3T47A

Crystal structure of truncated form of staphylococcal complement inhibitor d (scin-d) at 1.3 angstrom
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
71
structure length
71
Chain Sequence
QHQALVDQLHELIANTDLNKLSYLNLDAFQKRDILAAHYIAKSAIRTKNLDQMTKAKQRLESIYNSISNPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SCIN-D
publication title Diversity in the C3b Convertase Contact Residues and Tertiary Structures of the Staphylococcal Complement Inhibitor (SCIN) Protein Family.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Immune system
total genus 28
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3t47A00
4EZNA 4EZSA 3OHXM 4EZPA 3C7NA 1U00A 1DKXA 4JWCA 4R5LA 3T49A 4EZRA 3D2FA 3DPQA 4B9QA 2WINM 4JNFA 5TKYA 4EZXA 2QFFA 4JWDA 4PO2A 4F00A 4R5GA 1DKZA 3L3OM 4EZYA 4EZOA 3T48A 3DPOA 5E84A 3T4AG 4EZTA 4EZVA 4EZZA 4H6HA 4R5JA 4JWIA 4R5IA 4H6IA 3QNJA 2KHOA 4JN4A 3T47A 3D2EA 4R5KA 4E81A 4F01A 4EZWA 4JNEA 4HYBA 4HY9A 3T46A 4EZUA 2QXLA 1DKYA 4EZQA 4JWEA 3DPPA
chains in the Genus database with same CATH superfamily
2WYIA 3CKDA 1TQWA 2RT6A 2WINM 3EJPA 4KIKA 3D50A 2YIBA 2RAKA 2C08A 2Z0OA 3BUBA 4DYLA 2OW6A 4FZOA 1X04A 4EZSA 3QA8A 1DKXA 1LQ7A 1SU8A 2OZNB 2QFFA 4HR1B 2FICA 3OK8A 2F1AA 1TQTA 3I04A 1URUA 4IW0A 3EJQA 4E81A 2ALWA 3O3MB 4EZPA 1Y2OA 1ZWWA 4EZXA 2LXYA 3GI7A 2X3VA 4HR1A 4EZZA 3Q0KA 3D4YA 3QNIA 2PMRA 3ER8C 1DKYA 2YI9A 3L3PA 4AZHA 3CV5A 3BVTA 3EJSA 5TKYA 3BVXA 1W9MA 2NCZA 3ERCC 2YLAA 4NQIA 3DPOA 3D52A 2ELBA 3DYTA 3O3OB 4FZPA 1O7DB 4UDYX 3BUDA 4ATMA 1SUFA 3B52X 1U00A 2ND1A 3CAZA 2OW7A 3T48A 3EJTA 1PS3A 2YLLA 2Z0VA 3RV1A 4R5IA 3ER9B 5KBPA 3PLTA 3HAJA 4FM3A 4DCNC 2YL5A 4JWEA 3DX4A 3KAWA 3T49A 2LM0A 3DX3A 4B9QA 1OA1A 2F7PA 4JWDA 2PY6A 2F7QA 3SYVA 3CZNA 1JQKA 4H6IA 4D8JA 3BLBA 1SU7A 2YIVX 1HTYA 2Z0NA 1E9VA 2V0OA 3EJRA 1E2UA 3RPMA 2F7OA 2EFKA 4IWOA 4G6QA 3ABHA 2RAIA 2KHOA 2QKWA 3DX0A 3SOGA 2Q12A 3OHXM 4JWCA 1ZYLA 3QWEA 1UPXA 4IWPA 3BUPA 3DX1A 2WYHA 1DKZA 2YIAA 4IWQA 1SU6A 4EZVA 3EJUA 3LLLA 4BNEA 2EX3B 2OO2A 2YI8A 4EZNA 3UITA 2GA9D 1QWNA 3DPQA 2ZXQA 3ACOA 1I4TA 4F00A 3O3NB 4EZYA 3B51X 1R34A 3BVVA 4H6HA 3F7WA 2Q13A 4R5KA 1GNTA 3VEAA 4EZQA 2JNSA 1MJGA 1WDZA 3BVWA 3LMFA 4IM2A 3LVTA 4AZGA 3DDFA 3BUIA 4H8SA 2RAJA 1O7DC 4R5LA 4WPEA 4JNFA 3B53X 1I4DA 3VEBA 4FZSA 1QWUA 4EZTA 2ND0A 2D4CA 2X3XA 1OA0A 3DX2A 4AZBA 3KDRA 3QNJA 2YKTA 4JNEA 3KAVA 3M3WA 1HWWA 2MI7A 4R5JA 1I49A 3D2EA 2N3KA 3BUQA 2YL8A 2QXLA 4JN4A 3A98A 2F1BA 2OBMA 2JNKA 3D2FA 3OWGA 1GN9A 2F18A 4EZOA 2O0I1 1I4LA 4AZIA 4AZCB 3T47A 1X03A 1OAOA 3HAHA 3QE6A 4NPHA 2FYVA 4M0MA 2Z8YA 4WPCA 5C5BB 3I39X 1R5EA 3FD9A 2GAFD 3D51A 3D4ZA 1QX1A 3T4AG 1GNLA 4AKVA 4AZ5A 1TQUA 4AZCA 4F01A 3HAIA 4HYBA 4HY9A 3T46A 3I01A 3ZEDA 4EZUA 3CVRA 3DDGA 5FLEX 5C5BA 3I2WA 2OBLA 4PO2A 4R5GA 3CZSA 4E3CA 1YWMA 2D1LA 5E84A 2X5CA 4AVMA 4NSWA 3Q84A 4UDXX 4EZRA 1E1DA 3DPPA 2F7RA 3C7NA 1R33A 1TQSA 3G9GA 4IM0A 2EWFA 2X3WA 4JLCA 4KIKB 4AZ6A 5FIGA 4I1QA 3L3OM 4IM3A 4AZ7A 2YL6A 3RV0A 4JWIA 4JL9A 3BVUA 4EZWA 1HXKA 2EFLA 2YL9A 2GF4A 1TQVA 3VKHA
chains in the Genus database with same CATH topology
4EZNA 3A98A 2OBMA 3B52X 1U00A 3UITA 2GA9D 2ND1A 2RT6A 3D2FA 2WINM 3DPQA 3OWGA 1GN9A 4F00A 3O3NB 4KIKA 4EZYA 4EZOA 3B51X 3T48A 2YIBA 4H6HA 3F7WA 3RV1A 4R5IA 3ER9B 3T47A 4R5KA 1GNTA 3VEAA 1OAOA 4FM3A 4NPHA 4EZQA 4JWEA 4M0MA 2Z8YA 3QA8A 4EZSA 3KAWA 1DKXA 3T49A 2LM0A 2JNSA 4B9QA 1SU8A 3I39X 1OA1A 2QFFA 4JWDA 3FD9A 4HR1B 2GAFD 2PY6A 1MJGA 3T4AG 1GNLA 3LMFA 4IM2A 1JQKA 4H6IA 3I04A 4D8JA 4IW0A 1SU7A 4E81A 4F01A 4HYBA 4HY9A 3T46A 2YIVX 3I01A 3ZEDA 4EZUA 3O3MB 1E9VA 5FLEX 4EZPA 4R5LA 1E2UA 4JNFA 4EZXA 3B53X 2OBLA 4PO2A 3VEBA 4R5GA 3GI7A 4E3CA 4IWOA 4G6QA 4HR1A 3VKHA 5E84A 4EZTA 2ND0A 4EZZA 2X5CA 1OA0A 3KDRA 3QNJA 2KHOA 4JNEA 4UDXX 3ER8C 4EZRA 1DKYA 1E1DA 3DPPA 2YI9A 3OHXM 3C7NA 4JWCA 3KAVA 4IM0A 2EWFA 4JLCA 1ZYLA 5TKYA 1W9MA 4KIKB 1UPXA 2NCZA 4IWPA 5FIGA 1DKZA 2YIAA 3L3OM 3ERCC 3DPOA 1SU6A 4IWQA 4EZVA 4IM3A 3RV0A 4R5JA 4JWIA 3O3OB 4JL9A 3D2EA 2N3KA 4UDYX 4EZWA 2EX3B 2QXLA 1SUFA 4JN4A 2YI8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EZN A;  4EZS A;  3OHX M;  4EZP A;  3C7N A;  1U00 A;  1DKX A;  4JWC A;  4R5L A;  3T49 A;  4EZR A;  3D2F A;  3DPQ A;  4B9Q A;  2WIN M;  4JNF A;  5TKY A;  4EZX A;  2QFF A;  4JWD A;  4PO2 A;  4F00 A;  4R5G A;  1DKZ A;  3L3O M;  4EZY A;  4EZO A;  3T48 A;  3DPO A;  5E84 A;  3T4A G;  4EZT A;  4EZV A;  4EZZ A;  4H6H A;  4R5J A;  4JWI A;  4R5I A;  4H6I A;  3QNJ A;  2KHO A;  4JN4 A;  3T47 A;  3D2E A;  4R5K A;  4E81 A;  4F01 A;  4EZW A;  4JNE A;  4HYB A;  4HY9 A;  3T46 A;  4EZU A;  2QXL A;  1DKY A;  4EZQ A;  4JWE A;  3DPP A; 
#chains in the Genus database with same CATH topology
 2WYI A;  3CKD A;  1TQW A;  2RT6 A;  2WIN M;  3EJP A;  4KIK A;  3D50 A;  2YIB A;  2RAK A;  2C08 A;  2Z0O A;  3BUB A;  4DYL A;  2OW6 A;  4FZO A;  1X04 A;  4EZS A;  3QA8 A;  1DKX A;  1LQ7 A;  1SU8 A;  2OZN B;  2QFF A;  4HR1 B;  2FIC A;  3OK8 A;  2F1A A;  1TQT A;  3I04 A;  1URU A;  4IW0 A;  3EJQ A;  4E81 A;  2ALW A;  3O3M B;  4EZP A;  1Y2O A;  1ZWW A;  4EZX A;  2LXY A;  3GI7 A;  2X3V A;  4HR1 A;  4EZZ A;  3Q0K A;  3D4Y A;  3QNI A;  2PMR A;  3ER8 C;  1DKY A;  2YI9 A;  3L3P A;  4AZH A;  3CV5 A;  3BVT A;  3EJS A;  5TKY A;  3BVX A;  1W9M A;  2NCZ A;  3ERC C;  2YLA A;  4NQI A;  3DPO A;  3D52 A;  2ELB A;  3DYT A;  3O3O B;  4FZP A;  1O7D B;  4UDY X;  3BUD A;  4ATM A;  1SUF A;  3B52 X;  1U00 A;  2ND1 A;  3CAZ A;  2OW7 A;  3T48 A;  3EJT A;  1PS3 A;  2YLL A;  2Z0V A;  3RV1 A;  4R5I A;  3ER9 B;  5KBP A;  3PLT A;  3HAJ A;  4FM3 A;  4DCN C;  2YL5 A;  4JWE A;  3DX4 A;  3KAW A;  3T49 A;  2LM0 A;  3DX3 A;  4B9Q A;  1OA1 A;  2F7P A;  4JWD A;  2PY6 A;  2F7Q A;  3SYV A;  3CZN A;  1JQK A;  4H6I A;  4D8J A;  3BLB A;  1SU7 A;  2YIV X;  1HTY A;  2Z0N A;  1E9V A;  2V0O A;  3EJR A;  1E2U A;  3RPM A;  2F7O A;  2EFK A;  4IWO A;  4G6Q A;  3ABH A;  2RAI A;  2KHO A;  2QKW A;  3DX0 A;  3SOG A;  2Q12 A;  3OHX M;  4JWC A;  1ZYL A;  3QWE A;  1UPX A;  4IWP A;  3BUP A;  3DX1 A;  2WYH A;  1DKZ A;  2YIA A;  4IWQ A;  1SU6 A;  4EZV A;  3EJU A;  3LLL A;  4BNE A;  2EX3 B;  2OO2 A;  2YI8 A;  4EZN A;  3UIT A;  2GA9 D;  1QWN A;  3DPQ A;  2ZXQ A;  3ACO A;  1I4T A;  4F00 A;  3O3N B;  4EZY A;  3B51 X;  1R34 A;  3BVV A;  4H6H A;  3F7W A;  2Q13 A;  4R5K A;  1GNT A;  3VEA A;  4EZQ A;  2JNS A;  1MJG A;  1WDZ A;  3BVW A;  3LMF A;  4IM2 A;  3LVT A;  4AZG A;  3DDF A;  3BUI A;  4H8S A;  2RAJ A;  1O7D C;  4R5L A;  4WPE A;  4JNF A;  3B53 X;  1I4D A;  3VEB A;  4FZS A;  1QWU A;  4EZT A;  2ND0 A;  2D4C A;  2X3X A;  1OA0 A;  3DX2 A;  4AZB A;  3KDR A;  3QNJ A;  2YKT A;  4JNE A;  3KAV A;  3M3W A;  1HWW A;  2MI7 A;  4R5J A;  1I49 A;  3D2E A;  2N3K A;  3BUQ A;  2YL8 A;  2QXL A;  4JN4 A;  3A98 A;  2F1B A;  2OBM A;  2JNK A;  3D2F A;  3OWG A;  1GN9 A;  2F18 A;  4EZO A;  2O0I 1;  1I4L A;  4AZI A;  4AZC B;  3T47 A;  1X03 A;  1OAO A;  3HAH A;  3QE6 A;  4NPH A;  2FYV A;  4M0M A;  2Z8Y A;  4WPC A;  5C5B B;  3I39 X;  1R5E A;  3FD9 A;  2GAF D;  3D51 A;  3D4Z A;  1QX1 A;  3T4A G;  1GNL A;  4AKV A;  4AZ5 A;  1TQU A;  4AZC A;  4F01 A;  3HAI A;  4HYB A;  4HY9 A;  3T46 A;  3I01 A;  3ZED A;  4EZU A;  3CVR A;  3DDG A;  5FLE X;  5C5B A;  3I2W A;  2OBL A;  4PO2 A;  4R5G A;  3CZS A;  4E3C A;  1YWM A;  2D1L A;  5E84 A;  2X5C A;  4AVM A;  4NSW A;  3Q84 A;  4UDX X;  4EZR A;  1E1D A;  3DPP A;  2F7R A;  3C7N A;  1R33 A;  1TQS A;  3G9G A;  4IM0 A;  2EWF A;  2X3W A;  4JLC A;  4KIK B;  4AZ6 A;  5FIG A;  4I1Q A;  3L3O M;  4IM3 A;  4AZ7 A;  2YL6 A;  3RV0 A;  4JWI A;  4JL9 A;  3BVU A;  4EZW A;  1HXK A;  2EFL A;  2YL9 A;  2GF4 A;  1TQV A;  3VKH A; 
#chains in the Genus database with same CATH homology
 4EZN A;  3A98 A;  2OBM A;  3B52 X;  1U00 A;  3UIT A;  2GA9 D;  2ND1 A;  2RT6 A;  3D2F A;  2WIN M;  3DPQ A;  3OWG A;  1GN9 A;  4F00 A;  3O3N B;  4KIK A;  4EZY A;  4EZO A;  3B51 X;  3T48 A;  2YIB A;  4H6H A;  3F7W A;  3RV1 A;  4R5I A;  3ER9 B;  3T47 A;  4R5K A;  1GNT A;  3VEA A;  1OAO A;  4FM3 A;  4NPH A;  4EZQ A;  4JWE A;  4M0M A;  2Z8Y A;  3QA8 A;  4EZS A;  3KAW A;  1DKX A;  3T49 A;  2LM0 A;  2JNS A;  4B9Q A;  1SU8 A;  3I39 X;  1OA1 A;  2QFF A;  4JWD A;  3FD9 A;  4HR1 B;  2GAF D;  2PY6 A;  1MJG A;  3T4A G;  1GNL A;  3LMF A;  4IM2 A;  1JQK A;  4H6I A;  3I04 A;  4D8J A;  4IW0 A;  1SU7 A;  4E81 A;  4F01 A;  4HYB A;  4HY9 A;  3T46 A;  2YIV X;  3I01 A;  3ZED A;  4EZU A;  3O3M B;  1E9V A;  5FLE X;  4EZP A;  4R5L A;  1E2U A;  4JNF A;  4EZX A;  3B53 X;  2OBL A;  4PO2 A;  3VEB A;  4R5G A;  3GI7 A;  4E3C A;  4IWO A;  4G6Q A;  4HR1 A;  3VKH A;  5E84 A;  4EZT A;  2ND0 A;  4EZZ A;  2X5C A;  1OA0 A;  3KDR A;  3QNJ A;  2KHO A;  4JNE A;  4UDX X;  3ER8 C;  4EZR A;  1DKY A;  1E1D A;  3DPP A;  2YI9 A;  3OHX M;  3C7N A;  4JWC A;  3KAV A;  4IM0 A;  2EWF A;  4JLC A;  1ZYL A;  5TKY A;  1W9M A;  4KIK B;  1UPX A;  2NCZ A;  4IWP A;  5FIG A;  1DKZ A;  2YIA A;  3L3O M;  3ERC C;  3DPO A;  1SU6 A;  4IWQ A;  4EZV A;  4IM3 A;  3RV0 A;  4R5J A;  4JWI A;  3O3O B;  4JL9 A;  3D2E A;  2N3K A;  4UDY X;  4EZW A;  2EX3 B;  2QXL A;  1SUF A;  4JN4 A;  2YI8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...