2GF4A

Crystal structure of vng1086c from halobacterium salinarium (halobacterium halobium). northeast structural genomics target hsr14
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
89
structure length
89
Chain Sequence
MHKDELLELHEQMVNIKDQFLGFDHVDETAFAAYEELDVEPSHVHKSKSEHKHAVFLLGNALAAAMSEDEFSSAGRISKRMEELADDAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein Vng1086c
publication title Crystal structure of Vng1086c from Halobacterium salinarium (Halobacterium halobium). Northeast Structural Genomics Target HsR14
rcsb
source organism Halobacterium sp.
molecule tags Structural genomics, unknown function
total genus 30
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01893 UPF0058 Uncharacterised protein family UPF0058
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.110 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Uncharacterised protein family UPF0058 2gf4A00
2GF4A
chains in the Genus database with same CATH superfamily
3QWEA 2V0OA 4AZBA 3F7WA 1JQKA 3ERCC 3M3WA 2KHOA 2C08A 4PO2A 2QFFA 3CAZA 3BUQA 3EJUA 3DDGA 2ELBA 3O3OB 3QNIA 3O3NB 2WYHA 1O7DB 3Q0KA 3BVUA 3CVRA 4M0MA 4EZQA 3KAWA 3L3OM 3LVTA 3DDFA 2LM0A 4UDXX 4IWQA 3DX2A 2RT6A 3O3MB 4BNEA 1R33A 2MI7A 3KDRA 4NSWA 2QXLA 1I4TA 3GI7A 1TQSA 2YI9A 4HYBA 1GNTA 4AZ7A 3ABHA 2F7QA 2ND0A 2RAIA 4KIKA 3BUBA 2JNKA 1SU6A 3BUPA 1E1DA 1QWUA 2EFKA 4DCNC 1E9VA 2ALWA 1O7DC 5FIGA 3BVXA 4JNEA 1YWMA 2YL5A 3HAJA 4AVMA 4IWOA 4DYLA 4AZCB 3DPQA 1GN9A 3EJTA 4JLCA 2EX3B 2EWFA 3ER9B 2WYIA 1GNLA 1TQVA 1LQ7A 3OK8A 4FM3A 1OA1A 1I4DA 1R5EA 3I04A 3DPOA 2F1BA 1R34A 1URUA 2YKTA 1SU7A 3PLTA 1HTYA 3BLBA 2OZNB 4JWCA 2PMRA 1DKYA 2WINM 3BUIA 4WPEA 3T49A 2N3KA 4R5LA 3T47A 3BUDA 2O0I1 4UDYX 2Z0VA 3ER8C 3D4YA 3FD9A 3QNJA 4R5GA 4JL9A 2PY6A 4H6HA 2FYVA 1DKZA 2Q13A 2F7RA 2ND1A 1SU8A 2GAFD 1DKXA 3LLLA 4H8SA 2RAKA 5TKYA 1W9MA 4EZYA 3EJQA 2YL6A 3T46A 4G6QA 4D8JA 4EZWA 4AZHA 3CV5A 3VKHA 2YL9A 3EJRA 4AZCA 4EZZA 3OHXM 4AZ6A 2X3VA 1TQUA 4H6IA 3OWGA 3CZSA 4IM3A 1I4LA 3B52X 2Z0NA 5E84A 2YI8A 3DYTA 3DPPA 2OO2A 4EZVA 3DX3A 3HAIA 3Q84A 3RPMA 4R5KA 3DX4A 3RV1A 1U00A 3T48A 4JWEA 4EZSA 3I39X 4EZTA 2F1AA 4R5IA 3QA8A 3RV0A 3T4AG 2YL8A 2X5CA 3BVVA 3VEAA 4IM0A 4HY9A 4EZRA 4HR1B 2JNSA 5C5BA 2Z8YA 1E2UA 2GA9D 4EZNA 4AZIA 4AKVA 3EJPA 2F7OA 3QE6A 2FICA 3BVWA 4E3CA 3D4ZA 1I49A 5FLEX 1TQWA 3B53X 4B9QA 2X3XA 2RAJA 3SYVA 4JNFA 2F18A 5C5BB 4WPCA 4NQIA 4EZUA 3ACOA 3D50A 3VEBA 3DX1A 2X3WA 3A98A 1PS3A 2D4CA 4F01A 2ZXQA 1HWWA 5KBPA 4FZSA 1QX1A 2OW7A 3HAHA 2EFLA 3CZNA 2OW6A 4EZXA 2OBLA 4IM2A 2YIAA 3UITA 3I2WA 4AZGA 4EZOA 2GF4A 1TQTA 4ATMA 4F00A 1ZWWA 1ZYLA 2Q12A 1QWNA 1OAOA 4FZOA 2Z0OA 4JWIA 4I1QA 2OBMA 2YLAA 2D1LA 3EJSA 4HR1A 4R5JA 2F7PA 1MJGA 2QKWA 3B51X 3D2EA 2YIVX 4JN4A 1OA0A 3G9GA 2YLLA 4JWDA 1WDZA 1HXKA 3KAVA 1Y2OA 3LMFA 3DX0A 3I01A 4AZ5A 3C7NA 4NPHA 4IWPA 3SOGA 4KIKB 3BVTA 1UPXA 4FZPA 1X04A 3D51A 4IW0A 2YIBA 3CKDA 1SUFA 1X03A 4E81A 3D2FA 3ZEDA 2NCZA 2LXYA 4EZPA 3D52A 3L3PA
chains in the Genus database with same CATH topology
2GF4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GF4 A; 
#chains in the Genus database with same CATH topology
 3QWE A;  2V0O A;  4AZB A;  3F7W A;  1JQK A;  3ERC C;  3M3W A;  2KHO A;  2C08 A;  4PO2 A;  2QFF A;  3CAZ A;  3BUQ A;  3EJU A;  3DDG A;  2ELB A;  3O3O B;  3QNI A;  3O3N B;  2WYH A;  1O7D B;  3Q0K A;  3BVU A;  3CVR A;  4M0M A;  4EZQ A;  3KAW A;  3L3O M;  3LVT A;  3DDF A;  2LM0 A;  4UDX X;  4IWQ A;  3DX2 A;  2RT6 A;  3O3M B;  4BNE A;  1R33 A;  2MI7 A;  3KDR A;  4NSW A;  2QXL A;  1I4T A;  3GI7 A;  1TQS A;  2YI9 A;  4HYB A;  1GNT A;  4AZ7 A;  3ABH A;  2F7Q A;  2ND0 A;  2RAI A;  4KIK A;  3BUB A;  2JNK A;  1SU6 A;  3BUP A;  1E1D A;  1QWU A;  2EFK A;  4DCN C;  1E9V A;  2ALW A;  1O7D C;  5FIG A;  3BVX A;  4JNE A;  1YWM A;  2YL5 A;  3HAJ A;  4AVM A;  4IWO A;  4DYL A;  4AZC B;  3DPQ A;  1GN9 A;  3EJT A;  4JLC A;  2EX3 B;  2EWF A;  3ER9 B;  2WYI A;  1GNL A;  1TQV A;  1LQ7 A;  3OK8 A;  4FM3 A;  1OA1 A;  1I4D A;  1R5E A;  3I04 A;  3DPO A;  2F1B A;  1R34 A;  1URU A;  2YKT A;  1SU7 A;  3PLT A;  1HTY A;  3BLB A;  2OZN B;  4JWC A;  2PMR A;  1DKY A;  2WIN M;  3BUI A;  4WPE A;  3T49 A;  2N3K A;  4R5L A;  3T47 A;  3BUD A;  2O0I 1;  4UDY X;  2Z0V A;  3ER8 C;  3D4Y A;  3FD9 A;  3QNJ A;  4R5G A;  4JL9 A;  2PY6 A;  4H6H A;  2FYV A;  1DKZ A;  2Q13 A;  2F7R A;  2ND1 A;  1SU8 A;  2GAF D;  1DKX A;  3LLL A;  4H8S A;  2RAK A;  5TKY A;  1W9M A;  4EZY A;  3EJQ A;  2YL6 A;  3T46 A;  4G6Q A;  4D8J A;  4EZW A;  4AZH A;  3CV5 A;  3VKH A;  2YL9 A;  3EJR A;  4AZC A;  4EZZ A;  3OHX M;  4AZ6 A;  2X3V A;  1TQU A;  4H6I A;  3OWG A;  3CZS A;  4IM3 A;  1I4L A;  3B52 X;  2Z0N A;  5E84 A;  2YI8 A;  3DYT A;  3DPP A;  2OO2 A;  4EZV A;  3DX3 A;  3HAI A;  3Q84 A;  3RPM A;  4R5K A;  3DX4 A;  3RV1 A;  1U00 A;  3T48 A;  4JWE A;  4EZS A;  3I39 X;  4EZT A;  2F1A A;  4R5I A;  3QA8 A;  3RV0 A;  3T4A G;  2YL8 A;  2X5C A;  3BVV A;  3VEA A;  4IM0 A;  4HY9 A;  4EZR A;  4HR1 B;  2JNS A;  5C5B A;  2Z8Y A;  1E2U A;  2GA9 D;  4EZN A;  4AZI A;  4AKV A;  3EJP A;  2F7O A;  3QE6 A;  2FIC A;  3BVW A;  4E3C A;  3D4Z A;  1I49 A;  5FLE X;  1TQW A;  3B53 X;  4B9Q A;  2X3X A;  2RAJ A;  3SYV A;  4JNF A;  2F18 A;  5C5B B;  4WPC A;  4NQI A;  4EZU A;  3ACO A;  3D50 A;  3VEB A;  3DX1 A;  2X3W A;  3A98 A;  1PS3 A;  2D4C A;  4F01 A;  2ZXQ A;  1HWW A;  5KBP A;  4FZS A;  1QX1 A;  2OW7 A;  3HAH A;  2EFL A;  3CZN A;  2OW6 A;  4EZX A;  2OBL A;  4IM2 A;  2YIA A;  3UIT A;  3I2W A;  4AZG A;  4EZO A;  2GF4 A;  1TQT A;  4ATM A;  4F00 A;  1ZWW A;  1ZYL A;  2Q12 A;  1QWN A;  1OAO A;  4FZO A;  2Z0O A;  4JWI A;  4I1Q A;  2OBM A;  2YLA A;  2D1L A;  3EJS A;  4HR1 A;  4R5J A;  2F7P A;  1MJG A;  2QKW A;  3B51 X;  3D2E A;  2YIV X;  4JN4 A;  1OA0 A;  3G9G A;  2YLL A;  4JWD A;  1WDZ A;  1HXK A;  3KAV A;  1Y2O A;  3LMF A;  3DX0 A;  3I01 A;  4AZ5 A;  3C7N A;  4NPH A;  4IWP A;  3SOG A;  4KIK B;  3BVT A;  1UPX A;  4FZP A;  1X04 A;  3D51 A;  4IW0 A;  2YIB A;  3CKD A;  1SUF A;  1X03 A;  4E81 A;  3D2F A;  3ZED A;  2NCZ A;  2LXY A;  4EZP A;  3D52 A;  3L3P A; 
#chains in the Genus database with same CATH homology
 2GF4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...