4FZPA

Crystal structure of the uranyl binding protein complexed with uranyl
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
81
structure length
81
Chain Sequence
NALDCRERIEKDLEDLEKELMEMKSIKLSDDEEAVVERALNYRDDSVYYLEKGDHITSFGCITYAEGLTDSLRMLHRIIEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uranyl binding protein
publication title A protein engineered to bind uranyl selectively and with femtomolar affinity.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Unknown function
total genus 36
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04010 DUF357 Protein of unknown function (DUF357)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.90 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 AF1782-like 4fzpA00
4AZ5A 2YL9A 4AZ7A 2OO2A 2YL8A 4AZCA 4AZIA 2YLAA 3RPMA 2YLLA 4AZ6A 4AZHA 2PMRA 2YL5A 2OZNB 2YL6A 2JNKA 4AZGA 4AZCB 4FZPA 4AZBA 4FZOA
chains in the Genus database with same CATH superfamily
1I4DA 2YI8A 1GN9A 4AZ7A 2WINM 3DDGA 2V0OA 2JNSA 1QX1A 2YIVX 2N3KA 2YI9A 4EZOA 3M3WA 3EJTA 3KDRA 3PLTA 4AKVA 3T4AG 4EZUA 3B52X 1ZWWA 3CZNA 3DYTA 4HR1A 4JNFA 3BUPA 1DKXA 4NQIA 4IM2A 3L3PA 1LQ7A 3A98A 3CAZA 3C7NA 4R5KA 1UPXA 3UITA 3DX3A 2Q13A 2NCZA 1TQTA 4EZRA 1TQUA 4IM3A 3Q84A 2WYIA 2YKTA 4IM0A 3VKHA 3F7WA 3DX0A 3RV1A 4AZGA 3OWGA 4F00A 4JWIA 1R34A 3I39X 3O3OB 1ZYLA 2MI7A 3EJQA 4EZYA 3BUBA 1OA0A 1I4TA 4KIKB 3ERCC 4UDXX 2ZXQA 3BVTA 3EJUA 1TQWA 4EZXA 2GA9D 2Z8YA 4NSWA 1I49A 4HYBA 3D4ZA 4NPHA 3LVTA 5E84A 3D50A 2KHOA 4WPCA 1WDZA 3KAVA 4IWPA 2PY6A 2RAIA 2FICA 1SUFA 4E3CA 5C5BB 1PS3A 4FZSA 1OAOA 3T46A 4R5GA 2OW7A 2Z0NA 4I1QA 3DX1A 1GNTA 3BUIA 3I04A 2ND0A 4JL9A 3D52A 1SU7A 3LMFA 4D8JA 2YL9A 5FLEX 3SOGA 1O7DC 1TQSA 2F1AA 2LXYA 4G6QA 3QWEA 3RV0A 2FYVA 2QKWA 3T48A 3BVWA 4IW0A 1HWWA 3T47A 3CKDA 4UDYX 4AZ5A 3VEBA 3CV5A 3L3OM 1X03A 2F7OA 1E1DA 3BUQA 3B53X 4EZQA 4ATMA 3O3NB 1E9VA 3Q0KA 1O7DB 5KBPA 1HTYA 1QWUA 1X04A 2Z0OA 3O3MB 3DX4A 3I01A 3VEAA 4AZ6A 1URUA 4EZTA 2X5CA 2YL5A 3ACOA 3ER8C 4JNEA 3HAJA 4F01A 1JQKA 3BVUA 3BVVA 4H6IA 4AZCA 4M0MA 3BVXA 4JLCA 4BNEA 3FD9A 1GNLA 2F7QA 3B51X 3T49A 3DX2A 4IWOA 4FM3A 1HXKA 3LLLA 2JNKA 2EFLA 1Y2OA 3G9GA 4H8SA 2PMRA 2GF4A 5C5BA 3CVRA 4JWDA 4EZNA 2X3WA 1R33A 4AZHA 1R5EA 1SU8A 2C08A 2QFFA 3ABHA 4FZPA 2D4CA 4AZBA 2WYHA 2F7PA 1YWMA 3QNIA 3KAWA 4AVMA 1DKZA 3HAHA 3D51A 2F18A 2ELBA 4B9QA 2X3VA 1MJGA 2OZNB 2Q12A 3D4YA 4FZOA 3EJSA 4HR1B 3BUDA 3SYVA 3BLBA 3DPPA 2OW6A 2ALWA 2D1LA 1QWNA 3GI7A 4JWCA 1U00A 2YIBA 4EZSA 3OK8A 1DKYA 1I4LA 4PO2A 2YIAA 3OHXM 2EWFA 4IWQA 5FIGA 2LM0A 3I2WA 3QA8A 2RT6A 1SU6A 4R5JA 4E81A 2QXLA 2RAJA 4R5IA 3D2EA 4DCNC 3ZEDA 4DYLA 2X3XA 2F1BA 4KIKA 5TKYA 4JWEA 2OO2A 2Z0VA 4EZVA 2YLAA 1TQVA 3HAIA 3CZSA 3QNJA 3DDFA 2OBLA 4AZCB 4H6HA 3DPOA 3DPQA 2YL8A 3EJPA 4AZIA 4WPEA 4EZPA 4JN4A 3D2FA 1E2UA 2ND1A 3RPMA 4EZZA 2YLLA 2OBMA 4EZWA 4HY9A 2F7RA 2YL6A 3QE6A 2EX3B 1OA1A 2RAKA 2O0I1 3ER9B 4R5LA 3EJRA 2EFKA 2GAFD 1W9MA
chains in the Genus database with same CATH topology
4AZ5A 2YL9A 4AZ7A 2OO2A 2YL8A 4AZCA 4AZIA 2YLAA 3RPMA 2YLLA 4AZ6A 4AZHA 2PMRA 2YL5A 2OZNB 2YL6A 2JNKA 4AZGA 4AZCB 4FZPA 4AZBA 4FZOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AZ5 A;  2YL9 A;  4AZ7 A;  2OO2 A;  2YL8 A;  4AZC A;  4AZI A;  2YLA A;  3RPM A;  2YLL A;  4AZ6 A;  4AZH A;  2PMR A;  2YL5 A;  2OZN B;  2YL6 A;  2JNK A;  4AZG A;  4AZC B;  4FZP A;  4AZB A;  4FZO A; 
#chains in the Genus database with same CATH topology
 1I4D A;  2YI8 A;  1GN9 A;  4AZ7 A;  2WIN M;  3DDG A;  2V0O A;  2JNS A;  1QX1 A;  2YIV X;  2N3K A;  2YI9 A;  4EZO A;  3M3W A;  3EJT A;  3KDR A;  3PLT A;  4AKV A;  3T4A G;  4EZU A;  3B52 X;  1ZWW A;  3CZN A;  3DYT A;  4HR1 A;  4JNF A;  3BUP A;  1DKX A;  4NQI A;  4IM2 A;  3L3P A;  1LQ7 A;  3A98 A;  3CAZ A;  3C7N A;  4R5K A;  1UPX A;  3UIT A;  3DX3 A;  2Q13 A;  2NCZ A;  1TQT A;  4EZR A;  1TQU A;  4IM3 A;  3Q84 A;  2WYI A;  2YKT A;  4IM0 A;  3VKH A;  3F7W A;  3DX0 A;  3RV1 A;  4AZG A;  3OWG A;  4F00 A;  4JWI A;  1R34 A;  3I39 X;  3O3O B;  1ZYL A;  2MI7 A;  3EJQ A;  4EZY A;  3BUB A;  1OA0 A;  1I4T A;  4KIK B;  3ERC C;  4UDX X;  2ZXQ A;  3BVT A;  3EJU A;  1TQW A;  4EZX A;  2GA9 D;  2Z8Y A;  4NSW A;  1I49 A;  4HYB A;  3D4Z A;  4NPH A;  3LVT A;  5E84 A;  3D50 A;  2KHO A;  4WPC A;  1WDZ A;  3KAV A;  4IWP A;  2PY6 A;  2RAI A;  2FIC A;  1SUF A;  4E3C A;  5C5B B;  1PS3 A;  4FZS A;  1OAO A;  3T46 A;  4R5G A;  2OW7 A;  2Z0N A;  4I1Q A;  3DX1 A;  1GNT A;  3BUI A;  3I04 A;  2ND0 A;  4JL9 A;  3D52 A;  1SU7 A;  3LMF A;  4D8J A;  2YL9 A;  5FLE X;  3SOG A;  1O7D C;  1TQS A;  2F1A A;  2LXY A;  4G6Q A;  3QWE A;  3RV0 A;  2FYV A;  2QKW A;  3T48 A;  3BVW A;  4IW0 A;  1HWW A;  3T47 A;  3CKD A;  4UDY X;  4AZ5 A;  3VEB A;  3CV5 A;  3L3O M;  1X03 A;  2F7O A;  1E1D A;  3BUQ A;  3B53 X;  4EZQ A;  4ATM A;  3O3N B;  1E9V A;  3Q0K A;  1O7D B;  5KBP A;  1HTY A;  1QWU A;  1X04 A;  2Z0O A;  3O3M B;  3DX4 A;  3I01 A;  3VEA A;  4AZ6 A;  1URU A;  4EZT A;  2X5C A;  2YL5 A;  3ACO A;  3ER8 C;  4JNE A;  3HAJ A;  4F01 A;  1JQK A;  3BVU A;  3BVV A;  4H6I A;  4AZC A;  4M0M A;  3BVX A;  4JLC A;  4BNE A;  3FD9 A;  1GNL A;  2F7Q A;  3B51 X;  3T49 A;  3DX2 A;  4IWO A;  4FM3 A;  1HXK A;  3LLL A;  2JNK A;  2EFL A;  1Y2O A;  3G9G A;  4H8S A;  2PMR A;  2GF4 A;  5C5B A;  3CVR A;  4JWD A;  4EZN A;  2X3W A;  1R33 A;  4AZH A;  1R5E A;  1SU8 A;  2C08 A;  2QFF A;  3ABH A;  4FZP A;  2D4C A;  4AZB A;  2WYH A;  2F7P A;  1YWM A;  3QNI A;  3KAW A;  4AVM A;  1DKZ A;  3HAH A;  3D51 A;  2F18 A;  2ELB A;  4B9Q A;  2X3V A;  1MJG A;  2OZN B;  2Q12 A;  3D4Y A;  4FZO A;  3EJS A;  4HR1 B;  3BUD A;  3SYV A;  3BLB A;  3DPP A;  2OW6 A;  2ALW A;  2D1L A;  1QWN A;  3GI7 A;  4JWC A;  1U00 A;  2YIB A;  4EZS A;  3OK8 A;  1DKY A;  1I4L A;  4PO2 A;  2YIA A;  3OHX M;  2EWF A;  4IWQ A;  5FIG A;  2LM0 A;  3I2W A;  3QA8 A;  2RT6 A;  1SU6 A;  4R5J A;  4E81 A;  2QXL A;  2RAJ A;  4R5I A;  3D2E A;  4DCN C;  3ZED A;  4DYL A;  2X3X A;  2F1B A;  4KIK A;  5TKY A;  4JWE A;  2OO2 A;  2Z0V A;  4EZV A;  2YLA A;  1TQV A;  3HAI A;  3CZS A;  3QNJ A;  3DDF A;  2OBL A;  4AZC B;  4H6H A;  3DPO A;  3DPQ A;  2YL8 A;  3EJP A;  4AZI A;  4WPE A;  4EZP A;  4JN4 A;  3D2F A;  1E2U A;  2ND1 A;  3RPM A;  4EZZ A;  2YLL A;  2OBM A;  4EZW A;  4HY9 A;  2F7R A;  2YL6 A;  3QE6 A;  2EX3 B;  1OA1 A;  2RAK A;  2O0I 1;  3ER9 B;  4R5L A;  3EJR A;  2EFK A;  2GAF D;  1W9M A; 
#chains in the Genus database with same CATH homology
 4AZ5 A;  2YL9 A;  4AZ7 A;  2OO2 A;  2YL8 A;  4AZC A;  4AZI A;  2YLA A;  3RPM A;  2YLL A;  4AZ6 A;  4AZH A;  2PMR A;  2YL5 A;  2OZN B;  2YL6 A;  2JNK A;  4AZG A;  4AZC B;  4FZP A;  4AZB A;  4FZO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...