2GF4A

Crystal structure of vng1086c from halobacterium salinarium (halobacterium halobium). northeast structural genomics target hsr14
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
89
structure length
89
Chain Sequence
MHKDELLELHEQMVNIKDQFLGFDHVDETAFAAYEELDVEPSHVHKSKSEHKHAVFLLGNALAAAMSEDEFSSAGRISKRMEELADDAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein Vng1086c
publication title Crystal structure of Vng1086c from Halobacterium salinarium (Halobacterium halobium). Northeast Structural Genomics Target HsR14
rcsb
source organism Halobacterium sp.
molecule tags Structural genomics, unknown function
total genus 30
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01893 UPF0058 Uncharacterised protein family UPF0058
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.110 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Uncharacterised protein family UPF0058 2gf4A00
2GF4A
chains in the Genus database with same CATH superfamily
3DX4A 3ERCC 2ZXQA 3ZEDA 4EZQA 1LQ7A 1TQUA 2D4CA 2RAIA 2NCZA 2F7OA 2F18A 1HTYA 4R5KA 4R5LA 4H6IA 4G6QA 3SYVA 1I4DA 3ER9B 4EZUA 3SOGA 3CZNA 4NPHA 4F01A 4D8JA 4ATMA 1R34A 3D2FA 4M0MA 1QX1A 1TQSA 3D52A 4PO2A 2ALWA 1HWWA 1ZYLA 2PMRA 4IWQA 3EJUA 3F7WA 4AZHA 4WPCA 2WINM 4AZIA 1GNLA 3QWEA 4IW0A 3Q0KA 2YIBA 4KIKA 2X5CA 3CZSA 1DKXA 2C08A 2OW6A 3T4AG 4NQIA 1E1DA 3RV1A 1DKYA 3BUIA 4EZPA 1I49A 4E81A 3ABHA 1W9MA 3D4YA 1I4LA 4FM3A 2YLLA 5FIGA 2X3XA 2FYVA 2YL5A 3BVUA 3QE6A 4EZSA 4EZYA 2GAFD 4H6HA 4AZGA 1O7DC 2F7RA 1SU8A 4AZCB 4BNEA 2F1BA 4JN4A 3BVXA 3DPOA 5C5BB 2X3VA 1O7DB 2GF4A 4F00A 3HAHA 3BUBA 4AZ6A 4R5JA 2O0I1 2JNSA 4EZTA 2JNKA 5FLEX 4EZXA 2YI8A 1TQVA 3B52X 1U00A 1OAOA 2WYHA 4IWOA 2EX3B 4AZ5A 4EZOA 3EJRA 3BVVA 2LM0A 2X3WA 2YL9A 3B51X 4FZSA 1QWUA 2F1AA 4HR1B 2D1LA 4EZRA 3RPMA 4EZVA 4AVMA 1R5EA 4FZOA 2QKWA 4JWIA 1SU7A 3BUDA 3ER8C 3GI7A 2YIVX 2F7QA 3A98A 3ACOA 1HXKA 2N3KA 3EJPA 3DX1A 3D50A 2YKTA 3VEBA 3OHXM 2RAKA 4IM3A 4E3CA 3O3NB 4I1QA 3CVRA 1E9VA 2ELBA 1URUA 3QNJA 3DPQA 1JQKA 4UDXX 2EFLA 3T48A 1E2UA 4JLCA 3OK8A 3BVWA 4B9QA 3B53X 4NSWA 2LXYA 3DYTA 1QWNA 1YWMA 2WYIA 5TKYA 3T46A 3OWGA 4JNEA 3L3PA 3Q84A 4IWPA 2OW7A 2YIAA 4EZWA 5KBPA 2RT6A 2PY6A 5E84A 3HAIA 4JWCA 3D51A 3VKHA 3DDGA 4FZPA 2F7PA 3BUQA 1R33A 1X03A 4AZ7A 2EWFA 2YI9A 1DKZA 4R5GA 1MJGA 1TQTA 3CV5A 4JWEA 4KIKB 3DX0A 3M3WA 1OA0A 2Z0OA 2EFKA 1X04A 2Q13A 3QNIA 2Z0NA 2Z0VA 3KAWA 3KDRA 1SU6A 3LMFA 4HY9A 4AZCA 3I39X 4H8SA 4EZZA 3T49A 4AZBA 2OBMA 5C5BA 2Z8YA 3O3MB 3DX2A 3EJQA 3L3OM 4R5IA 4WPEA 1PS3A 1Y2OA 2FICA 3PLTA 2YLAA 3KAVA 1ZWWA 4DYLA 3C7NA 3G9GA 2OO2A 3O3OB 2Q12A 4IM2A 3QA8A 2OBLA 3T47A 3HAJA 4JNFA 1TQWA 2V0OA 3LVTA 1GNTA 1UPXA 3CKDA 3FD9A 3RV0A 3DPPA 2MI7A 3BVTA 3I01A 1WDZA 3DDFA 4UDYX 3UITA 2YL8A 4HR1A 3BLBA 2OZNB 2RAJA 4DCNC 1SUFA 2KHOA 3BUPA 1GN9A 4IM0A 2GA9D 3D4ZA 4JL9A 3EJSA 3D2EA 4HYBA 3VEAA 1I4TA 3EJTA 1OA1A 4JWDA 4AKVA 3I04A 3DX3A 2ND1A 2YL6A 2ND0A 3LLLA 4EZNA 2QFFA 2QXLA 3I2WA 3CAZA
chains in the Genus database with same CATH topology
2GF4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GF4 A; 
#chains in the Genus database with same CATH topology
 3DX4 A;  3ERC C;  2ZXQ A;  3ZED A;  4EZQ A;  1LQ7 A;  1TQU A;  2D4C A;  2RAI A;  2NCZ A;  2F7O A;  2F18 A;  1HTY A;  4R5K A;  4R5L A;  4H6I A;  4G6Q A;  3SYV A;  1I4D A;  3ER9 B;  4EZU A;  3SOG A;  3CZN A;  4NPH A;  4F01 A;  4D8J A;  4ATM A;  1R34 A;  3D2F A;  4M0M A;  1QX1 A;  1TQS A;  3D52 A;  4PO2 A;  2ALW A;  1HWW A;  1ZYL A;  2PMR A;  4IWQ A;  3EJU A;  3F7W A;  4AZH A;  4WPC A;  2WIN M;  4AZI A;  1GNL A;  3QWE A;  4IW0 A;  3Q0K A;  2YIB A;  4KIK A;  2X5C A;  3CZS A;  1DKX A;  2C08 A;  2OW6 A;  3T4A G;  4NQI A;  1E1D A;  3RV1 A;  1DKY A;  3BUI A;  4EZP A;  1I49 A;  4E81 A;  3ABH A;  1W9M A;  3D4Y A;  1I4L A;  4FM3 A;  2YLL A;  5FIG A;  2X3X A;  2FYV A;  2YL5 A;  3BVU A;  3QE6 A;  4EZS A;  4EZY A;  2GAF D;  4H6H A;  4AZG A;  1O7D C;  2F7R A;  1SU8 A;  4AZC B;  4BNE A;  2F1B A;  4JN4 A;  3BVX A;  3DPO A;  5C5B B;  2X3V A;  1O7D B;  2GF4 A;  4F00 A;  3HAH A;  3BUB A;  4AZ6 A;  4R5J A;  2O0I 1;  2JNS A;  4EZT A;  2JNK A;  5FLE X;  4EZX A;  2YI8 A;  1TQV A;  3B52 X;  1U00 A;  1OAO A;  2WYH A;  4IWO A;  2EX3 B;  4AZ5 A;  4EZO A;  3EJR A;  3BVV A;  2LM0 A;  2X3W A;  2YL9 A;  3B51 X;  4FZS A;  1QWU A;  2F1A A;  4HR1 B;  2D1L A;  4EZR A;  3RPM A;  4EZV A;  4AVM A;  1R5E A;  4FZO A;  2QKW A;  4JWI A;  1SU7 A;  3BUD A;  3ER8 C;  3GI7 A;  2YIV X;  2F7Q A;  3A98 A;  3ACO A;  1HXK A;  2N3K A;  3EJP A;  3DX1 A;  3D50 A;  2YKT A;  3VEB A;  3OHX M;  2RAK A;  4IM3 A;  4E3C A;  3O3N B;  4I1Q A;  3CVR A;  1E9V A;  2ELB A;  1URU A;  3QNJ A;  3DPQ A;  1JQK A;  4UDX X;  2EFL A;  3T48 A;  1E2U A;  4JLC A;  3OK8 A;  3BVW A;  4B9Q A;  3B53 X;  4NSW A;  2LXY A;  3DYT A;  1QWN A;  1YWM A;  2WYI A;  5TKY A;  3T46 A;  3OWG A;  4JNE A;  3L3P A;  3Q84 A;  4IWP A;  2OW7 A;  2YIA A;  4EZW A;  5KBP A;  2RT6 A;  2PY6 A;  5E84 A;  3HAI A;  4JWC A;  3D51 A;  3VKH A;  3DDG A;  4FZP A;  2F7P A;  3BUQ A;  1R33 A;  1X03 A;  4AZ7 A;  2EWF A;  2YI9 A;  1DKZ A;  4R5G A;  1MJG A;  1TQT A;  3CV5 A;  4JWE A;  4KIK B;  3DX0 A;  3M3W A;  1OA0 A;  2Z0O A;  2EFK A;  1X04 A;  2Q13 A;  3QNI A;  2Z0N A;  2Z0V A;  3KAW A;  3KDR A;  1SU6 A;  3LMF A;  4HY9 A;  4AZC A;  3I39 X;  4H8S A;  4EZZ A;  3T49 A;  4AZB A;  2OBM A;  5C5B A;  2Z8Y A;  3O3M B;  3DX2 A;  3EJQ A;  3L3O M;  4R5I A;  4WPE A;  1PS3 A;  1Y2O A;  2FIC A;  3PLT A;  2YLA A;  3KAV A;  1ZWW A;  4DYL A;  3C7N A;  3G9G A;  2OO2 A;  3O3O B;  2Q12 A;  4IM2 A;  3QA8 A;  2OBL A;  3T47 A;  3HAJ A;  4JNF A;  1TQW A;  2V0O A;  3LVT A;  1GNT A;  1UPX A;  3CKD A;  3FD9 A;  3RV0 A;  3DPP A;  2MI7 A;  3BVT A;  3I01 A;  1WDZ A;  3DDF A;  4UDY X;  3UIT A;  2YL8 A;  4HR1 A;  3BLB A;  2OZN B;  2RAJ A;  4DCN C;  1SUF A;  2KHO A;  3BUP A;  1GN9 A;  4IM0 A;  2GA9 D;  3D4Z A;  4JL9 A;  3EJS A;  3D2E A;  4HYB A;  3VEA A;  1I4T A;  3EJT A;  1OA1 A;  4JWD A;  4AKV A;  3I04 A;  3DX3 A;  2ND1 A;  2YL6 A;  2ND0 A;  3LLL A;  4EZN A;  2QFF A;  2QXL A;  3I2W A;  3CAZ A; 
#chains in the Genus database with same CATH homology
 2GF4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...