3T47A

Crystal structure of truncated form of staphylococcal complement inhibitor d (scin-d) at 1.3 angstrom
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
71
structure length
71
Chain Sequence
QHQALVDQLHELIANTDLNKLSYLNLDAFQKRDILAAHYIAKSAIRTKNLDQMTKAKQRLESIYNSISNPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords SCIN-D
publication title Diversity in the C3b Convertase Contact Residues and Tertiary Structures of the Staphylococcal Complement Inhibitor (SCIN) Protein Family.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 28
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3t47A00
4F01A 4F00A 4EZYA 4JNEA 4EZUA 4EZZA 3T47A 4R5LA 3QNJA 4R5GA 4PO2A 2QFFA 3DPPA 4EZNA 1DKXA 2KHOA 4EZVA 4R5IA 5TKYA 2QXLA 4R5KA 4H6IA 1DKZA 3C7NA 4HY9A 4JN4A 4JWCA 4JWIA 3T48A 4EZPA 4EZWA 4JWEA 1U00A 3DPQA 3T49A 4EZRA 4JNFA 3T46A 4EZXA 4HYBA 3T4AG 4EZQA 3D2EA 1DKYA 4H6HA 3OHXM 4JWDA 4EZOA 2WINM 4E81A 3DPOA 5E84A 3L3OM 4B9QA 4R5JA 4EZSA 4EZTA 3D2FA
chains in the Genus database with same CATH superfamily
2YL5A 4R5LA 3DPPA 4IWQA 1DKXA 3B52X 3I39X 2WYIA 4ATMA 1WDZA 3OWGA 3BUIA 4EZPA 3QWEA 3G9GA 1ZYLA 4AVMA 3CZSA 1DKYA 3FD9A 3OHXM 4JWDA 2EFKA 3UITA 5FIGA 4AZCB 1SU7A 2EX3B 3QE6A 2MI7A 3C7NA 4AZHA 4JWIA 3DPQA 3QNIA 4JNFA 3EJUA 2YIBA 3KDRA 3O3OB 4AKVA 5C5BA 3D2FA 3EJRA 2YLAA 1TQSA 4UDYX 3DDGA 3EJTA 2ZXQA 2F1BA 1YWMA 2JNSA 2YL8A 2RAJA 2ALWA 1ZWWA 4JLCA 2OW6A 3EJPA 4HR1B 2YL6A 2X3XA 3BUQA 3F7WA 4H6IA 2YIVX 2X3VA 1I4TA 1GNTA 4EZOA 3DPOA 3L3OM 2OW7A 4FZOA 3HAJA 3KAWA 4I1QA 2RAIA 4JN4A 1I4LA 1X03A 3BUPA 4M0MA 4NQIA 4H8SA 3A98A 3ER8C 2D1LA 1SU6A 3DX4A 3LMFA 1OAOA 2YI8A 4AZCA 1O7DB 4IM2A 2PMRA 2RT6A 1GNLA 1TQTA 4EZVA 2Z0OA 2OBLA 1TQVA 3EJQA 1HWWA 3Q84A 2F18A 4AZGA 3I01A 4EZRA 2F7PA 3T46A 1QWUA 3T4AG 4B9QA 1E1DA 4KIKA 5FLEX 1PS3A 2Z0NA 4NSWA 4UDXX 3QA8A 3D50A 4AZIA 3BVTA 1W9MA 1HXKA 3B53X 3D52A 4IM3A 2WYHA 3DX1A 2QXLA 3ABHA 4JWEA 3PLTA 1TQWA 2FYVA 3EJSA 4E81A 2LM0A 1URUA 4F01A 4EZZA 3D4YA 3DX3A 4D8JA 1TQUA 2EFLA 1R34A 3RPMA 2C08A 4HY9A 2Z8YA 4EZXA 3KAVA 3RV1A 3O3NB 1Y2OA 3ER9B 3ZEDA 2RAKA 4EZYA 3VEBA 2GF4A 1OA1A 4FM3A 5TKYA 3OK8A 3M3WA 4G6QA 4EZWA 1LQ7A 1SUFA 3BLBA 4EZQA 1I4DA 2QKWA 2WINM 4IW0A 4AZ6A 5C5BB 4EZSA 3VEAA 3RV0A 1E9VA 3BVXA 4E3CA 4R5GA 3BVVA 4DCNC 3DYTA 2YI9A 4JWCA 1UPXA 2Z0VA 4FZPA 2OO2A 3D2EA 5E84A 4FZSA 2Q13A 2Q12A 2F7OA 4IM0A 2JNKA 3I2WA 3ACOA 3SYVA 1R5EA 3BUDA 3HAIA 3HAHA 4F00A 4DYLA 2F7QA 1OA0A 3QNJA 2FICA 1QWNA 1R33A 4AZBA 2V0OA 2YLLA 2OBMA 3LLLA 2X5CA 2F1AA 3LVTA 2F7RA 3CV5A 3L3PA 3DX0A 4HR1A 4NPHA 2KHOA 2NCZA 3Q0KA 4R5IA 5KBPA 2X3WA 3B51X 3T49A 3BVWA 1GN9A 4R5JA 3GI7A 4KIKB 1JQKA 4EZTA 2GAFD 2YIAA 3D51A 4JNEA 3ERCC 3T47A 3DX2A 2D4CA 2QFFA 4EZNA 2ND1A 2YKTA 1E2UA 2O0I1 4R5KA 4AZ5A 1DKZA 4JL9A 1X04A 3DDFA 3BVUA 4H6HA 2LXYA 3CVRA 2PY6A 2YL9A 4WPEA 3VKHA 1QX1A 2N3KA 3CAZA 3O3MB 4IWPA 1I49A 1HTYA 3BUBA 4BNEA 2OZNB 4EZUA 4PO2A 2GA9D 4AZ7A 3CKDA 3CZNA 2EWFA 2ND0A 4IWOA 4WPCA 3SOGA 3T48A 1U00A 3D4ZA 2ELBA 4HYBA 1O7DC 3I04A 1SU8A 1MJGA
chains in the Genus database with same CATH topology
4EZYA 3VEBA 3KAWA 4R5LA 3DPPA 4IWQA 4HR1A 1DKXA 4NPHA 1OA1A 2KHOA 3B52X 2NCZA 3I39X 4FM3A 4R5IA 5TKYA 4JN4A 3OWGA 4G6QA 4EZPA 4EZWA 3B51X 3T49A 1SUFA 4M0MA 1ZYLA 1GN9A 4EZQA 3FD9A 1DKYA 3A98A 3OHXM 4JWDA 2WINM 3ER8C 4IW0A 4R5JA 3GI7A 4KIKB 3UITA 1JQKA 1SU6A 5FIGA 4EZTA 2GAFD 4EZSA 3LMFA 3RV0A 3VEAA 1E9VA 1OAOA 2YI8A 2YIAA 4JNEA 4E3CA 3ERCC 3T47A 4R5GA 2QFFA 4EZNA 1SU7A 2EX3B 2RT6A 4IM2A 2ND1A 1GNLA 4EZVA 1E2UA 2OBLA 4R5KA 1DKZA 4JL9A 2YI9A 3C7NA 4JWCA 4JWIA 1UPXA 3I01A 3DPQA 4EZRA 4JNFA 3T46A 3T4AG 3D2EA 4H6HA 5E84A 2PY6A 4B9QA 1E1DA 2YIBA 3KDRA 4KIKA 5FLEX 3O3OB 3D2FA 4UDXX 3QA8A 3VKHA 1W9MA 4IM0A 4UDYX 3B53X 4IM3A 2QXLA 2N3KA 4JWEA 4IWPA 3O3MB 2JNSA 4E81A 4JLCA 2LM0A 4F01A 4F00A 4EZUA 4EZZA 1OA0A 4PO2A 3QNJA 4D8JA 4HR1B 2GA9D 2EWFA 3F7WA 4H6IA 4HY9A 2ND0A 4IWOA 2Z8YA 3T48A 2YIVX 1U00A 4EZXA 3KAVA 1GNTA 4HYBA 3O3NB 3RV1A 3I04A 1SU8A 4EZOA 3DPOA 1MJGA 3L3OM 3ER9B 2OBMA 2X5CA 3ZEDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F01 A;  4F00 A;  4EZY A;  4JNE A;  4EZU A;  4EZZ A;  3T47 A;  4R5L A;  3QNJ A;  4R5G A;  4PO2 A;  2QFF A;  3DPP A;  4EZN A;  1DKX A;  2KHO A;  4EZV A;  4R5I A;  5TKY A;  2QXL A;  4R5K A;  4H6I A;  1DKZ A;  3C7N A;  4HY9 A;  4JN4 A;  4JWC A;  4JWI A;  3T48 A;  4EZP A;  4EZW A;  4JWE A;  1U00 A;  3DPQ A;  3T49 A;  4EZR A;  4JNF A;  3T46 A;  4EZX A;  4HYB A;  3T4A G;  4EZQ A;  3D2E A;  1DKY A;  4H6H A;  3OHX M;  4JWD A;  4EZO A;  2WIN M;  4E81 A;  3DPO A;  5E84 A;  3L3O M;  4B9Q A;  4R5J A;  4EZS A;  4EZT A;  3D2F A; 
#chains in the Genus database with same CATH topology
 2YL5 A;  4R5L A;  3DPP A;  4IWQ A;  1DKX A;  3B52 X;  3I39 X;  2WYI A;  4ATM A;  1WDZ A;  3OWG A;  3BUI A;  4EZP A;  3QWE A;  3G9G A;  1ZYL A;  4AVM A;  3CZS A;  1DKY A;  3FD9 A;  3OHX M;  4JWD A;  2EFK A;  3UIT A;  5FIG A;  4AZC B;  1SU7 A;  2EX3 B;  3QE6 A;  2MI7 A;  3C7N A;  4AZH A;  4JWI A;  3DPQ A;  3QNI A;  4JNF A;  3EJU A;  2YIB A;  3KDR A;  3O3O B;  4AKV A;  5C5B A;  3D2F A;  3EJR A;  2YLA A;  1TQS A;  4UDY X;  3DDG A;  3EJT A;  2ZXQ A;  2F1B A;  1YWM A;  2JNS A;  2YL8 A;  2RAJ A;  2ALW A;  1ZWW A;  4JLC A;  2OW6 A;  3EJP A;  4HR1 B;  2YL6 A;  2X3X A;  3BUQ A;  3F7W A;  4H6I A;  2YIV X;  2X3V A;  1I4T A;  1GNT A;  4EZO A;  3DPO A;  3L3O M;  2OW7 A;  4FZO A;  3HAJ A;  3KAW A;  4I1Q A;  2RAI A;  4JN4 A;  1I4L A;  1X03 A;  3BUP A;  4M0M A;  4NQI A;  4H8S A;  3A98 A;  3ER8 C;  2D1L A;  1SU6 A;  3DX4 A;  3LMF A;  1OAO A;  2YI8 A;  4AZC A;  1O7D B;  4IM2 A;  2PMR A;  2RT6 A;  1GNL A;  1TQT A;  4EZV A;  2Z0O A;  2OBL A;  1TQV A;  3EJQ A;  1HWW A;  3Q84 A;  2F18 A;  4AZG A;  3I01 A;  4EZR A;  2F7P A;  3T46 A;  1QWU A;  3T4A G;  4B9Q A;  1E1D A;  4KIK A;  5FLE X;  1PS3 A;  2Z0N A;  4NSW A;  4UDX X;  3QA8 A;  3D50 A;  4AZI A;  3BVT A;  1W9M A;  1HXK A;  3B53 X;  3D52 A;  4IM3 A;  2WYH A;  3DX1 A;  2QXL A;  3ABH A;  4JWE A;  3PLT A;  1TQW A;  2FYV A;  3EJS A;  4E81 A;  2LM0 A;  1URU A;  4F01 A;  4EZZ A;  3D4Y A;  3DX3 A;  4D8J A;  1TQU A;  2EFL A;  1R34 A;  3RPM A;  2C08 A;  4HY9 A;  2Z8Y A;  4EZX A;  3KAV A;  3RV1 A;  3O3N B;  1Y2O A;  3ER9 B;  3ZED A;  2RAK A;  4EZY A;  3VEB A;  2GF4 A;  1OA1 A;  4FM3 A;  5TKY A;  3OK8 A;  3M3W A;  4G6Q A;  4EZW A;  1LQ7 A;  1SUF A;  3BLB A;  4EZQ A;  1I4D A;  2QKW A;  2WIN M;  4IW0 A;  4AZ6 A;  5C5B B;  4EZS A;  3VEA A;  3RV0 A;  1E9V A;  3BVX A;  4E3C A;  4R5G A;  3BVV A;  4DCN C;  3DYT A;  2YI9 A;  4JWC A;  1UPX A;  2Z0V A;  4FZP A;  2OO2 A;  3D2E A;  5E84 A;  4FZS A;  2Q13 A;  2Q12 A;  2F7O A;  4IM0 A;  2JNK A;  3I2W A;  3ACO A;  3SYV A;  1R5E A;  3BUD A;  3HAI A;  3HAH A;  4F00 A;  4DYL A;  2F7Q A;  1OA0 A;  3QNJ A;  2FIC A;  1QWN A;  1R33 A;  4AZB A;  2V0O A;  2YLL A;  2OBM A;  3LLL A;  2X5C A;  2F1A A;  3LVT A;  2F7R A;  3CV5 A;  3L3P A;  3DX0 A;  4HR1 A;  4NPH A;  2KHO A;  2NCZ A;  3Q0K A;  4R5I A;  5KBP A;  2X3W A;  3B51 X;  3T49 A;  3BVW A;  1GN9 A;  4R5J A;  3GI7 A;  4KIK B;  1JQK A;  4EZT A;  2GAF D;  2YIA A;  3D51 A;  4JNE A;  3ERC C;  3T47 A;  3DX2 A;  2D4C A;  2QFF A;  4EZN A;  2ND1 A;  2YKT A;  1E2U A;  2O0I 1;  4R5K A;  4AZ5 A;  1DKZ A;  4JL9 A;  1X04 A;  3DDF A;  3BVU A;  4H6H A;  2LXY A;  3CVR A;  2PY6 A;  2YL9 A;  4WPE A;  3VKH A;  1QX1 A;  2N3K A;  3CAZ A;  3O3M B;  4IWP A;  1I49 A;  1HTY A;  3BUB A;  4BNE A;  2OZN B;  4EZU A;  4PO2 A;  2GA9 D;  4AZ7 A;  3CKD A;  3CZN A;  2EWF A;  2ND0 A;  4IWO A;  4WPC A;  3SOG A;  3T48 A;  1U00 A;  3D4Z A;  2ELB A;  4HYB A;  1O7D C;  3I04 A;  1SU8 A;  1MJG A; 
#chains in the Genus database with same CATH homology
 4EZY A;  3VEB A;  3KAW A;  4R5L A;  3DPP A;  4IWQ A;  4HR1 A;  1DKX A;  4NPH A;  1OA1 A;  2KHO A;  3B52 X;  2NCZ A;  3I39 X;  4FM3 A;  4R5I A;  5TKY A;  4JN4 A;  3OWG A;  4G6Q A;  4EZP A;  4EZW A;  3B51 X;  3T49 A;  1SUF A;  4M0M A;  1ZYL A;  1GN9 A;  4EZQ A;  3FD9 A;  1DKY A;  3A98 A;  3OHX M;  4JWD A;  2WIN M;  3ER8 C;  4IW0 A;  4R5J A;  3GI7 A;  4KIK B;  3UIT A;  1JQK A;  1SU6 A;  5FIG A;  4EZT A;  2GAF D;  4EZS A;  3LMF A;  3RV0 A;  3VEA A;  1E9V A;  1OAO A;  2YI8 A;  2YIA A;  4JNE A;  4E3C A;  3ERC C;  3T47 A;  4R5G A;  2QFF A;  4EZN A;  1SU7 A;  2EX3 B;  2RT6 A;  4IM2 A;  2ND1 A;  1GNL A;  4EZV A;  1E2U A;  2OBL A;  4R5K A;  1DKZ A;  4JL9 A;  2YI9 A;  3C7N A;  4JWC A;  4JWI A;  1UPX A;  3I01 A;  3DPQ A;  4EZR A;  4JNF A;  3T46 A;  3T4A G;  3D2E A;  4H6H A;  5E84 A;  2PY6 A;  4B9Q A;  1E1D A;  2YIB A;  3KDR A;  4KIK A;  5FLE X;  3O3O B;  3D2F A;  4UDX X;  3QA8 A;  3VKH A;  1W9M A;  4IM0 A;  4UDY X;  3B53 X;  4IM3 A;  2QXL A;  2N3K A;  4JWE A;  4IWP A;  3O3M B;  2JNS A;  4E81 A;  4JLC A;  2LM0 A;  4F01 A;  4F00 A;  4EZU A;  4EZZ A;  1OA0 A;  4PO2 A;  3QNJ A;  4D8J A;  4HR1 B;  2GA9 D;  2EWF A;  3F7W A;  4H6I A;  4HY9 A;  2ND0 A;  4IWO A;  2Z8Y A;  3T48 A;  2YIV X;  1U00 A;  4EZX A;  3KAV A;  1GNT A;  4HYB A;  3O3N B;  3RV1 A;  3I04 A;  1SU8 A;  4EZO A;  3DPO A;  1MJG A;  3L3O M;  3ER9 B;  2OBM A;  2X5C A;  3ZED A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...