2GF4A

Crystal structure of vng1086c from halobacterium salinarium (halobacterium halobium). northeast structural genomics target hsr14
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
89
structure length
89
Chain Sequence
MHKDELLELHEQMVNIKDQFLGFDHVDETAFAAYEELDVEPSHVHKSKSEHKHAVFLLGNALAAAMSEDEFSSAGRISKRMEELADDAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Protein Vng1086c
publication title Crystal structure of Vng1086c from Halobacterium salinarium (Halobacterium halobium). Northeast Structural Genomics Target HsR14
rcsb
source organism Halobacterium sp.
total genus 30
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01893 UPF0058 Uncharacterised protein family UPF0058
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.110 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Uncharacterised protein family UPF0058 2gf4A00
2GF4A
chains in the Genus database with same CATH superfamily
2YKTA 4EZPA 2GAFD 1TQWA 2YI8A 3LLLA 3D52A 3C7NA 4HR1A 4JWCA 1PS3A 2O0I1 4JNFA 3CKDA 4R5LA 1MJGA 1SU7A 3QE6A 3DX0A 4IWOA 3BVVA 3VEAA 2QFFA 3SOGA 4HR1B 3ABHA 2LXYA 4E3CA 4I1QA 4UDYX 2RAIA 2X3XA 2Q12A 3HAJA 3DX1A 1U00A 2F18A 3D50A 1O7DC 3D51A 3T48A 2WYIA 1ZWWA 4EZZA 2EWFA 3DDFA 4WPEA 2ND1A 3QA8A 3D2FA 4R5GA 2YI9A 2QXLA 3RV1A 3B53X 4IW0A 3FD9A 4M0MA 3D2EA 1I4LA 3I01A 4EZQA 3LMFA 4HY9A 2Z0VA 1HTYA 4EZNA 4ATMA 1OA1A 4NSWA 5FLEX 3ER9B 3Q0KA 4EZOA 3DX4A 4EZVA 3QNIA 4R5IA 3L3OM 1TQTA 3EJUA 1TQUA 3BVUA 4EZRA 4JWEA 1R5EA 2MI7A 2OO2A 3BUBA 4H8SA 4NQIA 4HYBA 3DX2A 2F1AA 3DPPA 3DX3A 1R33A 5KBPA 1HWWA 3VEBA 3ERCC 2RAKA 4EZTA 1DKZA 4IM3A 2YL6A 2JNKA 2LM0A 1TQSA 3ER8C 3D4YA 2YL9A 2F7QA 3UITA 3DYTA 4UDXX 3CZNA 1SUFA 3O3OB 2GA9D 2Z0OA 3CV5A 4F00A 3QWEA 2RT6A 3ACOA 1R34A 1E1DA 2EFLA 2C08A 2KHOA 2PY6A 2YIBA 4PO2A 4WPCA 1HXKA 2ND0A 3EJQA 3BUQA 4IM0A 2ELBA 2X5CA 3BUIA 1W9MA 2D1LA 4BNEA 2YIVX 3G9GA 3O3MB 4FZSA 3DPOA 3DDGA 2YLLA 2QKWA 3T4AG 2JNSA 4D8JA 4R5KA 4AZCA 1O7DB 4R5JA 1I4TA 1SU6A 4E81A 4H6IA 4DCNC 3EJRA 2F7RA 3L3PA 5E84A 5FIGA 3HAHA 4IWQA 1GN9A 4AZCB 2V0OA 3M3WA 2FICA 3KAVA 1I4DA 1QX1A 3CZSA 4AZ7A 1QWNA 2NCZA 1GNTA 2GF4A 4KIKA 2YL5A 3SYVA 5C5BA 4EZYA 3LVTA 4AZBA 3RPMA 4AZIA 1ZYLA 3O3NB 3BVTA 2D4CA 4G6QA 2Z8YA 4JN4A 4FZOA 4AKVA 3DPQA 4B9QA 2OBLA 3OHXM 4JWIA 4KIKB 3GI7A 5C5BB 4AZ5A 3EJPA 2OZNB 4EZSA 1E9VA 3BVXA 1DKXA 3D4ZA 4IWPA 3EJSA 4JL9A 3BVWA 3PLTA 1X04A 2WYHA 3RV0A 4AZHA 3KAWA 3I2WA 2ALWA 3I39X 3F7WA 2F7PA 2YIAA 3QNJA 1LQ7A 1Y2OA 2ZXQA 3OWGA 3T47A 2EX3B 1OAOA 2N3KA 1GNLA 3I04A 4AZ6A 1QWUA 4FZPA 3ZEDA 3B51X 4EZWA 1OA0A 4NPHA 2OW6A 3VKHA 1YWMA 1TQVA 3OK8A 2OBMA 1SU8A 3T49A 2YLAA 1WDZA 3BUPA 4JNEA 3A98A 4DYLA 2WINM 1E2UA 1UPXA 3B52X 2F1BA 2Q13A 1I49A 2F7OA 2X3WA 5TKYA 4AZGA 4EZXA 1X03A 3HAIA 4AVMA 4F01A 2RAJA 3Q84A 3CVRA 4H6HA 2X3VA 4FM3A 4JWDA 3T46A 2FYVA 2PMRA 3BUDA 2Z0NA 3KDRA 4JLCA 3BLBA 2EFKA 3CAZA 1DKYA 3EJTA 2OW7A 2YL8A 4IM2A 1JQKA 1URUA 4EZUA
chains in the Genus database with same CATH topology
2GF4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GF4 A; 
#chains in the Genus database with same CATH topology
 2YKT A;  4EZP A;  2GAF D;  1TQW A;  2YI8 A;  3LLL A;  3D52 A;  3C7N A;  4HR1 A;  4JWC A;  1PS3 A;  2O0I 1;  4JNF A;  3CKD A;  4R5L A;  1MJG A;  1SU7 A;  3QE6 A;  3DX0 A;  4IWO A;  3BVV A;  3VEA A;  2QFF A;  3SOG A;  4HR1 B;  3ABH A;  2LXY A;  4E3C A;  4I1Q A;  4UDY X;  2RAI A;  2X3X A;  2Q12 A;  3HAJ A;  3DX1 A;  1U00 A;  2F18 A;  3D50 A;  1O7D C;  3D51 A;  3T48 A;  2WYI A;  1ZWW A;  4EZZ A;  2EWF A;  3DDF A;  4WPE A;  2ND1 A;  3QA8 A;  3D2F A;  4R5G A;  2YI9 A;  2QXL A;  3RV1 A;  3B53 X;  4IW0 A;  3FD9 A;  4M0M A;  3D2E A;  1I4L A;  3I01 A;  4EZQ A;  3LMF A;  4HY9 A;  2Z0V A;  1HTY A;  4EZN A;  4ATM A;  1OA1 A;  4NSW A;  5FLE X;  3ER9 B;  3Q0K A;  4EZO A;  3DX4 A;  4EZV A;  3QNI A;  4R5I A;  3L3O M;  1TQT A;  3EJU A;  1TQU A;  3BVU A;  4EZR A;  4JWE A;  1R5E A;  2MI7 A;  2OO2 A;  3BUB A;  4H8S A;  4NQI A;  4HYB A;  3DX2 A;  2F1A A;  3DPP A;  3DX3 A;  1R33 A;  5KBP A;  1HWW A;  3VEB A;  3ERC C;  2RAK A;  4EZT A;  1DKZ A;  4IM3 A;  2YL6 A;  2JNK A;  2LM0 A;  1TQS A;  3ER8 C;  3D4Y A;  2YL9 A;  2F7Q A;  3UIT A;  3DYT A;  4UDX X;  3CZN A;  1SUF A;  3O3O B;  2GA9 D;  2Z0O A;  3CV5 A;  4F00 A;  3QWE A;  2RT6 A;  3ACO A;  1R34 A;  1E1D A;  2EFL A;  2C08 A;  2KHO A;  2PY6 A;  2YIB A;  4PO2 A;  4WPC A;  1HXK A;  2ND0 A;  3EJQ A;  3BUQ A;  4IM0 A;  2ELB A;  2X5C A;  3BUI A;  1W9M A;  2D1L A;  4BNE A;  2YIV X;  3G9G A;  3O3M B;  4FZS A;  3DPO A;  3DDG A;  2YLL A;  2QKW A;  3T4A G;  2JNS A;  4D8J A;  4R5K A;  4AZC A;  1O7D B;  4R5J A;  1I4T A;  1SU6 A;  4E81 A;  4H6I A;  4DCN C;  3EJR A;  2F7R A;  3L3P A;  5E84 A;  5FIG A;  3HAH A;  4IWQ A;  1GN9 A;  4AZC B;  2V0O A;  3M3W A;  2FIC A;  3KAV A;  1I4D A;  1QX1 A;  3CZS A;  4AZ7 A;  1QWN A;  2NCZ A;  1GNT A;  2GF4 A;  4KIK A;  2YL5 A;  3SYV A;  5C5B A;  4EZY A;  3LVT A;  4AZB A;  3RPM A;  4AZI A;  1ZYL A;  3O3N B;  3BVT A;  2D4C A;  4G6Q A;  2Z8Y A;  4JN4 A;  4FZO A;  4AKV A;  3DPQ A;  4B9Q A;  2OBL A;  3OHX M;  4JWI A;  4KIK B;  3GI7 A;  5C5B B;  4AZ5 A;  3EJP A;  2OZN B;  4EZS A;  1E9V A;  3BVX A;  1DKX A;  3D4Z A;  4IWP A;  3EJS A;  4JL9 A;  3BVW A;  3PLT A;  1X04 A;  2WYH A;  3RV0 A;  4AZH A;  3KAW A;  3I2W A;  2ALW A;  3I39 X;  3F7W A;  2F7P A;  2YIA A;  3QNJ A;  1LQ7 A;  1Y2O A;  2ZXQ A;  3OWG A;  3T47 A;  2EX3 B;  1OAO A;  2N3K A;  1GNL A;  3I04 A;  4AZ6 A;  1QWU A;  4FZP A;  3ZED A;  3B51 X;  4EZW A;  1OA0 A;  4NPH A;  2OW6 A;  3VKH A;  1YWM A;  1TQV A;  3OK8 A;  2OBM A;  1SU8 A;  3T49 A;  2YLA A;  1WDZ A;  3BUP A;  4JNE A;  3A98 A;  4DYL A;  2WIN M;  1E2U A;  1UPX A;  3B52 X;  2F1B A;  2Q13 A;  1I49 A;  2F7O A;  2X3W A;  5TKY A;  4AZG A;  4EZX A;  1X03 A;  3HAI A;  4AVM A;  4F01 A;  2RAJ A;  3Q84 A;  3CVR A;  4H6H A;  2X3V A;  4FM3 A;  4JWD A;  3T46 A;  2FYV A;  2PMR A;  3BUD A;  2Z0N A;  3KDR A;  4JLC A;  3BLB A;  2EFK A;  3CAZ A;  1DKY A;  3EJT A;  2OW7 A;  2YL8 A;  4IM2 A;  1JQK A;  1URU A;  4EZU A; 
#chains in the Genus database with same CATH homology
 2GF4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...