2GAFD

Crystal structure of the vaccinia polyadenylate polymerase heterodimer (apo form)
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
468
structure length
447
Chain Sequence
b'NITLKIIETYLGRVPSVNEYHMLKSQARNIQKITVFNKDIFVSLVKKNKKRFFSDVNTSASEIKDRILSYFSKQTQTYNIGKLFTIIELQSVLVTTYTDILGVLTIKAPTSMEELARDMLNSMNVAVIVSSLVKNVNKLMEEYLRRHNKSCICYGSYSLYLINPNIRYGDIDILQTNSRTFLIDLAFLIKFITGNNIILSKIPYLRNYMVIKDENDNHIIDSFNIRQDTMNVVPKIFIDNIYIVDPTFQLLNMIKMFSQIDRLEDLSKDPEKFNARMATMLEYVRYTHGIVFDGKRNNMPMKCIIDENNRIVTVTTKDYFSFKKCLVYLDENVLSSDILDLNADTSCDFESVTNSVYLIHDNIMYTYFSNTILLSDKGKVHEISARGLCAHILLYQMLTSGEYKQCLSDLLNSMMNRDKIPIYSHTERDKKPGRHGFINIEKDIIVF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase
publication title Crystal structures of the vaccinia virus polyadenylate polymerase heterodimer: insights into ATP selectivity and processivity.
pubmed doi rcsb
source organism Vaccinia virus
molecule tags Transferase
total genus 136
structure length 447
sequence length 468
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2006-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF03296 Pox_polyA_pol Poxvirus poly(A) polymerase nucleotidyltransferase domain
D PF12629 Pox_polyA_pol_C Poxvirus poly(A) polymerase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.320 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 2gafD01
3.30.460.60 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 2gafD03
3OWGA 3ER9B 3ERCC 2GAFD 3ER8C 2GA9D
chains in the Genus database with same CATH superfamily
2Z0VA 4EZOA 2BPCA 4P4OA 4QZ8A 3EJPA 4Z6CA 5J2JA 1ZQYA 1ZQHA 2EFLA 4PPXA 3MCRA 2X3XA 1OAOA 1SUFA 4EZPA 5CR0A 4KLTA 4KLOA 2ZH9A 4KLIA 2OO2A 4F00A 5HRBA 9ICXA 3D50A 4DOAA 3OUYA 3AUOA 3G9GA 9ICLA 4E8FA 2ND0A 2DR8A 4MF8A 9ICQA 3V7KA 4PO2A 5F2VO 4I2CA 1GPJA 2OZNB 2EWFA 4WH5A 3WFRE 2ZH8A 4R5KA 1QWUA 5FIGA 3OVSA 1MQ3A 4DOBA 2ISOA 3JPRA 8ICKA 1TV9A 4MKPA 8ICGA 3K7DA 4YMOA 3LQCB 2DR7A 1ZQDA 3LVTA 4B9QA 7ICQA 4R64A 4QZDA 1R8AA 2DRAA 3D52A 1OU5A 4NY8A 4F5OA 1F5AA 2F1BA 3VKHA 5HC9A 1ZQEA 3QA8A 2KHOA 4FZOA 7ICTA 3Q84A 4FHVA 4AKVA 3QNIA 2B51A 4WBYA 5D46A 7ICSA 4PGXA 4NXUA 2ELBA 4WOYA 4EBJA 3BUDA 3PHZA 2O0I1 4KLGA 3DX4A 2D4CA 1TQWA 4IM0A 4WC3A 1ZQQA 5J0PA 4IM3A 3MDAA 3CZSA 4EZSA 8ICNA 4KIKB 4WQKA 2OW7A 3DX1A 4EZUA 5IIOA 3RJJA 1TQTA 3JZ0A 2RT6A 4UAYA 4K99A 3JPPA 4K96A 3VEBA 5HRIA 4EZNA 9ICFA 3I04A 3I01A 1JQRA 1SU7A 3V7JA 8ICPA 4JNFA 3BVUA 3T46A 7ICRA 9ICEA 1KNYA 4XRHA 4X4RA 4FHWA 3BVWA 5J0UA 1KDHA 5J0XA 4PHEA 4XQ7A 1TQUA 1ZQAA 4OAHA 2ND1A 4P4PA 9ICJA 5DEDA 4EEBA 5D63A 3DPOA 4F5PA 2Q13A 1MIWA 3M3WA 1ZJMA 1HXKA 4KB6A 3CAZA 2RAKA 3UXOA 4AZGA 2YL9A 4UD4A 1TVAA 9ICWA 4TUSA 3OVBA 4HR1B 4RT3A 4WCWA 2HN2A 5CB1A 4R65A 4RQ8A 2ZH2A 4I27A 4KLQA 3UPQA 2WYHA 3ABHA 4KLEA 4LT6A 1ZQMA 2PFQA 1ZQVA 4PHAA 4AT9B 2PFNA 5CHGA 4GXKA 4ATMA 3RJEA 4QZBA 4O5EA 4QZEA 5CFTA 5HRKA 4ATBB 4JWDA 3CZNA 3OV7A 4KLHA 2F18A 2BCSA 8ICZA 1ZQKA 1DKZA 3UXNA 1I4DA 4HY9A 4QZHA 1TQSA 2YLLA 4NLKA 4XA5A 5HHIA 3H37A 2ZH6A 8ICTA 4XQ8A 2QKWA 4NXWA 4JWMA 4IWOA 4UDXX 3AQKA 5DB7A 4AZHA 2HHPA 3SYVA 3H38A 2F1AA 3HAIA 5J2GA 3BVVA 4NXVA 4HX0A 4DCNC 5KBPA 3A98A 2BCUA 4RQ6A 4JNEA 1SU8A 4HR1A 4OAIZ 2Z0OA 4E7XA 3WFPA 3C66A 4YCXA 5B3PA 5DECA 4NLZA 7ICJA 9ICBA 5J2IA 1O7DC 5D61A 1TFYA 3C5GA 2PBEA 3JPTA 4WC7A 4M0AA 1BPDA 4EZZA 4FO1A 1R34A 8ICLA 2M2WA 3Q0KA 4LEVA 3UXPA 3JYYA 1ZQTA 2EFKA 4X4OA 3C5FA 3MGHA 1E1DA 1YLQA 2O5AA 3H39A 3HAHA 4KLUA 3D2EA 3O3NB 3AQNA 4JLXA 4QZGA 1X04A 1UETA 4UD5A 4IQWA 1WOTA 2FMPA 3LLLA 1UPXA 3AQLA 1ZQWA 4EZWA 2Q66A 5IIJA 3RV0A 3AU6A 4M0MA 3HX0A 2GF4A 5C5BA 1ZQSA 1E2UA 4P4MA 4FO6A 5D62A 1HUZA 2YL5A 4FHPA 1R33A 4H6HA 4XJEA 1ZQNA 4KLSA 2OW6A 8ICMA 9ICPA 4NPHA 4EEDA 3BLBA 3OVAA 3WFQE 9ICKA 2DVIA 4JN4A 1HWWA 1MIVA 2FYVA 1RPLA 4UBBA 3D51A 3DYTA 1RZTA 4LEZA 4R63A 4KLJA 3DX3A 2LXYA 3NKUA 4NKTA 3JPNA 3KAVA 4N7RA 4K8VA 4E80A 9ICNA 1ZQGA 4EZTA 1R8BA 4FHXA 4AT7A 3JPOA 3DX0A 1Q78A 4QZAA 2MI7A 3RJHA 4LEWA 3UPSA 4WC2A 2BE3A 1JAJA 5HREA 4AZCB 3RH6A 4P2HA 4R5LA 5J2HA 4I2HA 1XSLA 5CJ7A 1URUA 2O1PA 3VEAA 5JTGA 3QWEA 4IWPA 1BPYA 2FCLA 3OGUA 2F7OA 5CP2A 5J2AA 1X03A 5HRHA 4LEYA 3HJ1A 1ZQXA 9ICUA 4F5QA 8ICEA 3OWGA 1I4LA 2YKTA 2X3WA 1O7DB 4M5DA 3DPQA 4O67A 3T49A 2ZH4A 4K4GA 3QNJA 3DDGA 5J2CA 5D4BA 3BVTA 4JWNA 4D8JA 4MFFA 5EOZA 5HRLA 2PMRA 8ICCA 5DB6A 7ICKA 4IWQA 5J2FA 4KLFA 4UB5A 2YL8A 4IM2A 3RJIA 1ZQCA 2QXLA 2IUBA 4K97A 8ICQA 7ICLA 4G6QA 3EJRA 1XSNA 4JLCA 4O5CA 5CFUA 2M2VA 4TURA 2ZH3A 2VANA 2IHOA 4FM3A 4F5RA 8ICOA 4AZCA 4X0AA 3GDXA 4EZQA 4EGWA 4QZIA 3KDRA 4WC1A 4RQ2A 4XUSA 3D2FA 1LQ7A 4R66A 4NKUA 4OAFA 2LM0A 1TQVA 9ICMA 4IQTA 4NXTA 4AZ6A 3B0YA 2FMQA 3EJTA 2ZHBA 5J0TA 4EV6A 2ZH7A 2EWRA 4MFAA 1XSPA 3PNCA 3EF2A 1ZQRA 3JPQA 2ZXQA 3D4ZA 2P66A 5HRFA 5DBAA 3C18A 1GNTA 4M04A 4AVMA 4IW0A 3FD9A 4IQUA 4AZ7A 4RQ4A 8ICHA 4YD2A 4DYLA 4RQ1A 1MIYA 7ICIA 4JLZA 2W9MA 4FH3A 3RJKA 4M9GA 3CKDA 9ICIA 4RQ3A 2ZHAA 3B0XA 3O3OB 3H3AA 5TKYA 5J2BA 3MBYA 2YIVX 1V4AA 2ZH1A 3RJFA 5J0YA 9ICVA 1ZQJA 4UDYX 4Z6DA 1GN9A 3JPSA 5C5BB 3C2LA 2OBMA 8ICFA 7ICNA 1DKXA 3ERCC 3I39X 3L9DA 4UB3A 2ALWA 3KAWA 1ZQOA 3ER9B 4X4PA 4QZ9A 7ICFA 4K9BA 4WC4A 2RAJA 5CWRA 4RPYA 1HUOA 2DRBA 3T4AG 1ZQBA 1ZYLA 4AT8B 1Y2OA 4EBKA 2GAFD 3C2MA 1PS3A 4I2JA 4X4VA 2OBLA 3B53X 4RWPA 3WFOA 2RAIA 3B52X 2ZH5A 2I9GA 5BOMA 4RPXA 3AQMA 2FMSA 4AT7B 1NOMA 1VJ7A 4YMNA 4TUPA 4M9JA 4PGYA 1R5EA 5BPCA 3GI7A 4FHYA 4S3NA 2BBHA 5J0RA 5IIIA 5J2EA 3NYBA 1JQKA 4M9LA 3MDCA 2BCRA 3CV5A 4NXXA 1R89A 4F01A 4O6AA 2F7PA 3HIYA 3ACOA 3OK8A 4GXIA 1ZQFA 4H8SA 5J29A 5DB9A 5BOLA 4X4SA 4O69A 1QWNA 4RWNA 9ICCA 9ICSA 1UEUA 1QX1A 4PGQA 4I2AA 3ER8C 4AZIA 3PMLA 3RPMA 1BPZA 4GXJA 2JNSA 3F7WA 3LMFA 4MFCA 3O3MB 4AT8A 4IQVA 4WC0A 4I2EA 1U00A 2EX3B 5D49A 2BCVA 3HAJA 4YN4A 4RPZA 4K4HA 1OA1A 4K4IA 1R8CA 4DO9A 7ICVA 3B51X 4AZBA 4LZDA 4HYBA 2WYIA 3JCFA 4NXZA 3K75D 2YIBA 4BNEA 5J0QA 4LVSA 2PXIA 5CFSA 3AU2A 3CK6A 4KLLA 4FZPA 4EZVA 1NO5A 4X5VA 3LK9A 4UAWA 4F5NA 3HWTA 2X3VA 3BUBA 4I1QA 3ISDA 1I4TA 3ZEDA 5HR9A 1DKYA 4R5JA 1JMSA 4RQ5A 4X0BA 1ZQIA 4M47A 3D4YA 2C08A 4NM1A 4FH5A 1SU6A 3V72A 8ICXA 4R5IA 5J2KA 4I2DA 4I2FA 8ICIA 3TFSA 4MF2A 2HN1A 2JNKA 4I2GA 4O68A 4UB4A 2RFFA 1BPXA 2DR5A 8ICYA 9ICGA 4IG8A 4RWQA 2YLAA 4UAZA 9ICOA 1TFWA 5IILA 9ICHA 2Z0NA 4WC6A 3RV1A 4NM2A 1Q79A 4QZFA 3ISCA 5J2DA 4X4TA 4X4UA 3I2WA 1PX5A 3UITA 2GWSA 1OA0A 5CA7A 4NSWA 4TUQA 1E9VA 2NRKA 1MJGA 5CHEA 7ICMA 3DDFA 8ICUA 2FICA 4JWIA 2PY6A 5J0SA 4X4QA 8ICRA 3CVRA 3L3PA 3V7LA 3UQ2A 4JL9A 4RQ0A 3T48A 2ID1A 5TZVA 4NLNA 2IHMA 5IIMA 4PHPA 3QE6A 1UEVA 5DDMA 4FZSA 4AZ5A 4WPEA 4WBZA 4EP7A 2YI9A 3BVXA 3L3OM 4PH5A 1HTYA 2YIAA 5J0OA 4UBCA 8ICVA 9ICRA 4Z6EA 3RH4A 4I2BA 1VFGA 2PFPA 7ICGA 1W9MA 3BUQA 3ISBA 1GNLA 1JN3A 2M2TA 4WQLA 8ICSA 3C7NA 4X4NA 3EJSA 4RWOA 4RT2A 5DBBA 4M2YA 1ZWWA 1FA0A 4DOCA 7ICPA 4K9AA 4M9NA 5IIKA 4QZCA 1ZQUA 2BBJA 1ZJNA 2QFFA 2BPGA 7ICUA 4KIKA 1WDZA 4EZXA 8ICBA 3PLTA 2N3KA 4YMMA 4NQIA 2B4VA 2F7QA 5DB8A 2PFOA 4R5GA 5J0WA 1KEJA 2F7RA 2B56A 5IINA 2BCQA 9ICAA 2YI8A 4I0UA 4KM5A 5FLEX 4M9HA 3DX2A 3NVOA 1BPEA 3TFRA 1YWMA 2X5CA 3BUPA 3BUIA 3C2KA 1ZQLA 4KLMA 8ICAA 1I49A 3SOGA 4LZGA 4WPCA 1BPBA 7ICHA 4OAGA 2D1LA 3EJUA 4K98A 5DBCA 2BPFA 3T47A 2NCZA 4UB1A 4EZYA 3NWIA 4WC5A 4I28A 4JWEA 3PMNA 1ZQPA 3WFSC 5E84A 3EJQA 5B3QA 7ICEA 3OHXM 3OUYB 4PHDA 3RH5A 2WINM 4O9MA 9ICTA 5HHHA 4H6IA 3HW8A 4RQ7A 2M2UA 4KLDA 2V0OA 1ZQZA 5HRGA 4I29A 4JWCA 3HJ4A 2ISPA 1MQ2A 4O5KA 3UQ0A 4E3CA 2DR9A 8ICWA 4UB2A 4YD1A 4I2IA 4AT9A 3MGIA 3RJGA 4EZRA 5DKWA 7ICOA 2YL6A 4ATBA 5HRDA 2Z8YA 4Z6FA 3DPPA 5DDYA 2GA9D 2Q12A 8ICJA 4E81A
chains in the Genus database with same CATH topology
4EZOA 4IWOA 4UDXX 4EZQA 1SU6A 3KDRA 4NXVA 4HX0A 3D2FA 4R5IA 4OAFA 2LM0A 3A98A 3MCRA 4JNEA 1SU8A 4HR1A 4NXTA 4OAIZ 5B3PA 1OAOA 1SUFA 4EZPA 2EWRA 4F00A 3EF2A 4O68A 5D61A 2ND0A 1GNTA 4EZZA 4PO2A 4IW0A 3FD9A 1GPJA 2EWFA 4FO1A 4WH5A 4R5KA 5FIGA 3RV1A 4LEVA 4JLZA 4MKPA 3K7DA 1E1DA 3UITA 1OA0A 3O3OB 5TKYA 4B9QA 1E9VA 2YIVX 1MJGA 3D2EA 3O3NB 5CHEA 4JLXA 4JWIA 4UDYX 1GN9A 2PY6A 2OBMA 3VKHA 1DKXA 3ERCC 3QA8A 1UPXA 2KHOA 3I39X 4JL9A 4E81A 4EZWA 3T48A 3KAWA 3RV0A 2B51A 4M0MA 4NXUA 3ER9B 1E2UA 4WOYA 5D62A 4K9BA 3PHZA 2YI9A 3L3OM 2YIAA 4H6HA 3T4AG 4XJEA 1ZYLA 4NPHA 4IM0A 1W9MA 2GAFD 1GNLA 4WQLA 3C7NA 2OBLA 4IM3A 4JN4A 4EZSA 3B53X 4KIKB 4WQKA 3B52X 4K9AA 4EZUA 2RT6A 4LEZA 4K99A 3NKUA 2QFFA 4K96A 3GI7A 3KAVA 4EZNA 3VEBA 3I04A 4K8VA 3I01A 4KIKA 4EZXA 4N7RA 1SU7A 2N3KA 4EZTA 1JQKA 4JNFA 3T46A 2B4VA 4NXXA 4O6AA 4F01A 4R5GA 4LEWA 2B56A 2YI8A 4KM5A 5FLEX 4OAHA 2ND1A 4O69A 4R5LA 5D63A 3DPOA 2X5CA 4KB6A 3ER8C 3VEAA 4IWPA 2FCLA 4HR1B 4OAGA 2JNSA 3F7WA 3LMFA 4K98A 3T47A 2NCZA 3O3MB 4EZYA 4LEYA 4JWEA 5E84A 1U00A 2EX3B 5B3QA 3OHXM 3OWGA 2WINM 1OA1A 4H6IA 3B51X 3DPQA 4HYBA 3T49A 4O67A 4JWCA 3QNJA 5CFTA 4JWDA 4D8JA 2YIBA 4E3CA 5CFSA 4IWQA 1DKZA 4IM2A 2QXLA 4HY9A 4K97A 4EZVA 4EZRA 4G6QA 4JLCA 2Z8YA 5CFUA 3DPPA 2GA9D 3ZEDA 2IHOA 1DKYA 4R5JA 4FM3A 4NXWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OWG A;  3ER9 B;  3ERC C;  2GAF D;  3ER8 C;  2GA9 D; 
#chains in the Genus database with same CATH topology
 2Z0V A;  4EZO A;  2BPC A;  4P4O A;  4QZ8 A;  3EJP A;  4Z6C A;  5J2J A;  1ZQY A;  1ZQH A;  2EFL A;  4PPX A;  3MCR A;  2X3X A;  1OAO A;  1SUF A;  4EZP A;  5CR0 A;  4KLT A;  4KLO A;  2ZH9 A;  4KLI A;  2OO2 A;  4F00 A;  5HRB A;  9ICX A;  3D50 A;  4DOA A;  3OUY A;  3AUO A;  3G9G A;  9ICL A;  4E8F A;  2ND0 A;  2DR8 A;  4MF8 A;  9ICQ A;  3V7K A;  4PO2 A;  5F2V O;  4I2C A;  1GPJ A;  2OZN B;  2EWF A;  4WH5 A;  3WFR E;  2ZH8 A;  4R5K A;  1QWU A;  5FIG A;  3OVS A;  1MQ3 A;  4DOB A;  2ISO A;  3JPR A;  8ICK A;  1TV9 A;  4MKP A;  8ICG A;  3K7D A;  4YMO A;  3LQC B;  2DR7 A;  1ZQD A;  3LVT A;  4B9Q A;  7ICQ A;  4R64 A;  4QZD A;  1R8A A;  2DRA A;  3D52 A;  1OU5 A;  4NY8 A;  4F5O A;  1F5A A;  2F1B A;  3VKH A;  5HC9 A;  1ZQE A;  3QA8 A;  2KHO A;  4FZO A;  7ICT A;  3Q84 A;  4FHV A;  4AKV A;  3QNI A;  2B51 A;  4WBY A;  5D46 A;  7ICS A;  4PGX A;  4NXU A;  2ELB A;  4WOY A;  4EBJ A;  3BUD A;  3PHZ A;  2O0I 1;  4KLG A;  3DX4 A;  2D4C A;  1TQW A;  4IM0 A;  4WC3 A;  1ZQQ A;  5J0P A;  4IM3 A;  3MDA A;  3CZS A;  4EZS A;  8ICN A;  4KIK B;  4WQK A;  2OW7 A;  3DX1 A;  4EZU A;  5IIO A;  3RJJ A;  1TQT A;  3JZ0 A;  2RT6 A;  4UAY A;  4K99 A;  3JPP A;  4K96 A;  3VEB A;  5HRI A;  4EZN A;  9ICF A;  3I04 A;  3I01 A;  1JQR A;  1SU7 A;  3V7J A;  8ICP A;  4JNF A;  3BVU A;  3T46 A;  7ICR A;  9ICE A;  1KNY A;  4XRH A;  4X4R A;  4FHW A;  3BVW A;  5J0U A;  1KDH A;  5J0X A;  4PHE A;  4XQ7 A;  1TQU A;  1ZQA A;  4OAH A;  2ND1 A;  4P4P A;  9ICJ A;  5DED A;  4EEB A;  5D63 A;  3DPO A;  4F5P A;  2Q13 A;  1MIW A;  3M3W A;  1ZJM A;  1HXK A;  4KB6 A;  3CAZ A;  2RAK A;  3UXO A;  4AZG A;  2YL9 A;  4UD4 A;  1TVA A;  9ICW A;  4TUS A;  3OVB A;  4HR1 B;  4RT3 A;  4WCW A;  2HN2 A;  5CB1 A;  4R65 A;  4RQ8 A;  2ZH2 A;  4I27 A;  4KLQ A;  3UPQ A;  2WYH A;  3ABH A;  4KLE A;  4LT6 A;  1ZQM A;  2PFQ A;  1ZQV A;  4PHA A;  4AT9 B;  2PFN A;  5CHG A;  4GXK A;  4ATM A;  3RJE A;  4QZB A;  4O5E A;  4QZE A;  5CFT A;  5HRK A;  4ATB B;  4JWD A;  3CZN A;  3OV7 A;  4KLH A;  2F18 A;  2BCS A;  8ICZ A;  1ZQK A;  1DKZ A;  3UXN A;  1I4D A;  4HY9 A;  4QZH A;  1TQS A;  2YLL A;  4NLK A;  4XA5 A;  5HHI A;  3H37 A;  2ZH6 A;  8ICT A;  4XQ8 A;  2QKW A;  4NXW A;  4JWM A;  4IWO A;  4UDX X;  3AQK A;  5DB7 A;  4AZH A;  2HHP A;  3SYV A;  3H38 A;  2F1A A;  3HAI A;  5J2G A;  3BVV A;  4NXV A;  4HX0 A;  4DCN C;  5KBP A;  3A98 A;  2BCU A;  4RQ6 A;  4JNE A;  1SU8 A;  4HR1 A;  4OAI Z;  2Z0O A;  4E7X A;  3WFP A;  3C66 A;  4YCX A;  5B3P A;  5DEC A;  4NLZ A;  7ICJ A;  9ICB A;  5J2I A;  1O7D C;  5D61 A;  1TFY A;  3C5G A;  2PBE A;  3JPT A;  4WC7 A;  4M0A A;  1BPD A;  4EZZ A;  4FO1 A;  1R34 A;  8ICL A;  2M2W A;  3Q0K A;  4LEV A;  3UXP A;  3JYY A;  1ZQT A;  2EFK A;  4X4O A;  3C5F A;  3MGH A;  1E1D A;  1YLQ A;  2O5A A;  3H39 A;  3HAH A;  4KLU A;  3D2E A;  3O3N B;  3AQN A;  4JLX A;  4QZG A;  1X04 A;  1UET A;  4UD5 A;  4IQW A;  1WOT A;  2FMP A;  3LLL A;  1UPX A;  3AQL A;  1ZQW A;  4EZW A;  2Q66 A;  5IIJ A;  3RV0 A;  3AU6 A;  4M0M A;  3HX0 A;  2GF4 A;  5C5B A;  1ZQS A;  1E2U A;  4P4M A;  4FO6 A;  5D62 A;  1HUZ A;  2YL5 A;  4FHP A;  1R33 A;  4H6H A;  4XJE A;  1ZQN A;  4KLS A;  2OW6 A;  8ICM A;  9ICP A;  4NPH A;  4EED A;  3BLB A;  3OVA A;  3WFQ E;  9ICK A;  2DVI A;  4JN4 A;  1HWW A;  1MIV A;  2FYV A;  1RPL A;  4UBB A;  3D51 A;  3DYT A;  1RZT A;  4LEZ A;  4R63 A;  4KLJ A;  3DX3 A;  2LXY A;  3NKU A;  4NKT A;  3JPN A;  3KAV A;  4N7R A;  4K8V A;  4E80 A;  9ICN A;  1ZQG A;  4EZT A;  1R8B A;  4FHX A;  4AT7 A;  3JPO A;  3DX0 A;  1Q78 A;  4QZA A;  2MI7 A;  3RJH A;  4LEW A;  3UPS A;  4WC2 A;  2BE3 A;  1JAJ A;  5HRE A;  4AZC B;  3RH6 A;  4P2H A;  4R5L A;  5J2H A;  4I2H A;  1XSL A;  5CJ7 A;  1URU A;  2O1P A;  3VEA A;  5JTG A;  3QWE A;  4IWP A;  1BPY A;  2FCL A;  3OGU A;  2F7O A;  5CP2 A;  5J2A A;  1X03 A;  5HRH A;  4LEY A;  3HJ1 A;  1ZQX A;  9ICU A;  4F5Q A;  8ICE A;  3OWG A;  1I4L A;  2YKT A;  2X3W A;  1O7D B;  4M5D A;  3DPQ A;  4O67 A;  3T49 A;  2ZH4 A;  4K4G A;  3QNJ A;  3DDG A;  5J2C A;  5D4B A;  3BVT A;  4JWN A;  4D8J A;  4MFF A;  5EOZ A;  5HRL A;  2PMR A;  8ICC A;  5DB6 A;  7ICK A;  4IWQ A;  5J2F A;  4KLF A;  4UB5 A;  2YL8 A;  4IM2 A;  3RJI A;  1ZQC A;  2QXL A;  2IUB A;  4K97 A;  8ICQ A;  7ICL A;  4G6Q A;  3EJR A;  1XSN A;  4JLC A;  4O5C A;  5CFU A;  2M2V A;  4TUR A;  2ZH3 A;  2VAN A;  2IHO A;  4FM3 A;  4F5R A;  8ICO A;  4AZC A;  4X0A A;  3GDX A;  4EZQ A;  4EGW A;  4QZI A;  3KDR A;  4WC1 A;  4RQ2 A;  4XUS A;  3D2F A;  1LQ7 A;  4R66 A;  4NKU A;  4OAF A;  2LM0 A;  1TQV A;  9ICM A;  4IQT A;  4NXT A;  4AZ6 A;  3B0Y A;  2FMQ A;  3EJT A;  2ZHB A;  5J0T A;  4EV6 A;  2ZH7 A;  2EWR A;  4MFA A;  1XSP A;  3PNC A;  3EF2 A;  1ZQR A;  3JPQ A;  2ZXQ A;  3D4Z A;  2P66 A;  5HRF A;  5DBA A;  3C18 A;  1GNT A;  4M04 A;  4AVM A;  4IW0 A;  3FD9 A;  4IQU A;  4AZ7 A;  4RQ4 A;  8ICH A;  4YD2 A;  4DYL A;  4RQ1 A;  1MIY A;  7ICI A;  4JLZ A;  2W9M A;  4FH3 A;  3RJK A;  4M9G A;  3CKD A;  9ICI A;  4RQ3 A;  2ZHA A;  3B0X A;  3O3O B;  3H3A A;  5TKY A;  5J2B A;  3MBY A;  2YIV X;  1V4A A;  2ZH1 A;  3RJF A;  5J0Y A;  9ICV A;  1ZQJ A;  4UDY X;  4Z6D A;  1GN9 A;  3JPS A;  5C5B B;  3C2L A;  2OBM A;  8ICF A;  7ICN A;  1DKX A;  3ERC C;  3I39 X;  3L9D A;  4UB3 A;  2ALW A;  3KAW A;  1ZQO A;  3ER9 B;  4X4P A;  4QZ9 A;  7ICF A;  4K9B A;  4WC4 A;  2RAJ A;  5CWR A;  4RPY A;  1HUO A;  2DRB A;  3T4A G;  1ZQB A;  1ZYL A;  4AT8 B;  1Y2O A;  4EBK A;  2GAF D;  3C2M A;  1PS3 A;  4I2J A;  4X4V A;  2OBL A;  3B53 X;  4RWP A;  3WFO A;  2RAI A;  3B52 X;  2ZH5 A;  2I9G A;  5BOM A;  4RPX A;  3AQM A;  2FMS A;  4AT7 B;  1NOM A;  1VJ7 A;  4YMN A;  4TUP A;  4M9J A;  4PGY A;  1R5E A;  5BPC A;  3GI7 A;  4FHY A;  4S3N A;  2BBH A;  5J0R A;  5III A;  5J2E A;  3NYB A;  1JQK A;  4M9L A;  3MDC A;  2BCR A;  3CV5 A;  4NXX A;  1R89 A;  4F01 A;  4O6A A;  2F7P A;  3HIY A;  3ACO A;  3OK8 A;  4GXI A;  1ZQF A;  4H8S A;  5J29 A;  5DB9 A;  5BOL A;  4X4S A;  4O69 A;  1QWN A;  4RWN A;  9ICC A;  9ICS A;  1UEU A;  1QX1 A;  4PGQ A;  4I2A A;  3ER8 C;  4AZI A;  3PML A;  3RPM A;  1BPZ A;  4GXJ A;  2JNS A;  3F7W A;  3LMF A;  4MFC A;  3O3M B;  4AT8 A;  4IQV A;  4WC0 A;  4I2E A;  1U00 A;  2EX3 B;  5D49 A;  2BCV A;  3HAJ A;  4YN4 A;  4RPZ A;  4K4H A;  1OA1 A;  4K4I A;  1R8C A;  4DO9 A;  7ICV A;  3B51 X;  4AZB A;  4LZD A;  4HYB A;  2WYI A;  3JCF A;  4NXZ A;  3K75 D;  2YIB A;  4BNE A;  5J0Q A;  4LVS A;  2PXI A;  5CFS A;  3AU2 A;  3CK6 A;  4KLL A;  4FZP A;  4EZV A;  1NO5 A;  4X5V A;  3LK9 A;  4UAW A;  4F5N A;  3HWT A;  2X3V A;  3BUB A;  4I1Q A;  3ISD A;  1I4T A;  3ZED A;  5HR9 A;  1DKY A;  4R5J A;  1JMS A;  4RQ5 A;  4X0B A;  1ZQI A;  4M47 A;  3D4Y A;  2C08 A;  4NM1 A;  4FH5 A;  1SU6 A;  3V72 A;  8ICX A;  4R5I A;  5J2K A;  4I2D A;  4I2F A;  8ICI A;  3TFS A;  4MF2 A;  2HN1 A;  2JNK A;  4I2G A;  4O68 A;  4UB4 A;  2RFF A;  1BPX A;  2DR5 A;  8ICY A;  9ICG A;  4IG8 A;  4RWQ A;  2YLA A;  4UAZ A;  9ICO A;  1TFW A;  5IIL A;  9ICH A;  2Z0N A;  4WC6 A;  3RV1 A;  4NM2 A;  1Q79 A;  4QZF A;  3ISC A;  5J2D A;  4X4T A;  4X4U A;  3I2W A;  1PX5 A;  3UIT A;  2GWS A;  1OA0 A;  5CA7 A;  4NSW A;  4TUQ A;  1E9V A;  2NRK A;  1MJG A;  5CHE A;  7ICM A;  3DDF A;  8ICU A;  2FIC A;  4JWI A;  2PY6 A;  5J0S A;  4X4Q A;  8ICR A;  3CVR A;  3L3P A;  3V7L A;  3UQ2 A;  4JL9 A;  4RQ0 A;  3T48 A;  2ID1 A;  5TZV A;  4NLN A;  2IHM A;  5IIM A;  4PHP A;  3QE6 A;  1UEV A;  5DDM A;  4FZS A;  4AZ5 A;  4WPE A;  4WBZ A;  4EP7 A;  2YI9 A;  3BVX A;  3L3O M;  4PH5 A;  1HTY A;  2YIA A;  5J0O A;  4UBC A;  8ICV A;  9ICR A;  4Z6E A;  3RH4 A;  4I2B A;  1VFG A;  2PFP A;  7ICG A;  1W9M A;  3BUQ A;  3ISB A;  1GNL A;  1JN3 A;  2M2T A;  4WQL A;  8ICS A;  3C7N A;  4X4N A;  3EJS A;  4RWO A;  4RT2 A;  5DBB A;  4M2Y A;  1ZWW A;  1FA0 A;  4DOC A;  7ICP A;  4K9A A;  4M9N A;  5IIK A;  4QZC A;  1ZQU A;  2BBJ A;  1ZJN A;  2QFF A;  2BPG A;  7ICU A;  4KIK A;  1WDZ A;  4EZX A;  8ICB A;  3PLT A;  2N3K A;  4YMM A;  4NQI A;  2B4V A;  2F7Q A;  5DB8 A;  2PFO A;  4R5G A;  5J0W A;  1KEJ A;  2F7R A;  2B56 A;  5IIN A;  2BCQ A;  9ICA A;  2YI8 A;  4I0U A;  4KM5 A;  5FLE X;  4M9H A;  3DX2 A;  3NVO A;  1BPE A;  3TFR A;  1YWM A;  2X5C A;  3BUP A;  3BUI A;  3C2K A;  1ZQL A;  4KLM A;  8ICA A;  1I49 A;  3SOG A;  4LZG A;  4WPC A;  1BPB A;  7ICH A;  4OAG A;  2D1L A;  3EJU A;  4K98 A;  5DBC A;  2BPF A;  3T47 A;  2NCZ A;  4UB1 A;  4EZY A;  3NWI A;  4WC5 A;  4I28 A;  4JWE A;  3PMN A;  1ZQP A;  3WFS C;  5E84 A;  3EJQ A;  5B3Q A;  7ICE A;  3OHX M;  3OUY B;  4PHD A;  3RH5 A;  2WIN M;  4O9M A;  9ICT A;  5HHH A;  4H6I A;  3HW8 A;  4RQ7 A;  2M2U A;  4KLD A;  2V0O A;  1ZQZ A;  5HRG A;  4I29 A;  4JWC A;  3HJ4 A;  2ISP A;  1MQ2 A;  4O5K A;  3UQ0 A;  4E3C A;  2DR9 A;  8ICW A;  4UB2 A;  4YD1 A;  4I2I A;  4AT9 A;  3MGI A;  3RJG A;  4EZR A;  5DKW A;  7ICO A;  2YL6 A;  4ATB A;  5HRD A;  2Z8Y A;  4Z6F A;  3DPP A;  5DDY A;  2GA9 D;  2Q12 A;  8ICJ A;  4E81 A; 
#chains in the Genus database with same CATH homology
 4EZO A;  4IWO A;  4UDX X;  4EZQ A;  1SU6 A;  3KDR A;  4NXV A;  4HX0 A;  3D2F A;  4R5I A;  4OAF A;  2LM0 A;  3A98 A;  3MCR A;  4JNE A;  1SU8 A;  4HR1 A;  4NXT A;  4OAI Z;  5B3P A;  1OAO A;  1SUF A;  4EZP A;  2EWR A;  4F00 A;  3EF2 A;  4O68 A;  5D61 A;  2ND0 A;  1GNT A;  4EZZ A;  4PO2 A;  4IW0 A;  3FD9 A;  1GPJ A;  2EWF A;  4FO1 A;  4WH5 A;  4R5K A;  5FIG A;  3RV1 A;  4LEV A;  4JLZ A;  4MKP A;  3K7D A;  1E1D A;  3UIT A;  1OA0 A;  3O3O B;  5TKY A;  4B9Q A;  1E9V A;  2YIV X;  1MJG A;  3D2E A;  3O3N B;  5CHE A;  4JLX A;  4JWI A;  4UDY X;  1GN9 A;  2PY6 A;  2OBM A;  3VKH A;  1DKX A;  3ERC C;  3QA8 A;  1UPX A;  2KHO A;  3I39 X;  4JL9 A;  4E81 A;  4EZW A;  3T48 A;  3KAW A;  3RV0 A;  2B51 A;  4M0M A;  4NXU A;  3ER9 B;  1E2U A;  4WOY A;  5D62 A;  4K9B A;  3PHZ A;  2YI9 A;  3L3O M;  2YIA A;  4H6H A;  3T4A G;  4XJE A;  1ZYL A;  4NPH A;  4IM0 A;  1W9M A;  2GAF D;  1GNL A;  4WQL A;  3C7N A;  2OBL A;  4IM3 A;  4JN4 A;  4EZS A;  3B53 X;  4KIK B;  4WQK A;  3B52 X;  4K9A A;  4EZU A;  2RT6 A;  4LEZ A;  4K99 A;  3NKU A;  2QFF A;  4K96 A;  3GI7 A;  3KAV A;  4EZN A;  3VEB A;  3I04 A;  4K8V A;  3I01 A;  4KIK A;  4EZX A;  4N7R A;  1SU7 A;  2N3K A;  4EZT A;  1JQK A;  4JNF A;  3T46 A;  2B4V A;  4NXX A;  4O6A A;  4F01 A;  4R5G A;  4LEW A;  2B56 A;  2YI8 A;  4KM5 A;  5FLE X;  4OAH A;  2ND1 A;  4O69 A;  4R5L A;  5D63 A;  3DPO A;  2X5C A;  4KB6 A;  3ER8 C;  3VEA A;  4IWP A;  2FCL A;  4HR1 B;  4OAG A;  2JNS A;  3F7W A;  3LMF A;  4K98 A;  3T47 A;  2NCZ A;  3O3M B;  4EZY A;  4LEY A;  4JWE A;  5E84 A;  1U00 A;  2EX3 B;  5B3Q A;  3OHX M;  3OWG A;  2WIN M;  1OA1 A;  4H6I A;  3B51 X;  3DPQ A;  4HYB A;  3T49 A;  4O67 A;  4JWC A;  3QNJ A;  5CFT A;  4JWD A;  4D8J A;  2YIB A;  4E3C A;  5CFS A;  4IWQ A;  1DKZ A;  4IM2 A;  2QXL A;  4HY9 A;  4K97 A;  4EZV A;  4EZR A;  4G6Q A;  4JLC A;  2Z8Y A;  5CFU A;  3DPP A;  2GA9 D;  3ZED A;  2IHO A;  1DKY A;  4R5J A;  4FM3 A;  4NXW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...