2GAFD

Crystal structure of the vaccinia polyadenylate polymerase heterodimer (apo form)
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
468
structure length
447
Chain Sequence
NITLKIIETYLGRVPSVNEYHMLKSQARNIQKITVFNKDIFVSLVKKNKKRFFSDVNTSASEIKDRILSYFSKQTQTYNIGKLFTIIELQSVLVTTYTDILGVLTIKAPTSMEELARDMLNSMNVAVIVSSLVKNVNKLMEEYLRRHNKSCICYGSYSLYLINPNIRYGDIDILQTNSRTFLIDLAFLIKFITGNNIILSKIPYLRNYMVIKDENDNHIIDSFNIRQDTMNVVPKIFIDNIYIVDPTFQLLNMIKMFSQIDRLEDLSKDPEKFNARMATMLEYVRYTHGIVFDGKRNNMPMKCIIDENNRIVTVTTKDYFSFKKCLVYLDENVLSSDILDLNADTSCDFESVTNSVYLIHDNIMYTYFSNTILLSDKGKVHEISARGLCAHILLYQMLTSGEYKQCLSDLLNSMMNRDKIPIYSHTERDKKPGRHGFINIEKDIIVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase
publication title Crystal structures of the vaccinia virus polyadenylate polymerase heterodimer: insights into ATP selectivity and processivity.
pubmed doi rcsb
source organism Vaccinia virus
total genus 136
structure length 447
sequence length 468
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2006-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF03296 Pox_polyA_pol Poxvirus poly(A) polymerase nucleotidyltransferase domain
D PF12629 Pox_polyA_pol_C Poxvirus poly(A) polymerase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.320 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 2gafD01
3.30.460.60 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 2gafD03
3ER8C 3ER9B 2GAFD 3OWGA 3ERCC 2GA9D
chains in the Genus database with same CATH superfamily
3JCFA 2OO2A 4FHPA 4EZPA 4QZEA 3ISBA 1ZQBA 8ICHA 3JPNA 9ICIA 8ICTA 4EZZA 1ZQIA 9ICGA 2M2VA 2BCRA 2Z0VA 8ICUA 4M9GA 4PHAA 8ICXA 2ND0A 7ICJA 4TURA 1PX5A 4X4TA 5CA7A 1TQSA 1TQUA 3JZ0A 1R34A 4JLZA 4ATBA 4KLTA 2F7QA 2OBMA 5HRBA 2ZHBA 2B56A 3UXPA 1ZQCA 4WC0A 4FZOA 4F01A 4JNEA 3HJ4A 5J0TA 1SU8A 2Q66A 4M9LA 3OUYA 3TFRA 4LVSA 4IQUA 4FO1A 4HR1A 4K97A 4P2HA 2WINM 4I28A 8ICYA 4O68A 5TZVA 5J2BA 3T47A 1BPXA 4R5KA 3D50A 4QZDA 1MQ3A 1SU7A 8ICIA 5HRHA 1BPEA 5D46A 7ICTA 3D2FA 4QZGA 3RV0A 4UAWA 3L9DA 3OK8A 3AQNA 5CP2A 2BPFA 1JQRA 2ZH8A 2ISOA 3I39X 2F7OA 2OZNB 1ZJNA 4M0AA 3ER8C 1TV9A 3H3AA 2ID1A 2X5CA 4UD5A 5J0WA 3TFSA 4BNEA 1ZQPA 4EEDA 3I2WA 3L3OM 4F5OA 4AZ5A 4RQ6A 4I2DA 5HR9A 4M9HA 3BUDA 4RPZA 1ZQMA 1OA0A 4K99A 3NYBA 5D62A 5B3PA 3MDAA 2P66A 4HYBA 9ICAA 5IIMA 4PO2A 4P4MA 3MBYA 3AU6A 1ZJMA 3C66A 2F18A 2YIAA 3EJSA 4FHWA 3BVVA 4K4IA 4Z6FA 7ICPA 2PY6A 1ZQZA 3BUBA 9ICUA 2ZXQA 4K98A 1R8AA 4UBBA 7ICOA 4TUPA 4O9MA 3CV5A 3CZSA 4AKVA 1QWNA 4I0UA 4X4NA 4FZSA 3VKHA 3BVTA 5IIJA 5CFUA 3BVWA 4RPYA 3H39A 3RJEA 3CK6A 4HX0A 2EFKA 2FMQA 5TKYA 4H6IA 3DPOA 2EFLA 2OW6A 1JQKA 1SUFA 1HTYA 4AZ7A 3OGUA 4WC7A 2ZH4A 1JN3A 2IHMA 1TFYA 2WYHA 1E2UA 4IM2A 4NXTA 5BPCA 4X4RA 4WC5A 4K9AA 4I2JA 3DDGA 9ICRA 4KLQA 2JNKA 3SOGA 4JLCA 3DX3A 4KLMA 2ZH7A 7ICIA 4AZ6A 2B51A 4NM1A 3UITA 1ZQQA 4LEZA 2ZH6A 1WDZA 4K4HA 9ICFA 1R33A 1UEUA 4I2BA 4LT6A 3BVUA 2X3WA 4F5QA 5DECA 4WH5A 4WC6A 3D4YA 2C08A 4D8JA 4NSWA 4PPXA 4PHEA 3GDXA 4X0BA 4I27A 4RQ4A 3JPOA 3KDRA 4YMNA 4I2GA 4I2AA 4I2FA 1ZQWA 3Q0KA 4P4PA 8ICVA 4LEWA 4QZFA 4I2IA 5DDMA 9ICJA 3NKUA 1ZQSA 2YLLA 2HN2A 4FH3A 3O3NB 4KIKB 2ND1A 3VEBA 3KAVA 3BUQA 1F5AA 4WQLA 3UXOA 4PH5A 9ICTA 4IWPA 4IQTA 4PHPA 2RAKA 3ERCC 4OAGA 3SYVA 4M47A 1XSNA 3AQMA 4X4PA 1HUZA 3HWTA 4JNFA 4WQKA 2YL6A 4K4GA 4RPXA 1O7DC 8ICLA 4EZTA 1U00A 3DDFA 3H37A 2Q12A 2ISPA 2YL9A 4UAZA 3JYYA 4IWOA 5FIGA 5HHIA 3JPSA 8ICQA 2V0OA 3L3PA 5DKWA 2EX3B 4R5GA 4ATBB 3BLBA 2M2WA 4UB1A 3AQKA 1ZQFA 4WOYA 5DB7A 2O5AA 4RWOA 5CJ7A 4RWNA 4EZUA 1TQWA 1E9VA 1QX1A 4QZHA 2X3XA 5J0XA 3OUYB 4IWQA 4KLSA 4HR1B 8ICFA 1GNLA 1ZQYA 8ICKA 1TFWA 4KLOA 3G9GA 2D4CA 3RJKA 3B0YA 3T46A 3JPQA 2GWSA 1MIYA 3MDCA 4MFCA 2F1BA 4N7RA 4X4OA 2F7PA 3V7JA 4R5JA 3GI7A 4JN4A 4M0MA 4Z6DA 3AU2A 4EZNA 1LQ7A 1ZQVA 1URUA 3OVAA 2IHOA 5J0OA 2O0I1 4EZSA 2PFNA 4YCXA 2YIVX 3ER9B 4H8SA 3HX0A 2F1AA 5J2HA 3DYTA 3RV1A 5J29A 4QZAA 5FLEX 4E8FA 3DPPA 4YN4A 4TUQA 4RT2A 1BPZA 5F2VO 8ICGA 4KLLA 3BUPA 4X4UA 1TVAA 4RWPA 2RT6A 5J0RA 8ICNA 4AT9A 3C5FA 3RJFA 1V4AA 1E1DA 1KDHA 2M2TA 4DCNC 3PLTA 7ICRA 2DR9A 3MGIA 4IW0A 4EBJA 5C5BA 1HWWA 3C2MA 2YL5A 2FYVA 5IIKA 2IUBA 4PHDA 4LEYA 2JNSA 4F5NA 4MFAA 4TUSA 7ICSA 3RJHA 4EZWA 1X03A 2FICA 5J0SA 4GXJA 3EJQA 3D2EA 3DPQA 3LVTA 4HY9A 1WOTA 4JWNA 4LZDA 1UEVA 4EZQA 3C2KA 1R8CA 1ZQLA 9ICSA 5E84A 3D51A 5D63A 5DDYA 8ICBA 1DKYA 1ZYLA 3C18A 7ICFA 3CZNA 4I29A 5DBCA 3B52X 4K8VA 3NWIA 5J0UA 4UDXX 4UB3A 3HJ1A 4G6QA 5HC9A 4AT7A 2QFFA 4X4VA 5HREA 2LXYA 3WFOA 4IQWA 3BVXA 4NLZA 4KLUA 8ICSA 3C5GA 9ICQA 5J2DA 1Y2OA 5DB8A 2W9MA 5CR0A 3CKDA 2GAFD 4M5DA 4XUSA 4I1QA 1OU5A 2FMPA 5HHHA 1I4TA 4EV6A 3AUOA 4RQ3A 4UB4A 8ICOA 2BE3A 8ICMA 4AZHA 4KM5A 8ICCA 3HAIA 3B51X 4NXXA 7ICKA 5J0YA 3JPRA 3A98A 3C2LA 4F5RA 2KHOA 4X4SA 1MJGA 4NXUA 4K9BA 3LK9A 2DRBA 4WPCA 1R89A 1RPLA 2RAIA 1ZQUA 1ZQHA 4UAYA 1KNYA 4NY8A 3H38A 5D61A 5HRGA 3EF2A 4R66A 4IM3A 3T4AG 4E3CA 4QZBA 2PFPA 1XSLA 2DR7A 4AZCA 3CVRA 5J2JA 4KLEA 2YLAA 3QNJA 4E81A 4WPEA 4JL9A 4KLFA 9ICHA 3KAWA 3K7DA 3JPPA 4E80A 3VEAA 4E7XA 4JWCA 9ICPA 1ZQEA 3FD9A 4O69A 2I9GA 9ICOA 9ICLA 4UB5A 2GA9D 5HRFA 7ICGA 3I01A 1VJ7A 4X0AA 9ICCA 4KLHA 4EZYA 4EZXA 4K96A 2EWFA 2O1PA 3D4ZA 4IM0A 4B9QA 3LQCB 3HIYA 4GXIA 4I2CA 5D49A 4NLKA 1OA1A 4X5VA 3DX4A 4I2HA 4FZPA 2NRKA 3OWGA 1MIWA 4JWDA 1JMSA 4WBYA 2BCSA 4M04A 2ZH1A 5J2GA 2HN1A 1ZQAA 1ZQRA 4O6AA 4RQ2A 4AT8A 3V72A 1YWMA 4YMOA 2GF4A 4PGQA 4UD4A 2HHPA 3AQLA 4EZVA 2DVIA 4IG8A 7ICLA 2OW7A 3WFSC 2PBEA 3UPSA 1W9MA 4UDYX 3PHZA 5IILA 9ICBA 9ICXA 3I04A 2Z0OA 4JWIA 4YMMA 4DO9A 4KLJA 2ZHAA 3T48A 3M3WA 3QE6A 4AZIA 1O7DB 3UQ2A 3C7NA 4FHVA 3EJPA 5DB9A 5J2CA 1UPXA 4M2YA 1OAOA 4NXWA 4R63A 2BCVA 2ZH3A 4EBKA 3RH4A 3MCRA 5BOMA 4S3NA 2YI9A 1FA0A 2BBJA 5J0PA 3RJGA 1Q78A 4QZIA 4PGYA 1ZQXA 3V7LA 4OAIZ 4AT9B 7ICQA 2OBLA 3QNIA 4WC1A 5DEDA 5DB6A 3K75D 4PGXA 4R64A 2VANA 4FH5A 3NVOA 3EJTA 5B3QA 5EOZA 4DOCA 2Z0NA 3RPMA 3ISCA 4ATMA 4KB6A 4FM3A 5HRKA 2Z8YA 3CAZA 5C5BB 4XQ8A 4KLDA 3WFQE 5CHGA 3WFPA 5JTGA 7ICVA 1R8BA 3D52A 4M9NA 2YKTA 4OAHA 1ZQTA 1I4DA 2BPCA 2BPGA 3JPTA 4QZ8A 2YL8A 4RT3A 1TQTA 3PMLA 3UXNA 1XSPA 2PXIA 3F7WA 4MKPA 7ICHA 1HXKA 1RZTA 3DX0A 4KLGA 2QKWA 4O5KA 2PFQA 8ICEA 4WC4A 3WFRE 8ICPA 8ICWA 9ICNA 2RFFA 4RWQA 4GXKA 2DR8A 4X4QA 4OAFA 2MI7A 3MGHA 3LMFA 3Q84A 4XRHA 4RQ5A 8ICZA 5J2FA 2QXLA 4R65A 4NQIA 4R5IA 1ZQJA 2NCZA 9ICWA 3ZEDA 1VFGA 4YD2A 4NPHA 4JWMA 4DYLA 4XQ7A 3O3MB 4AT7B 2BCQA 2M2UA 1ZQDA 1BPYA 3OVSA 4H6HA 9ICVA 5IIIA 5DBBA 5BOLA 3RH6A 9ICKA 2B4VA 5J2AA 2BCUA 3ACOA 1GN9A 3RJJA 4F00A 3T49A 8ICRA 9ICMA 2ZH5A 4XA5A 1I4LA 4LEVA 4Z6EA 4WBZA 4MFFA 1MIVA 4FHYA 3ABHA 2DRAA 5CWRA 3HW8A 3PNCA 4RQ0A 4EGWA 5J0QA 5J2KA 5J2IA 4RQ1A 4AZGA 4P4OA 3OHXM 4EZOA 1MQ2A 4DOBA 2Q13A 1TQVA 3LLLA 1YLQA 2N3KA 4NXZA 4Z6CA 1I49A 4EEBA 3EJUA 5D4BA 5HRDA 3V7KA 2EWRA 4NKUA 4DOAA 4LZGA 3DX1A 1ZQKA 4FO6A 7ICMA 8ICJA 1JAJA 1NO5A 8ICAA 4NM2A 5HRLA 5IINA 1ZQOA 1X04A 2YIBA 1R5EA 3HAHA 2WYIA 2FCLA 1ZQNA 1UETA 4AZCB 4AZBA 4EZRA 4QZ9A 7ICNA 5IIOA 3B0XA 5CFTA 1SU6A 2YI8A 4F5PA 3UQ0A 5CB1A 4O67A 5HRIA 5DBAA 2BBHA 4YD1A 5KBPA 4JWEA 2F7RA 5CHEA 4UBCA 4EP7A 3ISDA 3OV7A 3BUIA 4JLXA 2PFOA 2X3VA 1NOMA 2FMSA 4O5CA 2LM0A 9ICEA 4FHXA 3DX2A 4XJEA 4O5EA 3RH5A 4UB2A 3QWEA 1ZQGA 4NKTA 4I2EA 1DKZA 3HAJA 4AVMA 4RQ7A 2DR5A 4WCWA 4KLIA 4WC3A 4MF8A 2D1LA 1KEJA 2ZH2A 3OVBA 1GNTA 4AT8B 4IQVA 4M9JA 1GPJA 3UPQA 1Q79A 7ICUA 4WC2A 2ELBA 1QWUA 1BPDA 2ALWA 1ZWWA 3QA8A 1PS3A 3PMNA 5J2EA 4NXVA 4MF2A 4QZCA 1BPBA 3EJRA 3O3OB 1HUOA 3B53X 2PMRA 2RAJA 5CFSA 4R5LA 2ZH9A 1DKXA 4KIKA 3RJIA 4RQ8A 7ICEA 4NLNA
chains in the Genus database with same CATH topology
1DKYA 1ZYLA 4EZPA 3B52X 4K8VA 4UDXX 4WH5A 4OAHA 4G6QA 4EZZA 4D8JA 2QFFA 3KDRA 3F7WA 4MKPA 2ND0A 4LEWA 3NKUA 4JLZA 2GAFD 3O3NB 4KIKB 2ND1A 3VEBA 3KAVA 2OBMA 4OAFA 4WQLA 3LMFA 2B56A 4IWPA 4F01A 4JNEA 2QXLA 3ERCC 4OAGA 4R5IA 1SU8A 2NCZA 3ZEDA 4NPHA 4FO1A 4HR1A 4JNFA 4WQKA 4KM5A 2WINM 3O3MB 4K97A 4O68A 4NXXA 3B51X 4H6HA 4EZTA 3T47A 1U00A 3A98A 4R5KA 2KHOA 4K9BA 1MJGA 4NXUA 2B4VA 4IWOA 5FIGA 1GN9A 4F00A 3T49A 1SU7A 2EX3B 4R5GA 5D61A 3EF2A 4LEVA 3D2FA 4IM3A 3T4AG 4E3CA 3RV0A 4WOYA 3QNJA 4E81A 4EZUA 1E9VA 4JL9A 3I39X 3ER8C 2X5CA 3KAWA 3K7DA 4IWQA 3OHXM 4HR1B 4EZOA 1GNLA 3VEAA 4JWCA 2N3KA 3FD9A 4O69A 3L3OM 2GA9D 3T46A 3I01A 2EWRA 4N7RA 4EZYA 4EZXA 4R5JA 1OA0A 3GI7A 4JN4A 2EWFA 5D62A 5B3PA 4K96A 4K99A 4IM0A 4B9QA 4M0MA 4HYBA 2YIBA 1OA1A 2FCLA 4EZNA 4PO2A 4EZRA 3OWGA 2IHOA 5CFTA 1SU6A 2YI8A 2YIAA 4JWDA 4EZSA 4O67A 2YIVX 3ER9B 2PY6A 3RV1A 4O6AA 4K98A 5FLEX 3DPPA 4JWEA 5CHEA 2RT6A 4EZVA 4JLXA 1E1DA 1W9MA 4UDYX 2LM0A 3PHZA 3I04A 4JWIA 3VKHA 5CFUA 3T48A 4XJEA 4IW0A 3C7NA 1DKZA 4HX0A 5TKYA 3DPOA 1UPXA 4H6IA 1JQKA 1OAOA 1SUFA 4NXWA 4LEYA 1GNTA 2JNSA 3MCRA 1E2UA 2YI9A 1GPJA 4EZWA 4IM2A 4NXTA 3QA8A 4OAIZ 4K9AA 4NXVA 2OBLA 4JLCA 3D2EA 3DPQA 3B53X 3O3OB 4HY9A 5CFSA 4R5LA 4EZQA 2B51A 5B3QA 1DKXA 5E84A 4KIKA 3UITA 5D63A 4LEZA 4KB6A 4FM3A 2Z8YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ER8 C;  3ER9 B;  2GAF D;  3OWG A;  3ERC C;  2GA9 D; 
#chains in the Genus database with same CATH topology
 3JCF A;  2OO2 A;  4FHP A;  4EZP A;  4QZE A;  3ISB A;  1ZQB A;  8ICH A;  3JPN A;  9ICI A;  8ICT A;  4EZZ A;  1ZQI A;  9ICG A;  2M2V A;  2BCR A;  2Z0V A;  8ICU A;  4M9G A;  4PHA A;  8ICX A;  2ND0 A;  7ICJ A;  4TUR A;  1PX5 A;  4X4T A;  5CA7 A;  1TQS A;  1TQU A;  3JZ0 A;  1R34 A;  4JLZ A;  4ATB A;  4KLT A;  2F7Q A;  2OBM A;  5HRB A;  2ZHB A;  2B56 A;  3UXP A;  1ZQC A;  4WC0 A;  4FZO A;  4F01 A;  4JNE A;  3HJ4 A;  5J0T A;  1SU8 A;  2Q66 A;  4M9L A;  3OUY A;  3TFR A;  4LVS A;  4IQU A;  4FO1 A;  4HR1 A;  4K97 A;  4P2H A;  2WIN M;  4I28 A;  8ICY A;  4O68 A;  5TZV A;  5J2B A;  3T47 A;  1BPX A;  4R5K A;  3D50 A;  4QZD A;  1MQ3 A;  1SU7 A;  8ICI A;  5HRH A;  1BPE A;  5D46 A;  7ICT A;  3D2F A;  4QZG A;  3RV0 A;  4UAW A;  3L9D A;  3OK8 A;  3AQN A;  5CP2 A;  2BPF A;  1JQR A;  2ZH8 A;  2ISO A;  3I39 X;  2F7O A;  2OZN B;  1ZJN A;  4M0A A;  3ER8 C;  1TV9 A;  3H3A A;  2ID1 A;  2X5C A;  4UD5 A;  5J0W A;  3TFS A;  4BNE A;  1ZQP A;  4EED A;  3I2W A;  3L3O M;  4F5O A;  4AZ5 A;  4RQ6 A;  4I2D A;  5HR9 A;  4M9H A;  3BUD A;  4RPZ A;  1ZQM A;  1OA0 A;  4K99 A;  3NYB A;  5D62 A;  5B3P A;  3MDA A;  2P66 A;  4HYB A;  9ICA A;  5IIM A;  4PO2 A;  4P4M A;  3MBY A;  3AU6 A;  1ZJM A;  3C66 A;  2F18 A;  2YIA A;  3EJS A;  4FHW A;  3BVV A;  4K4I A;  4Z6F A;  7ICP A;  2PY6 A;  1ZQZ A;  3BUB A;  9ICU A;  2ZXQ A;  4K98 A;  1R8A A;  4UBB A;  7ICO A;  4TUP A;  4O9M A;  3CV5 A;  3CZS A;  4AKV A;  1QWN A;  4I0U A;  4X4N A;  4FZS A;  3VKH A;  3BVT A;  5IIJ A;  5CFU A;  3BVW A;  4RPY A;  3H39 A;  3RJE A;  3CK6 A;  4HX0 A;  2EFK A;  2FMQ A;  5TKY A;  4H6I A;  3DPO A;  2EFL A;  2OW6 A;  1JQK A;  1SUF A;  1HTY A;  4AZ7 A;  3OGU A;  4WC7 A;  2ZH4 A;  1JN3 A;  2IHM A;  1TFY A;  2WYH A;  1E2U A;  4IM2 A;  4NXT A;  5BPC A;  4X4R A;  4WC5 A;  4K9A A;  4I2J A;  3DDG A;  9ICR A;  4KLQ A;  2JNK A;  3SOG A;  4JLC A;  3DX3 A;  4KLM A;  2ZH7 A;  7ICI A;  4AZ6 A;  2B51 A;  4NM1 A;  3UIT A;  1ZQQ A;  4LEZ A;  2ZH6 A;  1WDZ A;  4K4H A;  9ICF A;  1R33 A;  1UEU A;  4I2B A;  4LT6 A;  3BVU A;  2X3W A;  4F5Q A;  5DEC A;  4WH5 A;  4WC6 A;  3D4Y A;  2C08 A;  4D8J A;  4NSW A;  4PPX A;  4PHE A;  3GDX A;  4X0B A;  4I27 A;  4RQ4 A;  3JPO A;  3KDR A;  4YMN A;  4I2G A;  4I2A A;  4I2F A;  1ZQW A;  3Q0K A;  4P4P A;  8ICV A;  4LEW A;  4QZF A;  4I2I A;  5DDM A;  9ICJ A;  3NKU A;  1ZQS A;  2YLL A;  2HN2 A;  4FH3 A;  3O3N B;  4KIK B;  2ND1 A;  3VEB A;  3KAV A;  3BUQ A;  1F5A A;  4WQL A;  3UXO A;  4PH5 A;  9ICT A;  4IWP A;  4IQT A;  4PHP A;  2RAK A;  3ERC C;  4OAG A;  3SYV A;  4M47 A;  1XSN A;  3AQM A;  4X4P A;  1HUZ A;  3HWT A;  4JNF A;  4WQK A;  2YL6 A;  4K4G A;  4RPX A;  1O7D C;  8ICL A;  4EZT A;  1U00 A;  3DDF A;  3H37 A;  2Q12 A;  2ISP A;  2YL9 A;  4UAZ A;  3JYY A;  4IWO A;  5FIG A;  5HHI A;  3JPS A;  8ICQ A;  2V0O A;  3L3P A;  5DKW A;  2EX3 B;  4R5G A;  4ATB B;  3BLB A;  2M2W A;  4UB1 A;  3AQK A;  1ZQF A;  4WOY A;  5DB7 A;  2O5A A;  4RWO A;  5CJ7 A;  4RWN A;  4EZU A;  1TQW A;  1E9V A;  1QX1 A;  4QZH A;  2X3X A;  5J0X A;  3OUY B;  4IWQ A;  4KLS A;  4HR1 B;  8ICF A;  1GNL A;  1ZQY A;  8ICK A;  1TFW A;  4KLO A;  3G9G A;  2D4C A;  3RJK A;  3B0Y A;  3T46 A;  3JPQ A;  2GWS A;  1MIY A;  3MDC A;  4MFC A;  2F1B A;  4N7R A;  4X4O A;  2F7P A;  3V7J A;  4R5J A;  3GI7 A;  4JN4 A;  4M0M A;  4Z6D A;  3AU2 A;  4EZN A;  1LQ7 A;  1ZQV A;  1URU A;  3OVA A;  2IHO A;  5J0O A;  2O0I 1;  4EZS A;  2PFN A;  4YCX A;  2YIV X;  3ER9 B;  4H8S A;  3HX0 A;  2F1A A;  5J2H A;  3DYT A;  3RV1 A;  5J29 A;  4QZA A;  5FLE X;  4E8F A;  3DPP A;  4YN4 A;  4TUQ A;  4RT2 A;  1BPZ A;  5F2V O;  8ICG A;  4KLL A;  3BUP A;  4X4U A;  1TVA A;  4RWP A;  2RT6 A;  5J0R A;  8ICN A;  4AT9 A;  3C5F A;  3RJF A;  1V4A A;  1E1D A;  1KDH A;  2M2T A;  4DCN C;  3PLT A;  7ICR A;  2DR9 A;  3MGI A;  4IW0 A;  4EBJ A;  5C5B A;  1HWW A;  3C2M A;  2YL5 A;  2FYV A;  5IIK A;  2IUB A;  4PHD A;  4LEY A;  2JNS A;  4F5N A;  4MFA A;  4TUS A;  7ICS A;  3RJH A;  4EZW A;  1X03 A;  2FIC A;  5J0S A;  4GXJ A;  3EJQ A;  3D2E A;  3DPQ A;  3LVT A;  4HY9 A;  1WOT A;  4JWN A;  4LZD A;  1UEV A;  4EZQ A;  3C2K A;  1R8C A;  1ZQL A;  9ICS A;  5E84 A;  3D51 A;  5D63 A;  5DDY A;  8ICB A;  1DKY A;  1ZYL A;  3C18 A;  7ICF A;  3CZN A;  4I29 A;  5DBC A;  3B52 X;  4K8V A;  3NWI A;  5J0U A;  4UDX X;  4UB3 A;  3HJ1 A;  4G6Q A;  5HC9 A;  4AT7 A;  2QFF A;  4X4V A;  5HRE A;  2LXY A;  3WFO A;  4IQW A;  3BVX A;  4NLZ A;  4KLU A;  8ICS A;  3C5G A;  9ICQ A;  5J2D A;  1Y2O A;  5DB8 A;  2W9M A;  5CR0 A;  3CKD A;  2GAF D;  4M5D A;  4XUS A;  4I1Q A;  1OU5 A;  2FMP A;  5HHH A;  1I4T A;  4EV6 A;  3AUO A;  4RQ3 A;  4UB4 A;  8ICO A;  2BE3 A;  8ICM A;  4AZH A;  4KM5 A;  8ICC A;  3HAI A;  3B51 X;  4NXX A;  7ICK A;  5J0Y A;  3JPR A;  3A98 A;  3C2L A;  4F5R A;  2KHO A;  4X4S A;  1MJG A;  4NXU A;  4K9B A;  3LK9 A;  2DRB A;  4WPC A;  1R89 A;  1RPL A;  2RAI A;  1ZQU A;  1ZQH A;  4UAY A;  1KNY A;  4NY8 A;  3H38 A;  5D61 A;  5HRG A;  3EF2 A;  4R66 A;  4IM3 A;  3T4A G;  4E3C A;  4QZB A;  2PFP A;  1XSL A;  2DR7 A;  4AZC A;  3CVR A;  5J2J A;  4KLE A;  2YLA A;  3QNJ A;  4E81 A;  4WPE A;  4JL9 A;  4KLF A;  9ICH A;  3KAW A;  3K7D A;  3JPP A;  4E80 A;  3VEA A;  4E7X A;  4JWC A;  9ICP A;  1ZQE A;  3FD9 A;  4O69 A;  2I9G A;  9ICO A;  9ICL A;  4UB5 A;  2GA9 D;  5HRF A;  7ICG A;  3I01 A;  1VJ7 A;  4X0A A;  9ICC A;  4KLH A;  4EZY A;  4EZX A;  4K96 A;  2EWF A;  2O1P A;  3D4Z A;  4IM0 A;  4B9Q A;  3LQC B;  3HIY A;  4GXI A;  4I2C A;  5D49 A;  4NLK A;  1OA1 A;  4X5V A;  3DX4 A;  4I2H A;  4FZP A;  2NRK A;  3OWG A;  1MIW A;  4JWD A;  1JMS A;  4WBY A;  2BCS A;  4M04 A;  2ZH1 A;  5J2G A;  2HN1 A;  1ZQA A;  1ZQR A;  4O6A A;  4RQ2 A;  4AT8 A;  3V72 A;  1YWM A;  4YMO A;  2GF4 A;  4PGQ A;  4UD4 A;  2HHP A;  3AQL A;  4EZV A;  2DVI A;  4IG8 A;  7ICL A;  2OW7 A;  3WFS C;  2PBE A;  3UPS A;  1W9M A;  4UDY X;  3PHZ A;  5IIL A;  9ICB A;  9ICX A;  3I04 A;  2Z0O A;  4JWI A;  4YMM A;  4DO9 A;  4KLJ A;  2ZHA A;  3T48 A;  3M3W A;  3QE6 A;  4AZI A;  1O7D B;  3UQ2 A;  3C7N A;  4FHV A;  3EJP A;  5DB9 A;  5J2C A;  1UPX A;  4M2Y A;  1OAO A;  4NXW A;  4R63 A;  2BCV A;  2ZH3 A;  4EBK A;  3RH4 A;  3MCR A;  5BOM A;  4S3N A;  2YI9 A;  1FA0 A;  2BBJ A;  5J0P A;  3RJG A;  1Q78 A;  4QZI A;  4PGY A;  1ZQX A;  3V7L A;  4OAI Z;  4AT9 B;  7ICQ A;  2OBL A;  3QNI A;  4WC1 A;  5DED A;  5DB6 A;  3K75 D;  4PGX A;  4R64 A;  2VAN A;  4FH5 A;  3NVO A;  3EJT A;  5B3Q A;  5EOZ A;  4DOC A;  2Z0N A;  3RPM A;  3ISC A;  4ATM A;  4KB6 A;  4FM3 A;  5HRK A;  2Z8Y A;  3CAZ A;  5C5B B;  4XQ8 A;  4KLD A;  3WFQ E;  5CHG A;  3WFP A;  5JTG A;  7ICV A;  1R8B A;  3D52 A;  4M9N A;  2YKT A;  4OAH A;  1ZQT A;  1I4D A;  2BPC A;  2BPG A;  3JPT A;  4QZ8 A;  2YL8 A;  4RT3 A;  1TQT A;  3PML A;  3UXN A;  1XSP A;  2PXI A;  3F7W A;  4MKP A;  7ICH A;  1HXK A;  1RZT A;  3DX0 A;  4KLG A;  2QKW A;  4O5K A;  2PFQ A;  8ICE A;  4WC4 A;  3WFR E;  8ICP A;  8ICW A;  9ICN A;  2RFF A;  4RWQ A;  4GXK A;  2DR8 A;  4X4Q A;  4OAF A;  2MI7 A;  3MGH A;  3LMF A;  3Q84 A;  4XRH A;  4RQ5 A;  8ICZ A;  5J2F A;  2QXL A;  4R65 A;  4NQI A;  4R5I A;  1ZQJ A;  2NCZ A;  9ICW A;  3ZED A;  1VFG A;  4YD2 A;  4NPH A;  4JWM A;  4DYL A;  4XQ7 A;  3O3M B;  4AT7 B;  2BCQ A;  2M2U A;  1ZQD A;  1BPY A;  3OVS A;  4H6H A;  9ICV A;  5III A;  5DBB A;  5BOL A;  3RH6 A;  9ICK A;  2B4V A;  5J2A A;  2BCU A;  3ACO A;  1GN9 A;  3RJJ A;  4F00 A;  3T49 A;  8ICR A;  9ICM A;  2ZH5 A;  4XA5 A;  1I4L A;  4LEV A;  4Z6E A;  4WBZ A;  4MFF A;  1MIV A;  4FHY A;  3ABH A;  2DRA A;  5CWR A;  3HW8 A;  3PNC A;  4RQ0 A;  4EGW A;  5J0Q A;  5J2K A;  5J2I A;  4RQ1 A;  4AZG A;  4P4O A;  3OHX M;  4EZO A;  1MQ2 A;  4DOB A;  2Q13 A;  1TQV A;  3LLL A;  1YLQ A;  2N3K A;  4NXZ A;  4Z6C A;  1I49 A;  4EEB A;  3EJU A;  5D4B A;  5HRD A;  3V7K A;  2EWR A;  4NKU A;  4DOA A;  4LZG A;  3DX1 A;  1ZQK A;  4FO6 A;  7ICM A;  8ICJ A;  1JAJ A;  1NO5 A;  8ICA A;  4NM2 A;  5HRL A;  5IIN A;  1ZQO A;  1X04 A;  2YIB A;  1R5E A;  3HAH A;  2WYI A;  2FCL A;  1ZQN A;  1UET A;  4AZC B;  4AZB A;  4EZR A;  4QZ9 A;  7ICN A;  5IIO A;  3B0X A;  5CFT A;  1SU6 A;  2YI8 A;  4F5P A;  3UQ0 A;  5CB1 A;  4O67 A;  5HRI A;  5DBA A;  2BBH A;  4YD1 A;  5KBP A;  4JWE A;  2F7R A;  5CHE A;  4UBC A;  4EP7 A;  3ISD A;  3OV7 A;  3BUI A;  4JLX A;  2PFO A;  2X3V A;  1NOM A;  2FMS A;  4O5C A;  2LM0 A;  9ICE A;  4FHX A;  3DX2 A;  4XJE A;  4O5E A;  3RH5 A;  4UB2 A;  3QWE A;  1ZQG A;  4NKT A;  4I2E A;  1DKZ A;  3HAJ A;  4AVM A;  4RQ7 A;  2DR5 A;  4WCW A;  4KLI A;  4WC3 A;  4MF8 A;  2D1L A;  1KEJ A;  2ZH2 A;  3OVB A;  1GNT A;  4AT8 B;  4IQV A;  4M9J A;  1GPJ A;  3UPQ A;  1Q79 A;  7ICU A;  4WC2 A;  2ELB A;  1QWU A;  1BPD A;  2ALW A;  1ZWW A;  3QA8 A;  1PS3 A;  3PMN A;  5J2E A;  4NXV A;  4MF2 A;  4QZC A;  1BPB A;  3EJR A;  3O3O B;  1HUO A;  3B53 X;  2PMR A;  2RAJ A;  5CFS A;  4R5L A;  2ZH9 A;  1DKX A;  4KIK A;  3RJI A;  4RQ8 A;  7ICE A;  4NLN A; 
#chains in the Genus database with same CATH homology
 1DKY A;  1ZYL A;  4EZP A;  3B52 X;  4K8V A;  4UDX X;  4WH5 A;  4OAH A;  4G6Q A;  4EZZ A;  4D8J A;  2QFF A;  3KDR A;  3F7W A;  4MKP A;  2ND0 A;  4LEW A;  3NKU A;  4JLZ A;  2GAF D;  3O3N B;  4KIK B;  2ND1 A;  3VEB A;  3KAV A;  2OBM A;  4OAF A;  4WQL A;  3LMF A;  2B56 A;  4IWP A;  4F01 A;  4JNE A;  2QXL A;  3ERC C;  4OAG A;  4R5I A;  1SU8 A;  2NCZ A;  3ZED A;  4NPH A;  4FO1 A;  4HR1 A;  4JNF A;  4WQK A;  4KM5 A;  2WIN M;  3O3M B;  4K97 A;  4O68 A;  4NXX A;  3B51 X;  4H6H A;  4EZT A;  3T47 A;  1U00 A;  3A98 A;  4R5K A;  2KHO A;  4K9B A;  1MJG A;  4NXU A;  2B4V A;  4IWO A;  5FIG A;  1GN9 A;  4F00 A;  3T49 A;  1SU7 A;  2EX3 B;  4R5G A;  5D61 A;  3EF2 A;  4LEV A;  3D2F A;  4IM3 A;  3T4A G;  4E3C A;  3RV0 A;  4WOY A;  3QNJ A;  4E81 A;  4EZU A;  1E9V A;  4JL9 A;  3I39 X;  3ER8 C;  2X5C A;  3KAW A;  3K7D A;  4IWQ A;  3OHX M;  4HR1 B;  4EZO A;  1GNL A;  3VEA A;  4JWC A;  2N3K A;  3FD9 A;  4O69 A;  3L3O M;  2GA9 D;  3T46 A;  3I01 A;  2EWR A;  4N7R A;  4EZY A;  4EZX A;  4R5J A;  1OA0 A;  3GI7 A;  4JN4 A;  2EWF A;  5D62 A;  5B3P A;  4K96 A;  4K99 A;  4IM0 A;  4B9Q A;  4M0M A;  4HYB A;  2YIB A;  1OA1 A;  2FCL A;  4EZN A;  4PO2 A;  4EZR A;  3OWG A;  2IHO A;  5CFT A;  1SU6 A;  2YI8 A;  2YIA A;  4JWD A;  4EZS A;  4O67 A;  2YIV X;  3ER9 B;  2PY6 A;  3RV1 A;  4O6A A;  4K98 A;  5FLE X;  3DPP A;  4JWE A;  5CHE A;  2RT6 A;  4EZV A;  4JLX A;  1E1D A;  1W9M A;  4UDY X;  2LM0 A;  3PHZ A;  3I04 A;  4JWI A;  3VKH A;  5CFU A;  3T48 A;  4XJE A;  4IW0 A;  3C7N A;  1DKZ A;  4HX0 A;  5TKY A;  3DPO A;  1UPX A;  4H6I A;  1JQK A;  1OAO A;  1SUF A;  4NXW A;  4LEY A;  1GNT A;  2JNS A;  3MCR A;  1E2U A;  2YI9 A;  1GPJ A;  4EZW A;  4IM2 A;  4NXT A;  3QA8 A;  4OAI Z;  4K9A A;  4NXV A;  2OBL A;  4JLC A;  3D2E A;  3DPQ A;  3B53 X;  3O3O B;  4HY9 A;  5CFS A;  4R5L A;  4EZQ A;  2B51 A;  5B3Q A;  1DKX A;  5E84 A;  4KIK A;  3UIT A;  5D63 A;  4LEZ A;  4KB6 A;  4FM3 A;  2Z8Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...