2GAFD

Crystal structure of the vaccinia polyadenylate polymerase heterodimer (apo form)
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
468
structure length
447
Chain Sequence
NITLKIIETYLGRVPSVNEYHMLKSQARNIQKITVFNKDIFVSLVKKNKKRFFSDVNTSASEIKDRILSYFSKQTQTYNIGKLFTIIELQSVLVTTYTDILGVLTIKAPTSMEELARDMLNSMNVAVIVSSLVKNVNKLMEEYLRRHNKSCICYGSYSLYLINPNIRYGDIDILQTNSRTFLIDLAFLIKFITGNNIILSKIPYLRNYMVIKDENDNHIIDSFNIRQDTMNVVPKIFIDNIYIVDPTFQLLNMIKMFSQIDRLEDLSKDPEKFNARMATMLEYVRYTHGIVFDGKRNNMPMKCIIDENNRIVTVTTKDYFSFKKCLVYLDENVLSSDILDLNADTSCDFESVTNSVYLIHDNIMYTYFSNTILLSDKGKVHEISARGLCAHILLYQMLTSGEYKQCLSDLLNSMMNRDKIPIYSHTERDKKPGRHGFINIEKDIIVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase
publication title Crystal structures of the vaccinia virus polyadenylate polymerase heterodimer: insights into ATP selectivity and processivity.
pubmed doi rcsb
source organism Vaccinia virus
molecule tags Transferase
total genus 136
structure length 447
sequence length 468
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2006-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF03296 Pox_polyA_pol Poxvirus poly(A) polymerase nucleotidyltransferase domain
D PF12629 Pox_polyA_pol_C Poxvirus poly(A) polymerase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.320 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 2gafD01
3.30.460.60 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 2gafD03
2GAFD 3ER9B 3OWGA 3ER8C 3ERCC 2GA9D
chains in the Genus database with same CATH superfamily
3BUQA 3WFRE 3PMNA 2YL6A 4AT7B 2PY6A 3OGUA 4M9JA 1W9MA 4FH3A 3VKHA 1NOMA 3UQ2A 4OAIZ 2ZH4A 2ISPA 2QXLA 4RQ1A 3OUYB 4KM5A 1ZQUA 4OAHA 2N3KA 7ICPA 4O68A 4M2YA 8ICEA 5DECA 3DPQA 2LXYA 5CWRA 4EZTA 2IHOA 5CHGA 1WDZA 4QZ8A 3HAIA 5D61A 4K99A 2YKTA 4RQ4A 3UXPA 2RAKA 3LK9A 4E81A 1TQUA 4IM0A 4PHAA 3M3WA 4JWMA 5BPCA 5CB1A 4PPXA 2FMQA 5J0SA 2LM0A 4Z6FA 3JPTA 2FMPA 4JWCA 3CZNA 4WC6A 5J0OA 4M04A 5F2VO 1WOTA 4F5OA 4I2HA 4KLIA 4I2BA 3WFOA 3C7NA 3T49A 4R65A 3C5GA 5CR0A 5J0YA 3BUIA 9ICWA 3B0XA 4FH5A 1SU8A 5CP2A 3JPNA 3JPPA 5J2EA 4FZSA 8ICSA 5FLEX 1VFGA 4EZNA 4I29A 4X4NA 4LT6A 4E3CA 2Z0VA 4WC7A 3D52A 2YL9A 5J0UA 2BCUA 4M9NA 4HR1B 5J2BA 3C2KA 3DX2A 4R5LA 2PFPA 4M5DA 3C2LA 1JN3A 1MQ3A 1ZYLA 1ZQKA 1I4LA 5JTGA 4NM2A 4NY8A 4AZ6A 3T4AG 8ICBA 8ICFA 4MFCA 2BBHA 4XA5A 4FZPA 4XRHA 1HTYA 1HUOA 2HN2A 1ZQZA 1Y2OA 4ATBA 4M0MA 3LVTA 4KLLA 5D46A 2GWSA 1MIYA 5J2CA 2IHMA 5IIIA 3Q0KA 4F01A 3CVRA 4EZWA 4RQ3A 5HR9A 4F5PA 3PHZA 2EWRA 5HHIA 4UB3A 5J0PA 1ZQNA 1TFYA 3ZEDA 2MI7A 4R64A 3OWGA 4H6HA 3ISCA 2DVIA 4NSWA 3V7LA 2M2WA 4KLFA 3QNIA 5HHHA 3ER9B 4UAZA 1ZQFA 8ICVA 2YIAA 3NVOA 4WOYA 4FO6A 4G6QA 4AZBA 3WFQE 1KDHA 4XQ8A 9ICAA 2PBEA 4NPHA 3T47A 3BUDA 2F7QA 1SU6A 1V4AA 4O69A 2Q66A 4H6IA 2M2VA 3ISDA 3OVAA 2ZH6A 4MFFA 1MQ2A 9ICBA 3PLTA 5BOMA 4EBJA 2RAIA 3GDXA 4HYBA 4I27A 1BPBA 2V0OA 3FD9A 2W9MA 4WPCA 4RQ2A 4PGQA 4E7XA 3UQ0A 4AT9A 2WYHA 4TUPA 2M2UA 3V7KA 8ICKA 2PXIA 3DPPA 3MGHA 4O5CA 4JLXA 1QX1A 4AT8B 3JPSA 3EJSA 5HRIA 2F1BA 9ICGA 1R8BA 4UB2A 8ICLA 4IG8A 7ICEA 4NLZA 1ZQYA 4WQLA 4QZAA 5J0WA 3RPMA 2ZH3A 2JNSA 1XSNA 5J0XA 4UAWA 2D1LA 4EZQA 1ZWWA 3CK6A 4I2CA 3BVWA 4WBYA 3T48A 3EF2A 2F7RA 4KLEA 3CAZA 4KIKA 1BPDA 1UEVA 3B51X 4EBKA 7ICHA 9ICRA 5CFTA 8ICXA 9ICXA 4RQ5A 4IWPA 3I2WA 5CFUA 5DDYA 5B3PA 4RQ7A 2P66A 4X0BA 3TFRA 4JWNA 4PGYA 4EZSA 5HRHA 3HX0A 1LQ7A 4JL9A 1GPJA 3BVTA 4K98A 4KLDA 5CJ7A 4UB1A 2YL8A 4WH5A 4GXJA 3AQMA 2B51A 5J0QA 3H39A 4EEBA 1JQRA 5J2GA 1JAJA 4MF2A 5HRBA 5J2FA 3JPRA 3K75D 3HIYA 1ZQHA 2ZH5A 2RAJA 1E9VA 2DRAA 4RWQA 4RPXA 4K4HA 3C66A 1ZQVA 9ICNA 4EZZA 3B0YA 3WFPA 4IQWA 2Q12A 1KNYA 2RT6A 3MGIA 4M47A 4EEDA 4I28A 4AT7A 4WC5A 4TUSA 2KHOA 4R5GA 3ER8C 5CA7A 5DB6A 3SOGA 7ICKA 4O9MA 5B3QA 5DDMA 3OUYA 4F5RA 8ICCA 3AQLA 1URUA 3NKUA 4PO2A 5C5BB 7ICVA 3H38A 4UAYA 1GNLA 4KLSA 1PX5A 4I2IA 5DBCA 3OVSA 4LEZA 1TQSA 4JNEA 4NKUA 4DCNC 1ZQTA 4K97A 4LEYA 3CKDA 4FZOA 5CFSA 4X5VA 2DR5A 2ND1A 5J2HA 4BNEA 2PFOA 1R89A 4M9LA 5J2AA 3UPQA 4X4SA 3JCFA 4NXZA 2Z0OA 4AZHA 3QNJA 4K8VA 4NXVA 5HRGA 4LZGA 2ZHAA 3SYVA 2NRKA 2O1PA 4I2GA 4MFAA 4KLHA 9ICEA 1TQTA 3DYTA 1F5AA 3AQNA 2BCQA 4QZ9A 1VJ7A 4P2HA 3OV7A 1Q78A 4UDXX 2ISOA 4WC0A 3F7WA 1ZQWA 4M9HA 4PHDA 3O3MB 5IIOA 3PMLA 1TV9A 5D63A 2YI9A 7ICMA 1BPZA 1SU7A 3V72A 3C5FA 3RH6A 2FYVA 1XSLA 4FHXA 4YN4A 2GF4A 4HR1A 3UITA 3I01A 4DYLA 1I4DA 4RWNA 3O3OB 2EWFA 2IUBA 3HJ4A 3MCRA 2BCVA 5J2DA 1SUFA 4UB5A 4UBBA 4JLZA 3NYBA 1TVAA 4QZDA 2YIVX 4EZVA 4I2JA 7ICNA 4RPZA 3I39X 2HN1A 4UDYX 2ALWA 3MDAA 3RJGA 3A98A 2O5AA 3UXNA 3RJJA 5FIGA 4IQVA 1ZQEA 3RV1A 1YLQA 2BE3A 3D4ZA 9ICTA 5EOZA 5E84A 4JLCA 3CZSA 4WC4A 3NWIA 3RV0A 4JN4A 2OW7A 8ICHA 9ICUA 2ZHBA 1X04A 3OVBA 4R66A 1ZQCA 4WPEA 4I2AA 2YLAA 1OA1A 3BUPA 4I2DA 1ZQPA 4FHVA 4PH5A 4PHPA 3RJFA 4R5JA 3EJUA 3HAJA 3BVUA 2OO2A 1E1DA 8ICPA 3RJKA 4E8FA 4RWPA 4DOAA 4EZUA 4ATMA 4AZCB 3PNCA 3OK8A 4QZGA 5J0TA 4K9AA 1JQKA 1ZQOA 1ZQJA 1R5EA 5HRLA 4EZYA 4K96A 5TKYA 9ICPA 2PMRA 4JWIA 5HC9A 4KLQA 4RQ0A 4PGXA 2B56A 9ICHA 1OU5A 2YL5A 1O7DB 4AT9B 4X4PA 1HWWA 4NQIA 4WCWA 3D2EA 4O6AA 1ZQQA 3ABHA 1NO5A 2OZNB 3KAWA 4AT8A 1TQVA 3DX0A 5HREA 5HRFA 2RFFA 5D49A 3HW8A 4X4VA 3GI7A 4DOBA 9ICCA 3MBYA 4FHWA 2ND0A 4EZXA 4EGWA 2ZH9A 8ICMA 4UBCA 1R8AA 1HXKA 3KDRA 1PS3A 4LEWA 5DB8A 4RQ8A 3T46A 3JYYA 3RJIA 9ICVA 1ZQRA 3CV5A 3MDCA 4IM3A 3AU6A 4FHYA 1DKZA 3I04A 2F18A 4QZFA 4R63A 9ICLA 3BVVA 5IIMA 2DR8A 4YD2A 4AKVA 4K9BA 1RZTA 3AU2A 4RT3A 1R33A 2EFLA 2B4VA 3C18A 5J29A 1ZQAA 2QFFA 3DDGA 1RPLA 4AVMA 2BPCA 4HY9A 4YD1A 4XJEA 8ICRA 4X4RA 5IIJA 4P4OA 4LZDA 1TQWA 4QZEA 2FCLA 5HRKA 4PHEA 4I2FA 3DX3A 5DEDA 4NLNA 3DDFA 2GAFD 2DR7A 1TFWA 2C08A 4WQKA 4E80A 3UPSA 1ZQBA 4WC1A 3D2FA 2OBLA 4R5IA 2YIBA 4LVSA 4M0AA 1DKXA 1BPYA 1BPXA 3RJEA 4RQ6A 4TURA 2FICA 9ICIA 5IILA 2YI8A 4X0AA 3L9DA 7ICIA 4HX0A 4EP7A 9ICFA 1ZQMA 3JPOA 1YWMA 7ICFA 3JZ0A 5D62A 4DOCA 4F00A 1OA0A 3B52X 4I2EA 2I9GA 8ICZA 5J2IA 4F5QA 4K4GA 1BPEA 3H37A 4AZIA 4NXXA 3ACOA 2BPGA 2PFNA 3WFSC 5CHEA 2VANA 3H3AA 3EJRA 2DRBA 4KLJA 2WYIA 5J2JA 4UB4A 1KEJA 5C5BA 1R34A 2ZH8A 3RH5A 4KLMA 3DX4A 4NM1A 3DX1A 4NXTA 2DR9A 4YMOA 8ICQA 3L3PA 1ZQGA 3QE6A 2OBMA 2X3VA 7ICUA 2ELBA 3LLLA 1MIVA 4N7RA 2EX3B 3EJQA 1U00A 2ZH2A 1GN9A 4KLGA 4P4MA 7ICGA 2GA9D 9ICSA 1QWUA 4YMMA 9ICOA 5KBPA 5D4BA 5IINA 3AQKA 3BLBA 3VEAA 4R5KA 4X4TA 2F1AA 2PFQA 4AZ5A 3BUBA 4Z6DA 7ICOA 4Z6CA 1ZQLA 2OW6A 4YCXA 8ICJA 5J2KA 4IM2A 3HJ1A 1GNTA 3UXOA 5DBBA 2FMSA 4XQ7A 4OAGA 5BOLA 7ICQA 1MJGA 2WINM 1UEUA 8ICAA 2BCSA 2X3XA 3JPQA 1HUZA 1ZJNA 4ATBB 2BBJA 3ISBA 8ICGA 5HRDA 4IWOA 4K4IA 4WC3A 4O67A 8ICIA 4IWQA 5IIKA 3V7JA 1O7DC 3DPOA 9ICJA 2D4CA 4RPYA 2M2TA 1R8CA 2O0I1 4X4OA 4P4PA 4EV6A 3D4YA 3EJPA 4AZ7A 4JWDA 4IW0A 4D8JA 1MIWA 2ID1A 1DKYA 2X5CA 3ERCC 4I0UA 4NXUA 3D51A 1ZQDA 1I4TA 4NKTA 4M9GA 4QZIA 3TFSA 9ICQA 4IQTA 8ICTA 3OHXM 4UD4A 4X4UA 8ICWA 2ZH7A 4RWOA 4JWEA 4IQUA 4FO1A 2NCZA 1Q79A 4O5KA 9ICKA 4WBZA 4B9QA 5DBAA 1ZJMA 2F7OA 4FHPA 4XUSA 2HHPA 4AZCA 3G9GA 7ICJA 4KLUA 4AZGA 4NLKA 1ZQSA 3KAVA 2Q13A 7ICSA 2Z8YA 4S3NA 4X4QA 4H8SA 3L3OM 3Q84A 4EZPA 4KLOA 1ZQIA 7ICTA 3AUOA 5DKWA 1ZQXA 3K7DA 1JMSA 3QA8A 4NXWA 1OAOA 2Z0NA 3LMFA 1X03A 8ICOA 4KIKB 3VEBA 4MKPA 4WC2A 3B53X 4QZCA 4FM3A 9ICMA 2F7PA 2ZXQA 8ICUA 3LQCB 3O3NB 3RJHA 4QZBA 4MF8A 4DO9A 4JNFA 2BPFA 1QWNA 4YMNA 2QKWA 4OAFA 1UETA 3EJTA 3QWEA 2JNKA 3C2MA 7ICRA 5TZVA 4F5NA 1I49A 4Z6EA 2EFKA 4GXKA 1E2UA 4LEVA 4O5EA 3BVXA 3HAHA 4KB6A 7ICLA 5DB7A 4RT2A 1FA0A 4TUQA 4GXIA 5DB9A 4EZOA 3HWTA 4I1QA 4KLTA 1XSPA 2BCRA 8ICNA 1UPXA 2YLLA 2X3WA 8ICYA 5J0RA 3RH4A 4EZRA 4UD5A 4QZHA 2ZH1A 3D50A
chains in the Genus database with same CATH topology
4JLCA 4EZQA 2PY6A 3VEAA 4R5KA 3T48A 3RV0A 3EF2A 1W9MA 4JN4A 3VKHA 4KIKA 4OAIZ 3B51X 1OA1A 2QXLA 5CFTA 4KM5A 4IWPA 5CFUA 4OAHA 5B3PA 2N3KA 4O68A 4R5JA 1E1DA 4IM2A 1GNTA 3DPQA 4EZSA 4EZTA 2IHOA 4EZUA 4OAGA 4JL9A 1MJGA 2WINM 1GPJA 4K9AA 1JQKA 5D61A 4K98A 4K99A 4WH5A 4EZYA 4E81A 4K96A 4IM0A 5TKYA 2B51A 4JWIA 4IWOA 2LM0A 4O67A 4JWCA 2B56A 4IWQA 3DPOA 3D2EA 1E9VA 4O6AA 3KAWA 3GI7A 3C7NA 3T49A 2ND0A 4EZXA 4EZZA 4NXWA 4JWDA 4IW0A 4D8JA 3KDRA 1DKYA 1SU8A 2X5CA 3ERCC 4LEWA 3T46A 4NXUA 2RT6A 5FLEX 4IM3A 4EZNA 1DKZA 3I04A 4E3CA 3OHXM 2KHOA 4R5GA 3ER8C 5B3QA 4K9BA 4HR1B 4R5LA 4JWEA 2B4VA 4FO1A 2NCZA 2QFFA 3NKUA 1ZYLA 4B9QA 4HY9A 3T4AG 4PO2A 4XJEA 2FCLA 1GNLA 4LEZA 4JNEA 3KAVA 2GAFD 4WQKA 4LEYA 4K97A 2Z8YA 5CFSA 4M0MA 3D2FA 2ND1A 2OBLA 2YIBA 3L3OM 4R5IA 4EZPA 1DKXA 4F01A 4EZWA 4K8VA 3QNJA 3PHZA 4NXVA 2EWRA 3ZEDA 3K7DA 3OWGA 2YI8A 4H6HA 3QA8A 1OAOA 3LMFA 4KIKB 3VEBA 4HX0A 4MKPA 3B53X 4UDXX 3F7WA 4FM3A 3ER9B 5D62A 3O3MB 4F00A 1OA0A 2YIAA 4WOYA 4G6QA 3B52X 3O3NB 2YI9A 5D63A 1SU7A 4JNFA 4NPHA 3T47A 4NXXA 4OAFA 1SU6A 4O69A 5CHEA 4H6IA 4HR1A 3I01A 3UITA 3O3OB 2EWFA 3MCRA 1SUFA 1E2UA 4HYBA 4JLZA 4LEVA 3FD9A 4KB6A 2YIVX 4EZVA 4EZOA 4NXTA 3I39X 4UDYX 1UPXA 3DPPA 4JLXA 2OBMA 3A98A 4N7RA 4EZRA 2EX3B 1U00A 5FIGA 1GN9A 4WQLA 3RV1A 2GA9D 2JNSA 5E84A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GAF D;  3ER9 B;  3OWG A;  3ER8 C;  3ERC C;  2GA9 D; 
#chains in the Genus database with same CATH topology
 3BUQ A;  3WFR E;  3PMN A;  2YL6 A;  4AT7 B;  2PY6 A;  3OGU A;  4M9J A;  1W9M A;  4FH3 A;  3VKH A;  1NOM A;  3UQ2 A;  4OAI Z;  2ZH4 A;  2ISP A;  2QXL A;  4RQ1 A;  3OUY B;  4KM5 A;  1ZQU A;  4OAH A;  2N3K A;  7ICP A;  4O68 A;  4M2Y A;  8ICE A;  5DEC A;  3DPQ A;  2LXY A;  5CWR A;  4EZT A;  2IHO A;  5CHG A;  1WDZ A;  4QZ8 A;  3HAI A;  5D61 A;  4K99 A;  2YKT A;  4RQ4 A;  3UXP A;  2RAK A;  3LK9 A;  4E81 A;  1TQU A;  4IM0 A;  4PHA A;  3M3W A;  4JWM A;  5BPC A;  5CB1 A;  4PPX A;  2FMQ A;  5J0S A;  2LM0 A;  4Z6F A;  3JPT A;  2FMP A;  4JWC A;  3CZN A;  4WC6 A;  5J0O A;  4M04 A;  5F2V O;  1WOT A;  4F5O A;  4I2H A;  4KLI A;  4I2B A;  3WFO A;  3C7N A;  3T49 A;  4R65 A;  3C5G A;  5CR0 A;  5J0Y A;  3BUI A;  9ICW A;  3B0X A;  4FH5 A;  1SU8 A;  5CP2 A;  3JPN A;  3JPP A;  5J2E A;  4FZS A;  8ICS A;  5FLE X;  1VFG A;  4EZN A;  4I29 A;  4X4N A;  4LT6 A;  4E3C A;  2Z0V A;  4WC7 A;  3D52 A;  2YL9 A;  5J0U A;  2BCU A;  4M9N A;  4HR1 B;  5J2B A;  3C2K A;  3DX2 A;  4R5L A;  2PFP A;  4M5D A;  3C2L A;  1JN3 A;  1MQ3 A;  1ZYL A;  1ZQK A;  1I4L A;  5JTG A;  4NM2 A;  4NY8 A;  4AZ6 A;  3T4A G;  8ICB A;  8ICF A;  4MFC A;  2BBH A;  4XA5 A;  4FZP A;  4XRH A;  1HTY A;  1HUO A;  2HN2 A;  1ZQZ A;  1Y2O A;  4ATB A;  4M0M A;  3LVT A;  4KLL A;  5D46 A;  2GWS A;  1MIY A;  5J2C A;  2IHM A;  5III A;  3Q0K A;  4F01 A;  3CVR A;  4EZW A;  4RQ3 A;  5HR9 A;  4F5P A;  3PHZ A;  2EWR A;  5HHI A;  4UB3 A;  5J0P A;  1ZQN A;  1TFY A;  3ZED A;  2MI7 A;  4R64 A;  3OWG A;  4H6H A;  3ISC A;  2DVI A;  4NSW A;  3V7L A;  2M2W A;  4KLF A;  3QNI A;  5HHH A;  3ER9 B;  4UAZ A;  1ZQF A;  8ICV A;  2YIA A;  3NVO A;  4WOY A;  4FO6 A;  4G6Q A;  4AZB A;  3WFQ E;  1KDH A;  4XQ8 A;  9ICA A;  2PBE A;  4NPH A;  3T47 A;  3BUD A;  2F7Q A;  1SU6 A;  1V4A A;  4O69 A;  2Q66 A;  4H6I A;  2M2V A;  3ISD A;  3OVA A;  2ZH6 A;  4MFF A;  1MQ2 A;  9ICB A;  3PLT A;  5BOM A;  4EBJ A;  2RAI A;  3GDX A;  4HYB A;  4I27 A;  1BPB A;  2V0O A;  3FD9 A;  2W9M A;  4WPC A;  4RQ2 A;  4PGQ A;  4E7X A;  3UQ0 A;  4AT9 A;  2WYH A;  4TUP A;  2M2U A;  3V7K A;  8ICK A;  2PXI A;  3DPP A;  3MGH A;  4O5C A;  4JLX A;  1QX1 A;  4AT8 B;  3JPS A;  3EJS A;  5HRI A;  2F1B A;  9ICG A;  1R8B A;  4UB2 A;  8ICL A;  4IG8 A;  7ICE A;  4NLZ A;  1ZQY A;  4WQL A;  4QZA A;  5J0W A;  3RPM A;  2ZH3 A;  2JNS A;  1XSN A;  5J0X A;  4UAW A;  2D1L A;  4EZQ A;  1ZWW A;  3CK6 A;  4I2C A;  3BVW A;  4WBY A;  3T48 A;  3EF2 A;  2F7R A;  4KLE A;  3CAZ A;  4KIK A;  1BPD A;  1UEV A;  3B51 X;  4EBK A;  7ICH A;  9ICR A;  5CFT A;  8ICX A;  9ICX A;  4RQ5 A;  4IWP A;  3I2W A;  5CFU A;  5DDY A;  5B3P A;  4RQ7 A;  2P66 A;  4X0B A;  3TFR A;  4JWN A;  4PGY A;  4EZS A;  5HRH A;  3HX0 A;  1LQ7 A;  4JL9 A;  1GPJ A;  3BVT A;  4K98 A;  4KLD A;  5CJ7 A;  4UB1 A;  2YL8 A;  4WH5 A;  4GXJ A;  3AQM A;  2B51 A;  5J0Q A;  3H39 A;  4EEB A;  1JQR A;  5J2G A;  1JAJ A;  4MF2 A;  5HRB A;  5J2F A;  3JPR A;  3K75 D;  3HIY A;  1ZQH A;  2ZH5 A;  2RAJ A;  1E9V A;  2DRA A;  4RWQ A;  4RPX A;  4K4H A;  3C66 A;  1ZQV A;  9ICN A;  4EZZ A;  3B0Y A;  3WFP A;  4IQW A;  2Q12 A;  1KNY A;  2RT6 A;  3MGI A;  4M47 A;  4EED A;  4I28 A;  4AT7 A;  4WC5 A;  4TUS A;  2KHO A;  4R5G A;  3ER8 C;  5CA7 A;  5DB6 A;  3SOG A;  7ICK A;  4O9M A;  5B3Q A;  5DDM A;  3OUY A;  4F5R A;  8ICC A;  3AQL A;  1URU A;  3NKU A;  4PO2 A;  5C5B B;  7ICV A;  3H38 A;  4UAY A;  1GNL A;  4KLS A;  1PX5 A;  4I2I A;  5DBC A;  3OVS A;  4LEZ A;  1TQS A;  4JNE A;  4NKU A;  4DCN C;  1ZQT A;  4K97 A;  4LEY A;  3CKD A;  4FZO A;  5CFS A;  4X5V A;  2DR5 A;  2ND1 A;  5J2H A;  4BNE A;  2PFO A;  1R89 A;  4M9L A;  5J2A A;  3UPQ A;  4X4S A;  3JCF A;  4NXZ A;  2Z0O A;  4AZH A;  3QNJ A;  4K8V A;  4NXV A;  5HRG A;  4LZG A;  2ZHA A;  3SYV A;  2NRK A;  2O1P A;  4I2G A;  4MFA A;  4KLH A;  9ICE A;  1TQT A;  3DYT A;  1F5A A;  3AQN A;  2BCQ A;  4QZ9 A;  1VJ7 A;  4P2H A;  3OV7 A;  1Q78 A;  4UDX X;  2ISO A;  4WC0 A;  3F7W A;  1ZQW A;  4M9H A;  4PHD A;  3O3M B;  5IIO A;  3PML A;  1TV9 A;  5D63 A;  2YI9 A;  7ICM A;  1BPZ A;  1SU7 A;  3V72 A;  3C5F A;  3RH6 A;  2FYV A;  1XSL A;  4FHX A;  4YN4 A;  2GF4 A;  4HR1 A;  3UIT A;  3I01 A;  4DYL A;  1I4D A;  4RWN A;  3O3O B;  2EWF A;  2IUB A;  3HJ4 A;  3MCR A;  2BCV A;  5J2D A;  1SUF A;  4UB5 A;  4UBB A;  4JLZ A;  3NYB A;  1TVA A;  4QZD A;  2YIV X;  4EZV A;  4I2J A;  7ICN A;  4RPZ A;  3I39 X;  2HN1 A;  4UDY X;  2ALW A;  3MDA A;  3RJG A;  3A98 A;  2O5A A;  3UXN A;  3RJJ A;  5FIG A;  4IQV A;  1ZQE A;  3RV1 A;  1YLQ A;  2BE3 A;  3D4Z A;  9ICT A;  5EOZ A;  5E84 A;  4JLC A;  3CZS A;  4WC4 A;  3NWI A;  3RV0 A;  4JN4 A;  2OW7 A;  8ICH A;  9ICU A;  2ZHB A;  1X04 A;  3OVB A;  4R66 A;  1ZQC A;  4WPE A;  4I2A A;  2YLA A;  1OA1 A;  3BUP A;  4I2D A;  1ZQP A;  4FHV A;  4PH5 A;  4PHP A;  3RJF A;  4R5J A;  3EJU A;  3HAJ A;  3BVU A;  2OO2 A;  1E1D A;  8ICP A;  3RJK A;  4E8F A;  4RWP A;  4DOA A;  4EZU A;  4ATM A;  4AZC B;  3PNC A;  3OK8 A;  4QZG A;  5J0T A;  4K9A A;  1JQK A;  1ZQO A;  1ZQJ A;  1R5E A;  5HRL A;  4EZY A;  4K96 A;  5TKY A;  9ICP A;  2PMR A;  4JWI A;  5HC9 A;  4KLQ A;  4RQ0 A;  4PGX A;  2B56 A;  9ICH A;  1OU5 A;  2YL5 A;  1O7D B;  4AT9 B;  4X4P A;  1HWW A;  4NQI A;  4WCW A;  3D2E A;  4O6A A;  1ZQQ A;  3ABH A;  1NO5 A;  2OZN B;  3KAW A;  4AT8 A;  1TQV A;  3DX0 A;  5HRE A;  5HRF A;  2RFF A;  5D49 A;  3HW8 A;  4X4V A;  3GI7 A;  4DOB A;  9ICC A;  3MBY A;  4FHW A;  2ND0 A;  4EZX A;  4EGW A;  2ZH9 A;  8ICM A;  4UBC A;  1R8A A;  1HXK A;  3KDR A;  1PS3 A;  4LEW A;  5DB8 A;  4RQ8 A;  3T46 A;  3JYY A;  3RJI A;  9ICV A;  1ZQR A;  3CV5 A;  3MDC A;  4IM3 A;  3AU6 A;  4FHY A;  1DKZ A;  3I04 A;  2F18 A;  4QZF A;  4R63 A;  9ICL A;  3BVV A;  5IIM A;  2DR8 A;  4YD2 A;  4AKV A;  4K9B A;  1RZT A;  3AU2 A;  4RT3 A;  1R33 A;  2EFL A;  2B4V A;  3C18 A;  5J29 A;  1ZQA A;  2QFF A;  3DDG A;  1RPL A;  4AVM A;  2BPC A;  4HY9 A;  4YD1 A;  4XJE A;  8ICR A;  4X4R A;  5IIJ A;  4P4O A;  4LZD A;  1TQW A;  4QZE A;  2FCL A;  5HRK A;  4PHE A;  4I2F A;  3DX3 A;  5DED A;  4NLN A;  3DDF A;  2GAF D;  2DR7 A;  1TFW A;  2C08 A;  4WQK A;  4E80 A;  3UPS A;  1ZQB A;  4WC1 A;  3D2F A;  2OBL A;  4R5I A;  2YIB A;  4LVS A;  4M0A A;  1DKX A;  1BPY A;  1BPX A;  3RJE A;  4RQ6 A;  4TUR A;  2FIC A;  9ICI A;  5IIL A;  2YI8 A;  4X0A A;  3L9D A;  7ICI A;  4HX0 A;  4EP7 A;  9ICF A;  1ZQM A;  3JPO A;  1YWM A;  7ICF A;  3JZ0 A;  5D62 A;  4DOC A;  4F00 A;  1OA0 A;  3B52 X;  4I2E A;  2I9G A;  8ICZ A;  5J2I A;  4F5Q A;  4K4G A;  1BPE A;  3H37 A;  4AZI A;  4NXX A;  3ACO A;  2BPG A;  2PFN A;  3WFS C;  5CHE A;  2VAN A;  3H3A A;  3EJR A;  2DRB A;  4KLJ A;  2WYI A;  5J2J A;  4UB4 A;  1KEJ A;  5C5B A;  1R34 A;  2ZH8 A;  3RH5 A;  4KLM A;  3DX4 A;  4NM1 A;  3DX1 A;  4NXT A;  2DR9 A;  4YMO A;  8ICQ A;  3L3P A;  1ZQG A;  3QE6 A;  2OBM A;  2X3V A;  7ICU A;  2ELB A;  3LLL A;  1MIV A;  4N7R A;  2EX3 B;  3EJQ A;  1U00 A;  2ZH2 A;  1GN9 A;  4KLG A;  4P4M A;  7ICG A;  2GA9 D;  9ICS A;  1QWU A;  4YMM A;  9ICO A;  5KBP A;  5D4B A;  5IIN A;  3AQK A;  3BLB A;  3VEA A;  4R5K A;  4X4T A;  2F1A A;  2PFQ A;  4AZ5 A;  3BUB A;  4Z6D A;  7ICO A;  4Z6C A;  1ZQL A;  2OW6 A;  4YCX A;  8ICJ A;  5J2K A;  4IM2 A;  3HJ1 A;  1GNT A;  3UXO A;  5DBB A;  2FMS A;  4XQ7 A;  4OAG A;  5BOL A;  7ICQ A;  1MJG A;  2WIN M;  1UEU A;  8ICA A;  2BCS A;  2X3X A;  3JPQ A;  1HUZ A;  1ZJN A;  4ATB B;  2BBJ A;  3ISB A;  8ICG A;  5HRD A;  4IWO A;  4K4I A;  4WC3 A;  4O67 A;  8ICI A;  4IWQ A;  5IIK A;  3V7J A;  1O7D C;  3DPO A;  9ICJ A;  2D4C A;  4RPY A;  2M2T A;  1R8C A;  2O0I 1;  4X4O A;  4P4P A;  4EV6 A;  3D4Y A;  3EJP A;  4AZ7 A;  4JWD A;  4IW0 A;  4D8J A;  1MIW A;  2ID1 A;  1DKY A;  2X5C A;  3ERC C;  4I0U A;  4NXU A;  3D51 A;  1ZQD A;  1I4T A;  4NKT A;  4M9G A;  4QZI A;  3TFS A;  9ICQ A;  4IQT A;  8ICT A;  3OHX M;  4UD4 A;  4X4U A;  8ICW A;  2ZH7 A;  4RWO A;  4JWE A;  4IQU A;  4FO1 A;  2NCZ A;  1Q79 A;  4O5K A;  9ICK A;  4WBZ A;  4B9Q A;  5DBA A;  1ZJM A;  2F7O A;  4FHP A;  4XUS A;  2HHP A;  4AZC A;  3G9G A;  7ICJ A;  4KLU A;  4AZG A;  4NLK A;  1ZQS A;  3KAV A;  2Q13 A;  7ICS A;  2Z8Y A;  4S3N A;  4X4Q A;  4H8S A;  3L3O M;  3Q84 A;  4EZP A;  4KLO A;  1ZQI A;  7ICT A;  3AUO A;  5DKW A;  1ZQX A;  3K7D A;  1JMS A;  3QA8 A;  4NXW A;  1OAO A;  2Z0N A;  3LMF A;  1X03 A;  8ICO A;  4KIK B;  3VEB A;  4MKP A;  4WC2 A;  3B53 X;  4QZC A;  4FM3 A;  9ICM A;  2F7P A;  2ZXQ A;  8ICU A;  3LQC B;  3O3N B;  3RJH A;  4QZB A;  4MF8 A;  4DO9 A;  4JNF A;  2BPF A;  1QWN A;  4YMN A;  2QKW A;  4OAF A;  1UET A;  3EJT A;  3QWE A;  2JNK A;  3C2M A;  7ICR A;  5TZV A;  4F5N A;  1I49 A;  4Z6E A;  2EFK A;  4GXK A;  1E2U A;  4LEV A;  4O5E A;  3BVX A;  3HAH A;  4KB6 A;  7ICL A;  5DB7 A;  4RT2 A;  1FA0 A;  4TUQ A;  4GXI A;  5DB9 A;  4EZO A;  3HWT A;  4I1Q A;  4KLT A;  1XSP A;  2BCR A;  8ICN A;  1UPX A;  2YLL A;  2X3W A;  8ICY A;  5J0R A;  3RH4 A;  4EZR A;  4UD5 A;  4QZH A;  2ZH1 A;  3D50 A; 
#chains in the Genus database with same CATH homology
 4JLC A;  4EZQ A;  2PY6 A;  3VEA A;  4R5K A;  3T48 A;  3RV0 A;  3EF2 A;  1W9M A;  4JN4 A;  3VKH A;  4KIK A;  4OAI Z;  3B51 X;  1OA1 A;  2QXL A;  5CFT A;  4KM5 A;  4IWP A;  5CFU A;  4OAH A;  5B3P A;  2N3K A;  4O68 A;  4R5J A;  1E1D A;  4IM2 A;  1GNT A;  3DPQ A;  4EZS A;  4EZT A;  2IHO A;  4EZU A;  4OAG A;  4JL9 A;  1MJG A;  2WIN M;  1GPJ A;  4K9A A;  1JQK A;  5D61 A;  4K98 A;  4K99 A;  4WH5 A;  4EZY A;  4E81 A;  4K96 A;  4IM0 A;  5TKY A;  2B51 A;  4JWI A;  4IWO A;  2LM0 A;  4O67 A;  4JWC A;  2B56 A;  4IWQ A;  3DPO A;  3D2E A;  1E9V A;  4O6A A;  3KAW A;  3GI7 A;  3C7N A;  3T49 A;  2ND0 A;  4EZX A;  4EZZ A;  4NXW A;  4JWD A;  4IW0 A;  4D8J A;  3KDR A;  1DKY A;  1SU8 A;  2X5C A;  3ERC C;  4LEW A;  3T46 A;  4NXU A;  2RT6 A;  5FLE X;  4IM3 A;  4EZN A;  1DKZ A;  3I04 A;  4E3C A;  3OHX M;  2KHO A;  4R5G A;  3ER8 C;  5B3Q A;  4K9B A;  4HR1 B;  4R5L A;  4JWE A;  2B4V A;  4FO1 A;  2NCZ A;  2QFF A;  3NKU A;  1ZYL A;  4B9Q A;  4HY9 A;  3T4A G;  4PO2 A;  4XJE A;  2FCL A;  1GNL A;  4LEZ A;  4JNE A;  3KAV A;  2GAF D;  4WQK A;  4LEY A;  4K97 A;  2Z8Y A;  5CFS A;  4M0M A;  3D2F A;  2ND1 A;  2OBL A;  2YIB A;  3L3O M;  4R5I A;  4EZP A;  1DKX A;  4F01 A;  4EZW A;  4K8V A;  3QNJ A;  3PHZ A;  4NXV A;  2EWR A;  3ZED A;  3K7D A;  3OWG A;  2YI8 A;  4H6H A;  3QA8 A;  1OAO A;  3LMF A;  4KIK B;  3VEB A;  4HX0 A;  4MKP A;  3B53 X;  4UDX X;  3F7W A;  4FM3 A;  3ER9 B;  5D62 A;  3O3M B;  4F00 A;  1OA0 A;  2YIA A;  4WOY A;  4G6Q A;  3B52 X;  3O3N B;  2YI9 A;  5D63 A;  1SU7 A;  4JNF A;  4NPH A;  3T47 A;  4NXX A;  4OAF A;  1SU6 A;  4O69 A;  5CHE A;  4H6I A;  4HR1 A;  3I01 A;  3UIT A;  3O3O B;  2EWF A;  3MCR A;  1SUF A;  1E2U A;  4HYB A;  4JLZ A;  4LEV A;  3FD9 A;  4KB6 A;  2YIV X;  4EZV A;  4EZO A;  4NXT A;  3I39 X;  4UDY X;  1UPX A;  3DPP A;  4JLX A;  2OBM A;  3A98 A;  4N7R A;  4EZR A;  2EX3 B;  1U00 A;  5FIG A;  1GN9 A;  4WQL A;  3RV1 A;  2GA9 D;  2JNS A;  5E84 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...