  4OML A;  2RF0 A;  2DRM A;  2OBM A;  2LCS A;  2F2W A;  1GNL A;  2L0A A;  4JJC A;  2YDL A;  4EZP A;  4HY9 A;  3M0R A;  1UPX A;  4J9E A;  2KXC A;  1VYV A;  2H8H A;  4EZR A;  4IWQ A;  2DL3 A;  2JT4 A;  3M0P A;  1X69 A;  3JV3 A;  2D8J A;  5FWC A;  2DMO A;  5IHI A;  3VEA A;  2L3S A;  1G2B A;  4OMP A;  3I5S A;  1SPK A;  1SRM A;  1W1F A;  1MUZ A;  2O9S A;  3REA B;  1OA0 A;  1AWJ A;  4LUE A;  3PVQ A;  2LQW A;  1MV3 A;  3DPO A;  1WI7 A;  2JM9 A;  2K9G A;  3H41 A;  1BBZ A;  1KFZ A;  3O5Z A;  4HVW A;  1DKZ A;  4EZY A;  5HCK A;  4F16 A;  1GRI A;  1JO8 A;  1SHG A;  5GJW B;  1NLP C;  2EGC A;  1FMK A;  4OMM A;  1T3S A;  1UEC A;  1ZYL A;  4CC3 A;  2GTO A;  2DYB A;  2ESW A;  4JWD A;  1GCQ C;  4M0M A;  4R5J A;  1WLP B;  3D2F A;  2DLP A;  4JN4 A;  2WIN M;  3SEM A;  2O9V A;  5TKY A;  1UGV A;  4F01 A;  3T47 A;  2JS0 A;  1H8K A;  1SRL A;  2D8H A;  2DE0 X;  2M51 A;  1I1J A;  1NEG A;  4EZU A;  1X6G A;  1HJD A;  1SHF A;  4J9C A;  2LX7 A;  2EYY A;  1PWT A;  1HSQ A;  2EYX A;  2PY6 A;  1U06 A;  2LJ0 A;  5EC7 A;  1W70 A;  2DJQ A;  2JMC A;  3UA6 A;  3DPP A;  3UA7 A;  3T46 A;  3B51 X;  3UAT A;  3VKH A;  2PZ1 A;  3A98 A;  3ZL7 C;  4WCI A;  4HVU A;  3OWG A;  2IIM A;  4FM3 A;  3TSW A;  4Z89 A;  1OOT A;  1B07 A;  4LN2 A;  3ER8 C;  4EZW A;  1OPK A;  3NPF A;  2ED1 A;  2J6F A;  5FW9 A;  2YIB A;  4R0K A;  3QWX X;  4F17 A;  1K4U S;  1WIE A;  4AFU C;  2LMJ A;  1YWO A;  2KGT A;  1B3Q A;  4OMO A;  4IWP A;  2YIA A;  1K1Z A;  2JS2 A;  2B86 A;  1AZG B;  4UDX X;  1SU6 A;  2DL5 A;  2ROT A;  2JM8 A;  4J9B A;  1E7O A;  4LUD A;  1U3O A;  1WDX A;  4DEX A;  3RV0 A;  1QWE A;  3H0F A;  2KRS A;  2N3K A;  3H0I A;  1KJW A;  1AWO A;  1E9V A;  1SSH A;  3B52 X;  1J3T A;  1GBQ A;  2HCK A;  1KIK A;  1BK2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...