4FZPA

Crystal structure of the uranyl binding protein complexed with uranyl
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
81
structure length
81
Chain Sequence
NALDCRERIEKDLEDLEKELMEMKSIKLSDDEEAVVERALNYRDDSVYYLEKGDHITSFGCITYAEGLTDSLRMLHRIIEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords uranyl binding protein
publication title A protein engineered to bind uranyl selectively and with femtomolar affinity.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
total genus 36
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04010 DUF357 Protein of unknown function (DUF357)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.90 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 AF1782-like 4fzpA00
4FZPA 2YLLA 4AZ6A 4AZ7A 2YLAA 4AZGA 4AZHA 3RPMA 2JNKA 2PMRA 4AZCB 2YL6A 4AZCA 2OZNB 4AZ5A 2YL9A 4AZBA 4AZIA 2YL5A 2OO2A 2YL8A 4FZOA
chains in the Genus database with same CATH superfamily
4H6HA 2F7RA 3BVUA 1HTYA 3CZNA 4DYLA 4IM0A 1I4LA 2GAFD 4NSWA 3D52A 3D50A 2O0I1 3KAWA 2X3WA 4ATMA 3ZEDA 4HY9A 1X03A 2PY6A 3BVTA 4IWQA 1OA1A 3T46A 3FD9A 4F01A 2YL9A 1YWMA 1W9MA 3D2EA 2F18A 2ALWA 2X3XA 3I01A 4JL9A 1X04A 2WYHA 3I2WA 4AZ6A 3RV0A 2ELBA 2ND0A 4JWIA 3D4YA 4EZUA 3D4ZA 1DKYA 2GF4A 2YL5A 3SYVA 4WPCA 3QA8A 4EZVA 4G6QA 4FZOA 1URUA 3B52X 2D1LA 3B53X 3BVXA 4IW0A 3ACOA 1O7DB 1TQWA 4F00A 3BVVA 1SUFA 3BVWA 2WINM 3I39X 1QWNA 4I1QA 2Z0VA 2ZXQA 4EZOA 1HWWA 1ZWWA 2D4CA 4EZTA 2F7QA 4AZ5A 4R5JA 2GA9D 3Q0KA 2FICA 4R5IA 4JLCA 2FYVA 2Q13A 2Z8YA 1E1DA 3T47A 5FIGA 2QFFA 4H8SA 1TQSA 1I49A 2OW6A 3O3NB 3CAZA 2OZNB 1PS3A 3BUBA 4EZYA 2F7PA 3VKHA 1JQKA 1TQUA 3C7NA 4M0MA 1WDZA 4FZPA 3RV1A 3O3MB 1SU6A 4R5KA 3DX3A 3L3PA 4WPEA 2WYIA 3DPOA 2KHOA 2ND1A 2F1AA 3B51X 2MI7A 3DDFA 2Z0NA 1E2UA 3L3OM 1R33A 1DKZA 3BUDA 3DX1A 1I4DA 2EWFA 3QNIA 3UITA 2YKTA 2X3VA 3DX2A 2PMRA 3VEBA 1SU7A 1LQ7A 4EZNA 4EZPA 3DPQA 2LM0A 3EJUA 5E84A 1TQVA 4NQIA 1UPXA 2OBLA 4HYBA 4AZGA 4IM3A 3DPPA 3EJPA 5FLEX 3LLLA 3BUQA 3ERCC 2F7OA 3D2FA 3QWEA 2N3KA 3LVTA 4R5GA 3KAVA 4EZXA 3DX4A 4AKVA 2Z0OA 1ZYLA 3GI7A 2LXYA 4JNFA 3Q84A 3CKDA 3EJQA 4JNEA 1GN9A 3HAJA 1R5EA 3KDRA 2EX3B 3T48A 3HAHA 4IM2A 1O7DC 4UDYX 3BUPA 1Y2OA 4H6IA 4D8JA 4E81A 4R5LA 3CZSA 3QNJA 4IWOA 1U00A 2RAKA 2QKWA 4AZCA 3PLTA 4HR1A 1I4TA 4E3CA 3A98A 1GNLA 2X5CA 4JWEA 3OWGA 4DCNC 3LMFA 4AVMA 3OK8A 2YI9A 3ER8C 3RPMA 4AZCB 3M3WA 4JWCA 1MJGA 5TKYA 4HR1B 4PO2A 1QWUA 3EJSA 3EJRA 4AZBA 2YIBA 4BNEA 3D51A 1SU8A 3BLBA 2RAJA 4JN4A 4EZRA 4AZ7A 4AZHA 2JNKA 3F7WA 2OW7A 3EJTA 2YL6A 1OAOA 4IWPA 3T49A 4B9QA 3OHXM 2YI8A 3HAIA 3QE6A 3SOGA 3T4AG 2NCZA 2YLLA 4EZQA 4KIKA 2OBMA 1OA0A 3BUIA 1DKXA 2C08A 3G9GA 4JWDA 1R34A 2EFKA 4AZIA 1TQTA 4KIKB 4UDXX 5C5BA 4NPHA 2YLAA 1GNTA 1E9VA 3CV5A 4FZSA 3ABHA 4EZZA 3CVRA 1HXKA 4EZWA 3O3OB 2JNSA 4EZSA 2QXLA 3DYTA 5C5BB 2V0OA 3DX0A 3DDGA 2YIAA 3I04A 2EFLA 2YIVX 3VEAA 2Q12A 2RT6A 3ER9B 1QX1A 2F1BA 5KBPA 2OO2A 2YL8A 2RAIA 4FM3A
chains in the Genus database with same CATH topology
4FZPA 2YLLA 4AZ6A 4AZ7A 2YLAA 4AZGA 4AZHA 3RPMA 2JNKA 2PMRA 4AZCB 2YL6A 4AZCA 2OZNB 4AZ5A 2YL9A 4AZBA 4AZIA 2YL5A 2OO2A 2YL8A 4FZOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FZP A;  2YLL A;  4AZ6 A;  4AZ7 A;  2YLA A;  4AZG A;  4AZH A;  3RPM A;  2JNK A;  2PMR A;  4AZC B;  2YL6 A;  4AZC A;  2OZN B;  4AZ5 A;  2YL9 A;  4AZB A;  4AZI A;  2YL5 A;  2OO2 A;  2YL8 A;  4FZO A; 
#chains in the Genus database with same CATH topology
 4H6H A;  2F7R A;  3BVU A;  1HTY A;  3CZN A;  4DYL A;  4IM0 A;  1I4L A;  2GAF D;  4NSW A;  3D52 A;  3D50 A;  2O0I 1;  3KAW A;  2X3W A;  4ATM A;  3ZED A;  4HY9 A;  1X03 A;  2PY6 A;  3BVT A;  4IWQ A;  1OA1 A;  3T46 A;  3FD9 A;  4F01 A;  2YL9 A;  1YWM A;  1W9M A;  3D2E A;  2F18 A;  2ALW A;  2X3X A;  3I01 A;  4JL9 A;  1X04 A;  2WYH A;  3I2W A;  4AZ6 A;  3RV0 A;  2ELB A;  2ND0 A;  4JWI A;  3D4Y A;  4EZU A;  3D4Z A;  1DKY A;  2GF4 A;  2YL5 A;  3SYV A;  4WPC A;  3QA8 A;  4EZV A;  4G6Q A;  4FZO A;  1URU A;  3B52 X;  2D1L A;  3B53 X;  3BVX A;  4IW0 A;  3ACO A;  1O7D B;  1TQW A;  4F00 A;  3BVV A;  1SUF A;  3BVW A;  2WIN M;  3I39 X;  1QWN A;  4I1Q A;  2Z0V A;  2ZXQ A;  4EZO A;  1HWW A;  1ZWW A;  2D4C A;  4EZT A;  2F7Q A;  4AZ5 A;  4R5J A;  2GA9 D;  3Q0K A;  2FIC A;  4R5I A;  4JLC A;  2FYV A;  2Q13 A;  2Z8Y A;  1E1D A;  3T47 A;  5FIG A;  2QFF A;  4H8S A;  1TQS A;  1I49 A;  2OW6 A;  3O3N B;  3CAZ A;  2OZN B;  1PS3 A;  3BUB A;  4EZY A;  2F7P A;  3VKH A;  1JQK A;  1TQU A;  3C7N A;  4M0M A;  1WDZ A;  4FZP A;  3RV1 A;  3O3M B;  1SU6 A;  4R5K A;  3DX3 A;  3L3P A;  4WPE A;  2WYI A;  3DPO A;  2KHO A;  2ND1 A;  2F1A A;  3B51 X;  2MI7 A;  3DDF A;  2Z0N A;  1E2U A;  3L3O M;  1R33 A;  1DKZ A;  3BUD A;  3DX1 A;  1I4D A;  2EWF A;  3QNI A;  3UIT A;  2YKT A;  2X3V A;  3DX2 A;  2PMR A;  3VEB A;  1SU7 A;  1LQ7 A;  4EZN A;  4EZP A;  3DPQ A;  2LM0 A;  3EJU A;  5E84 A;  1TQV A;  4NQI A;  1UPX A;  2OBL A;  4HYB A;  4AZG A;  4IM3 A;  3DPP A;  3EJP A;  5FLE X;  3LLL A;  3BUQ A;  3ERC C;  2F7O A;  3D2F A;  3QWE A;  2N3K A;  3LVT A;  4R5G A;  3KAV A;  4EZX A;  3DX4 A;  4AKV A;  2Z0O A;  1ZYL A;  3GI7 A;  2LXY A;  4JNF A;  3Q84 A;  3CKD A;  3EJQ A;  4JNE A;  1GN9 A;  3HAJ A;  1R5E A;  3KDR A;  2EX3 B;  3T48 A;  3HAH A;  4IM2 A;  1O7D C;  4UDY X;  3BUP A;  1Y2O A;  4H6I A;  4D8J A;  4E81 A;  4R5L A;  3CZS A;  3QNJ A;  4IWO A;  1U00 A;  2RAK A;  2QKW A;  4AZC A;  3PLT A;  4HR1 A;  1I4T A;  4E3C A;  3A98 A;  1GNL A;  2X5C A;  4JWE A;  3OWG A;  4DCN C;  3LMF A;  4AVM A;  3OK8 A;  2YI9 A;  3ER8 C;  3RPM A;  4AZC B;  3M3W A;  4JWC A;  1MJG A;  5TKY A;  4HR1 B;  4PO2 A;  1QWU A;  3EJS A;  3EJR A;  4AZB A;  2YIB A;  4BNE A;  3D51 A;  1SU8 A;  3BLB A;  2RAJ A;  4JN4 A;  4EZR A;  4AZ7 A;  4AZH A;  2JNK A;  3F7W A;  2OW7 A;  3EJT A;  2YL6 A;  1OAO A;  4IWP A;  3T49 A;  4B9Q A;  3OHX M;  2YI8 A;  3HAI A;  3QE6 A;  3SOG A;  3T4A G;  2NCZ A;  2YLL A;  4EZQ A;  4KIK A;  2OBM A;  1OA0 A;  3BUI A;  1DKX A;  2C08 A;  3G9G A;  4JWD A;  1R34 A;  2EFK A;  4AZI A;  1TQT A;  4KIK B;  4UDX X;  5C5B A;  4NPH A;  2YLA A;  1GNT A;  1E9V A;  3CV5 A;  4FZS A;  3ABH A;  4EZZ A;  3CVR A;  1HXK A;  4EZW A;  3O3O B;  2JNS A;  4EZS A;  2QXL A;  3DYT A;  5C5B B;  2V0O A;  3DX0 A;  3DDG A;  2YIA A;  3I04 A;  2EFL A;  2YIV X;  3VEA A;  2Q12 A;  2RT6 A;  3ER9 B;  1QX1 A;  2F1B A;  5KBP A;  2OO2 A;  2YL8 A;  2RAI A;  4FM3 A; 
#chains in the Genus database with same CATH homology
 4FZP A;  2YLL A;  4AZ6 A;  4AZ7 A;  2YLA A;  4AZG A;  4AZH A;  3RPM A;  2JNK A;  2PMR A;  4AZC B;  2YL6 A;  4AZC A;  2OZN B;  4AZ5 A;  2YL9 A;  4AZB A;  4AZI A;  2YL5 A;  2OO2 A;  2YL8 A;  4FZO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...