2GAFD

Crystal structure of the vaccinia polyadenylate polymerase heterodimer (apo form)
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
468
structure length
447
Chain Sequence
NITLKIIETYLGRVPSVNEYHMLKSQARNIQKITVFNKDIFVSLVKKNKKRFFSDVNTSASEIKDRILSYFSKQTQTYNIGKLFTIIELQSVLVTTYTDILGVLTIKAPTSMEELARDMLNSMNVAVIVSSLVKNVNKLMEEYLRRHNKSCICYGSYSLYLINPNIRYGDIDILQTNSRTFLIDLAFLIKFITGNNIILSKIPYLRNYMVIKDENDNHIIDSFNIRQDTMNVVPKIFIDNIYIVDPTFQLLNMIKMFSQIDRLEDLSKDPEKFNARMATMLEYVRYTHGIVFDGKRNNMPMKCIIDENNRIVTVTTKDYFSFKKCLVYLDENVLSSDILDLNADTSCDFESVTNSVYLIHDNIMYTYFSNTILLSDKGKVHEISARGLCAHILLYQMLTSGEYKQCLSDLLNSMMNRDKIPIYSHTERDKKPGRHGFINIEKDIIVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the vaccinia virus polyadenylate polymerase heterodimer: insights into ATP selectivity and processivity.
pubmed doi rcsb
source organism Vaccinia virus
molecule tags Transferase
molecule keywords Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase
total genus 136
structure length 447
sequence length 468
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2006-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF03296 Pox_polyA_pol Poxvirus poly(A) polymerase nucleotidyltransferase domain
D PF12629 Pox_polyA_pol_C Poxvirus poly(A) polymerase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.320 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 2gafD01
3.30.460.60 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 2gafD03
2GAFD 3OWGA 3ER9B 3ERCC 3ER8C 2GA9D
chains in the Genus database with same CATH superfamily
3BVUA 4RPZA 1TV9A 9ICIA 2I9GA 4AZ5A 5FLEX 4I27A 1R5EA 3BVVA 7ICKA 2FCLA 3V7LA 4OAFA 2DR9A 3ERCC 2B51A 3LVTA 2ZH9A 1JN3A 8ICFA 3Q0KA 3DX3A 4UB2A 8ICAA 4JWCA 4K96A 4QZCA 5J0WA 4TURA 1ZQOA 2EFLA 4WC6A 1ZQBA 4PPXA 2ND1A 5J0SA 2Z0VA 4LZDA 3OUYB 4M9GA 4RPXA 8ICVA 5DB9A 1UPXA 2W9MA 4KLIA 3T4AG 1YLQA 2LM0A 3BUPA 1XSLA 2ISPA 4KB6A 4KLSA 4FHVA 8ICGA 2D1LA 2YL9A 4WBYA 9ICHA 4KM5A 1ZJNA 4R65A 4KLHA 3MGIA 1ZQJA 3HIYA 4QZEA 5DB7A 3I2WA 3JPNA 2O5AA 4EZWA 2DRBA 4IG8A 7ICLA 1ZQAA 1GNLA 2YL5A 1ZQZA 1ZQIA 1E9VA 1O7DC 4M2YA 2NRKA 3D50A 4RQ4A 5CP2A 5B3QA 5IIMA 3RPMA 4F5NA 9ICQA 1WOTA 5TZVA 4JLCA 1ZWWA 5D46A 3RJFA 3DPPA 3LQCB 4FO6A 4I2HA 5DEDA 3QWEA 2GF4A 4H6IA 8ICXA 1QWNA 4UDYX 5J0XA 4M9LA 9ICXA 3DYTA 4ATMA 1O7DB 3UPQA 1I49A 7ICGA 5BPCA 2P66A 2OO2A 1RPLA 1DKXA 4DOBA 8ICJA 1ZQNA 4RWPA 4OAIZ 3AQLA 3KAWA 2YL8A 1Q78A 1NOMA 2BE3A 4LT6A 4M9HA 2M2TA 4DCNC 4NPHA 2HHPA 4XJEA 2F7RA 2JNSA 4H8SA 2DR5A 4Z6DA 9ICSA 4KIKA 4AZCA 5IINA 4RQ7A 4O69A 4PGYA 3UITA 4UB3A 5HC9A 4IM0A 2EX3B 4OAHA 4LEZA 5DBBA 1DKZA 4X4PA 5DB6A 5J2AA 9ICOA 1RZTA 3AU6A 3TFSA 2F7OA 4AZGA 3VEBA 4KLJA 4FZPA 2PFQA 4IQVA 9ICLA 4ATBB 4K97A 2FMQA 7ICTA 2GWSA 3RH5A 2OBMA 1GPJA 1BPYA 3FD9A 4EBJA 5KBPA 4JLZA 3RJIA 4MFCA 4I2DA 3QNIA 4MF2A 4NLZA 3SOGA 1BPDA 1QX1A 8ICIA 3VEAA 3RJGA 4YCXA 2DR8A 4QZ9A 4QZGA 2D4CA 4LEYA 3WFPA 4WC4A 5HHIA 3K75D 4RQ8A 3JPOA 3DPQA 4K98A 2F7QA 4AT9B 1TQTA 4YMMA 1DKYA 2WYIA 3QNJA 5J0UA 4WCWA 1E2UA 4QZDA 9ICPA 4FZOA 4E3CA 8ICOA 4PO2A 1SU7A 3O3NB 2VANA 3DX1A 2IHOA 4X4QA 5FIGA 4K99A 2WINM 4NXTA 5CFSA 5J2HA 1BPEA 3RJJA 7ICHA 2JNKA 1ZQUA 5D49A 3D52A 4I28A 4O68A 1I4DA 1R33A 4FH5A 1KEJA 5D63A 2DVIA 1F5AA 1LQ7A 2WYHA 4XRHA 2PMRA 3AQNA 2V0OA 3JPRA 9ICGA 4AZIA 3OVBA 1Q79A 4M47A 3EJRA 4NSWA 2RAIA 2YKTA 4JWEA 5DKWA 1ZQDA 4UD4A 1PX5A 5IIIA 4NLKA 1R8AA 2PBEA 4QZAA 1VFGA 3BUBA 4KLDA 4EGWA 5CWRA 5J2DA 5IIKA 4IQWA 3HWTA 4PHPA 1E1DA 5IIJA 3CV5A 4I2IA 9ICVA 4AKVA 4E81A 2BCQA 5HREA 4EZPA 3MDCA 4WC7A 4NKTA 2F1BA 4UD5A 2OW7A 4FHPA 8ICLA 3A98A 4RWQA 2RFFA 4NXXA 4QZIA 3KAVA 2YIVX 8ICCA 4X4VA 2ZH5A 2FYVA 4R5IA 4FO1A 5J0QA 3AQMA 3H38A 4RWOA 2BBHA 3F7WA 4P4PA 4XQ8A 4X4SA 3GDXA 9ICWA 4WPCA 5CHGA 1TQWA 4M04A 2M2VA 4M5DA 4QZ8A 3RJEA 4TUQA 1ZQVA 4UAWA 4IWPA 5J2KA 3MDAA 4EZOA 5HRKA 4FH3A 2HN1A 5HR9A 5HHHA 4UBCA 3L9DA 4NY8A 5J2EA 3EJUA 1UEVA 3PLTA 3JPSA 3ISDA 2EWFA 9ICJA 5D61A 9ICEA 2NCZA 4UB1A 3UXNA 4LEWA 5IIOA 5CR0A 3RH4A 4HYBA 2PFPA 8ICYA 3MCRA 3NWIA 4R64A 9ICAA 4KLEA 5J29A 4EP7A 1ZQMA 4EZSA 3JCFA 3PMNA 4EZQA 4WC0A 2F18A 3TFRA 7ICOA 4I2FA 3QE6A 2B56A 1ZQEA 3DX4A 1ZQSA 3HAJA 4KLUA 2FMPA 4FZSA 5HRIA 1URUA 4XUSA 5BOLA 4RQ2A 4AZ7A 5J2CA 4PHEA 4JL9A 4K4IA 3BUIA 9ICKA 4KLFA 5CFUA 2OW6A 8ICMA 3V7JA 3LLLA 1XSPA 3BUQA 1TFYA 4IWQA 7ICVA 2RT6A 3ER8C 2ZHAA 3VKHA 5E84A 4RQ0A 4GXIA 1ZQYA 4F5QA 4KLQA 4HY9A 1X03A 1ZYLA 2YL6A 3V72A 4IWOA 9ICRA 3OUYA 4F5RA 2PXIA 3L3OM 4O5EA 2DRAA 3D2FA 1V4AA 4D8JA 8ICWA 5HRBA 1MQ3A 2ZH7A 4N7RA 4DOAA 1ZQPA 5J0YA 4WC3A 2HN2A 1WDZA 4EZRA 3H3AA 1ZQCA 4RWNA 3UQ0A 1JMSA 3NVOA 2QKWA 3OVSA 1X04A 3K7DA 4K4GA 1HTYA 4RT2A 4LVSA 2F1AA 1JQRA 4R66A 4O9MA 1OA0A 4M9JA 4FM3A 3DDGA 1HUZA 4MFFA 3DPOA 3CAZA 5CJ7A 3EF2A 3DX2A 8ICRA 2M2UA 4EZUA 2F7PA 4KLOA 3B0YA 1BPBA 4RQ3A 8ICTA 4EEDA 4PH5A 3PMLA 3ISBA 1TQVA 4NXVA 4AZBA 5DDMA 4EEBA 2LXYA 5DECA 4IM2A 1JAJA 5B3PA 8ICUA 4FHXA 2BBJA 2X3VA 1PS3A 2Q66A 1FA0A 8ICKA 4RPYA 4X5VA 2ID1A 4GXJA 5J0PA 3ABHA 5HRFA 4JNFA 3JPTA 4NXWA 4HX0A 1R89A 5HRLA 1TQSA 2BCSA 2M2WA 3PNCA 4WBZA 4NM2A 4QZBA 4X4UA 1OU5A 3BUDA 1ZQWA 4YMOA 2X3XA 7ICIA 9ICCA 3I39X 2PFOA 4WC5A 3C2LA 7ICUA 8ICSA 5F2VO 5C5BA 4PHDA 4K8VA 5HRHA 1MQ2A 9ICNA 3EJTA 4KLLA 2Z8YA 4MKPA 2Z0OA 1ZQGA 2IUBA 4K9BA 2OZNB 4IM3A 5J0OA 4HR1B 5J0TA 4YD1A 4ATBA 4IW0A 2BCUA 3JPPA 8ICQA 4IQUA 3KDRA 4I2BA 3MBYA 4JWMA 4EZVA 5CFTA 3D2EA 4X0AA 2PY6A 3Q84A 4E8FA 1ZQLA 2O0I1 4S3NA 3B51X 7ICQA 2X5CA 4RT3A 2ALWA 3CVRA 4EZZA 3D4ZA 7ICFA 4RQ5A 4E80A 3OV7A 4WC1A 3HJ4A 4JLXA 3ER9B 3UXOA 3LK9A 1ZQHA 4RQ6A 4UB4A 2ZH2A 4UDXX 1TFWA 3NKUA 3UPSA 1ZQFA 4DOCA 3QA8A 3CZSA 9ICUA 1W9MA 1YWMA 2ZH6A 3OWGA 3UXPA 2YLLA 4AT8A 4I2JA 4WQKA 2ZH1A 4O5KA 4Z6EA 4AZHA 2ZHBA 3ZEDA 4JWDA 4EZNA 1ZQXA 4WC2A 5HRGA 4E7XA 3RH6A 1R34A 4DYLA 2BPCA 5DDYA 1MIYA 3HW8A 4R5GA 4UAYA 4AT8B 2Q12A 1R8BA 1SU8A 5JTGA 2QFFA 4IQTA 4P4OA 2RAJA 4WPEA 2KHOA 1JQKA 3O3OB 1ZQQA 5HRDA 2Z0NA 4NKUA 5CA7A 4MFAA 3ISCA 3B53X 3CZNA 4AZCB 3RV1A 4LZGA 8ICHA 4KLTA 4X4RA 4EZYA 3BLBA 4NQIA 1UETA 7ICNA 3V7KA 2YIAA 2EWRA 4P2HA 1MIVA 4XA5A 5J2GA 1GNTA 3B0XA 4I0UA 4R63A 2X3WA 3L3PA 3OVAA 2BCRA 4F5PA 1U00A 4O6AA 1OAOA 8ICBA 1BPZA 1HWWA 3HAIA 4I1QA 4PGXA 3I01A 9ICBA 4F01A 5IILA 2MI7A 4NXZA 1R8CA 3RJKA 3C66A 5EOZA 2N3KA 2GAFD 2YI8A 3WFOA 2ZXQA 4DO9A 4I2EA 9ICFA 2QXLA 4WOYA 3C5GA 3C2MA 2IHMA 4UBBA 4AT7A 4QZFA 4G6QA 3BVWA 3C5FA 1ZQRA 3JPQA 4LEVA 4I2CA 5DBCA 3AQKA 5CB1A 3WFQE 3WFRE 4AZ6A 2C08A 1GN9A 3WFSC 7ICPA 2BPFA 3GI7A 4K4HA 3I04A 4R5JA 3SYVA 4X4OA 4KIKB 2OBLA 4KLMA 1Y2OA 3DDFA 3RV0A 1HUOA 3OHXM 5J2FA 2RAKA 1ZQTA 4M0AA 3H39A 2ZH8A 2ZH3A 4Z6CA 8ICZA 3HX0A 3AUOA 1ZQKA 4X4NA 2FMSA 4F00A 9ICMA 3RJHA 3D4YA 4R5LA 2PFNA 2ND0A 2YIBA 3PHZA 4X0BA 5TKYA 4UB5A 3EJSA 4H6HA 4EBKA 4TUPA 1TVAA 2Q13A 4MF8A 4FHYA 3C18A 7ICEA 4PGQA 2YI9A 1ZJMA 2BCVA 3M3WA 1UEUA 3EJPA 3AU2A 5J0RA 1I4TA 4EZTA 1KDHA 8ICPA 4GXKA 4I29A 4NM1A 4YMNA 3OK8A 1KNYA 2O1PA 5J2IA 3UQ2A 4UAZA 4I2AA 4YD2A 4QZHA 1TQUA 2GA9D 3T49A 2ISOA 1HXKA 4JN4A 5C5BB 4EZXA 4TUSA 5J2JA 1VJ7A 3LMFA 4AT9A 1MIWA 4YN4A 5D62A 1SUFA 1XSNA 7ICMA 3H37A 4JNEA 1QWUA 3OGUA 3C2KA 4HR1A 3T47A 4XQ7A 4R5KA 3EJQA 3BVXA 4KLGA 5J2BA 2YLAA 4F5OA 4NLNA 3G9GA 4M0MA 4O67A 4OAGA 2ELBA 3JYYA 5D4BA 5CHEA 4NXUA 4FHWA 7ICSA 8ICEA 3O3MB 3T46A 2B4VA 4B9QA 5DBAA 3CK6A 4Z6FA 4WH5A 4RQ1A 3BVTA 1MJGA 7ICRA 4P4MA 3CKDA 3MGHA 1OA1A 7ICJA 3ACOA 8ICNA 4WQLA 4X4TA 2BPGA 4O5CA 4K9AA 3C7NA 3DX0A 1I4LA 4BNEA 4JWIA 4I2GA 4M9NA 4AVMA 3NYBA 3T48A 5DB8A 1BPXA 1SU6A 2DR7A 3HAHA 3JZ0A 3D51A 2FICA 4PHAA 9ICTA 1NO5A 4AT7B 4EV6A 5BOMA 2EFKA 3B52X 2ZH4A 4JWNA 3HJ1A
chains in the Genus database with same CATH topology
3K7DA 2YIAA 2EWRA 1OA0A 1GNTA 5FLEX 4FM3A 4O68A 3DPOA 5D63A 3EF2A 1U00A 2FCLA 4O6AA 1OAOA 4OAFA 3ERCC 2B51A 3I01A 4EZUA 4F01A 4JWCA 4K96A 4JWEA 4NXVA 2N3KA 2GAFD 2YI8A 2ND1A 4IM2A 5B3PA 2QXLA 4WOYA 1UPXA 1E1DA 3T4AG 2LM0A 4G6QA 4E81A 4JNFA 4EZPA 4NXWA 4KB6A 4HX0A 4LEVA 4KM5A 1GN9A 3A98A 4NXXA 3KAVA 3GI7A 2YIVX 3I04A 3I39X 4R5JA 4KIKB 2OBLA 4R5IA 4FO1A 3RV0A 4EZWA 3OHXM 4K8VA 4NXTA 3F7WA 1GNLA 2Z8YA 4MKPA 1E9VA 5B3QA 4IWPA 4F00A 4K9BA 4EZOA 4JLCA 4IM3A 3DPPA 4R5LA 4HR1B 2ND0A 2YIBA 3PHZA 5TKYA 4H6HA 4IW0A 5CFSA 4H6IA 4UDYX 3KDRA 2EWFA 5D61A 4EZVA 5CFTA 2NCZA 3D2EA 2PY6A 2YI9A 4LEWA 4HYBA 1DKXA 3MCRA 4EZTA 3B51X 4OAIZ 3KAWA 4EZSA 2X5CA 4EZQA 4EZZA 4NPHA 4XJEA 2JNSA 2GA9D 2B56A 4KIKA 3T49A 4JLXA 4JN4A 4O69A 3UITA 4EZXA 3ER9B 4IM0A 2EX3B 3LMFA 4OAHA 4LEZA 4UDXX 3NKUA 1DKZA 1SUFA 5D62A 3QA8A 4JNEA 4HR1A 1W9MA 3T47A 3VEBA 3OWGA 4R5KA 4JL9A 4WQKA 5CFUA 4M0MA 4O67A 4K97A 4OAGA 3ZEDA 4JWDA 5CHEA 4NXUA 4EZNA 2OBMA 4IWQA 1GPJA 2RT6A 3O3MB 3T46A 3ER8C 4B9QA 3FD9A 3VKHA 2B4VA 5E84A 4JLZA 4HY9A 4WH5A 1ZYLA 4IWOA 4R5GA 1MJGA 1SU8A 3VEAA 3L3OM 3D2FA 1OA1A 2QFFA 4LEYA 2KHOA 3DPQA 4D8JA 4WQLA 4K98A 1JQKA 3O3OB 4K9AA 3C7NA 1DKYA 3QNJA 4JWIA 4N7RA 1E2UA 3T48A 1SU6A 4E3CA 3B53X 1SU7A 3O3NB 4EZRA 4PO2A 3RV1A 2IHOA 5FIGA 4K99A 2WINM 3B52X 4EZYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GAF D;  3OWG A;  3ER9 B;  3ERC C;  3ER8 C;  2GA9 D; 
#chains in the Genus database with same CATH topology
 3BVU A;  4RPZ A;  1TV9 A;  9ICI A;  2I9G A;  4AZ5 A;  5FLE X;  4I27 A;  1R5E A;  3BVV A;  7ICK A;  2FCL A;  3V7L A;  4OAF A;  2DR9 A;  3ERC C;  2B51 A;  3LVT A;  2ZH9 A;  1JN3 A;  8ICF A;  3Q0K A;  3DX3 A;  4UB2 A;  8ICA A;  4JWC A;  4K96 A;  4QZC A;  5J0W A;  4TUR A;  1ZQO A;  2EFL A;  4WC6 A;  1ZQB A;  4PPX A;  2ND1 A;  5J0S A;  2Z0V A;  4LZD A;  3OUY B;  4M9G A;  4RPX A;  8ICV A;  5DB9 A;  1UPX A;  2W9M A;  4KLI A;  3T4A G;  1YLQ A;  2LM0 A;  3BUP A;  1XSL A;  2ISP A;  4KB6 A;  4KLS A;  4FHV A;  8ICG A;  2D1L A;  2YL9 A;  4WBY A;  9ICH A;  4KM5 A;  1ZJN A;  4R65 A;  4KLH A;  3MGI A;  1ZQJ A;  3HIY A;  4QZE A;  5DB7 A;  3I2W A;  3JPN A;  2O5A A;  4EZW A;  2DRB A;  4IG8 A;  7ICL A;  1ZQA A;  1GNL A;  2YL5 A;  1ZQZ A;  1ZQI A;  1E9V A;  1O7D C;  4M2Y A;  2NRK A;  3D50 A;  4RQ4 A;  5CP2 A;  5B3Q A;  5IIM A;  3RPM A;  4F5N A;  9ICQ A;  1WOT A;  5TZV A;  4JLC A;  1ZWW A;  5D46 A;  3RJF A;  3DPP A;  3LQC B;  4FO6 A;  4I2H A;  5DED A;  3QWE A;  2GF4 A;  4H6I A;  8ICX A;  1QWN A;  4UDY X;  5J0X A;  4M9L A;  9ICX A;  3DYT A;  4ATM A;  1O7D B;  3UPQ A;  1I49 A;  7ICG A;  5BPC A;  2P66 A;  2OO2 A;  1RPL A;  1DKX A;  4DOB A;  8ICJ A;  1ZQN A;  4RWP A;  4OAI Z;  3AQL A;  3KAW A;  2YL8 A;  1Q78 A;  1NOM A;  2BE3 A;  4LT6 A;  4M9H A;  2M2T A;  4DCN C;  4NPH A;  2HHP A;  4XJE A;  2F7R A;  2JNS A;  4H8S A;  2DR5 A;  4Z6D A;  9ICS A;  4KIK A;  4AZC A;  5IIN A;  4RQ7 A;  4O69 A;  4PGY A;  3UIT A;  4UB3 A;  5HC9 A;  4IM0 A;  2EX3 B;  4OAH A;  4LEZ A;  5DBB A;  1DKZ A;  4X4P A;  5DB6 A;  5J2A A;  9ICO A;  1RZT A;  3AU6 A;  3TFS A;  2F7O A;  4AZG A;  3VEB A;  4KLJ A;  4FZP A;  2PFQ A;  4IQV A;  9ICL A;  4ATB B;  4K97 A;  2FMQ A;  7ICT A;  2GWS A;  3RH5 A;  2OBM A;  1GPJ A;  1BPY A;  3FD9 A;  4EBJ A;  5KBP A;  4JLZ A;  3RJI A;  4MFC A;  4I2D A;  3QNI A;  4MF2 A;  4NLZ A;  3SOG A;  1BPD A;  1QX1 A;  8ICI A;  3VEA A;  3RJG A;  4YCX A;  2DR8 A;  4QZ9 A;  4QZG A;  2D4C A;  4LEY A;  3WFP A;  4WC4 A;  5HHI A;  3K75 D;  4RQ8 A;  3JPO A;  3DPQ A;  4K98 A;  2F7Q A;  4AT9 B;  1TQT A;  4YMM A;  1DKY A;  2WYI A;  3QNJ A;  5J0U A;  4WCW A;  1E2U A;  4QZD A;  9ICP A;  4FZO A;  4E3C A;  8ICO A;  4PO2 A;  1SU7 A;  3O3N B;  2VAN A;  3DX1 A;  2IHO A;  4X4Q A;  5FIG A;  4K99 A;  2WIN M;  4NXT A;  5CFS A;  5J2H A;  1BPE A;  3RJJ A;  7ICH A;  2JNK A;  1ZQU A;  5D49 A;  3D52 A;  4I28 A;  4O68 A;  1I4D A;  1R33 A;  4FH5 A;  1KEJ A;  5D63 A;  2DVI A;  1F5A A;  1LQ7 A;  2WYH A;  4XRH A;  2PMR A;  3AQN A;  2V0O A;  3JPR A;  9ICG A;  4AZI A;  3OVB A;  1Q79 A;  4M47 A;  3EJR A;  4NSW A;  2RAI A;  2YKT A;  4JWE A;  5DKW A;  1ZQD A;  4UD4 A;  1PX5 A;  5III A;  4NLK A;  1R8A A;  2PBE A;  4QZA A;  1VFG A;  3BUB A;  4KLD A;  4EGW A;  5CWR A;  5J2D A;  5IIK A;  4IQW A;  3HWT A;  4PHP A;  1E1D A;  5IIJ A;  3CV5 A;  4I2I A;  9ICV A;  4AKV A;  4E81 A;  2BCQ A;  5HRE A;  4EZP A;  3MDC A;  4WC7 A;  4NKT A;  2F1B A;  4UD5 A;  2OW7 A;  4FHP A;  8ICL A;  3A98 A;  4RWQ A;  2RFF A;  4NXX A;  4QZI A;  3KAV A;  2YIV X;  8ICC A;  4X4V A;  2ZH5 A;  2FYV A;  4R5I A;  4FO1 A;  5J0Q A;  3AQM A;  3H38 A;  4RWO A;  2BBH A;  3F7W A;  4P4P A;  4XQ8 A;  4X4S A;  3GDX A;  9ICW A;  4WPC A;  5CHG A;  1TQW A;  4M04 A;  2M2V A;  4M5D A;  4QZ8 A;  3RJE A;  4TUQ A;  1ZQV A;  4UAW A;  4IWP A;  5J2K A;  3MDA A;  4EZO A;  5HRK A;  4FH3 A;  2HN1 A;  5HR9 A;  5HHH A;  4UBC A;  3L9D A;  4NY8 A;  5J2E A;  3EJU A;  1UEV A;  3PLT A;  3JPS A;  3ISD A;  2EWF A;  9ICJ A;  5D61 A;  9ICE A;  2NCZ A;  4UB1 A;  3UXN A;  4LEW A;  5IIO A;  5CR0 A;  3RH4 A;  4HYB A;  2PFP A;  8ICY A;  3MCR A;  3NWI A;  4R64 A;  9ICA A;  4KLE A;  5J29 A;  4EP7 A;  1ZQM A;  4EZS A;  3JCF A;  3PMN A;  4EZQ A;  4WC0 A;  2F18 A;  3TFR A;  7ICO A;  4I2F A;  3QE6 A;  2B56 A;  1ZQE A;  3DX4 A;  1ZQS A;  3HAJ A;  4KLU A;  2FMP A;  4FZS A;  5HRI A;  1URU A;  4XUS A;  5BOL A;  4RQ2 A;  4AZ7 A;  5J2C A;  4PHE A;  4JL9 A;  4K4I A;  3BUI A;  9ICK A;  4KLF A;  5CFU A;  2OW6 A;  8ICM A;  3V7J A;  3LLL A;  1XSP A;  3BUQ A;  1TFY A;  4IWQ A;  7ICV A;  2RT6 A;  3ER8 C;  2ZHA A;  3VKH A;  5E84 A;  4RQ0 A;  4GXI A;  1ZQY A;  4F5Q A;  4KLQ A;  4HY9 A;  1X03 A;  1ZYL A;  2YL6 A;  3V72 A;  4IWO A;  9ICR A;  3OUY A;  4F5R A;  2PXI A;  3L3O M;  4O5E A;  2DRA A;  3D2F A;  1V4A A;  4D8J A;  8ICW A;  5HRB A;  1MQ3 A;  2ZH7 A;  4N7R A;  4DOA A;  1ZQP A;  5J0Y A;  4WC3 A;  2HN2 A;  1WDZ A;  4EZR A;  3H3A A;  1ZQC A;  4RWN A;  3UQ0 A;  1JMS A;  3NVO A;  2QKW A;  3OVS A;  1X04 A;  3K7D A;  4K4G A;  1HTY A;  4RT2 A;  4LVS A;  2F1A A;  1JQR A;  4R66 A;  4O9M A;  1OA0 A;  4M9J A;  4FM3 A;  3DDG A;  1HUZ A;  4MFF A;  3DPO A;  3CAZ A;  5CJ7 A;  3EF2 A;  3DX2 A;  8ICR A;  2M2U A;  4EZU A;  2F7P A;  4KLO A;  3B0Y A;  1BPB A;  4RQ3 A;  8ICT A;  4EED A;  4PH5 A;  3PML A;  3ISB A;  1TQV A;  4NXV A;  4AZB A;  5DDM A;  4EEB A;  2LXY A;  5DEC A;  4IM2 A;  1JAJ A;  5B3P A;  8ICU A;  4FHX A;  2BBJ A;  2X3V A;  1PS3 A;  2Q66 A;  1FA0 A;  8ICK A;  4RPY A;  4X5V A;  2ID1 A;  4GXJ A;  5J0P A;  3ABH A;  5HRF A;  4JNF A;  3JPT A;  4NXW A;  4HX0 A;  1R89 A;  5HRL A;  1TQS A;  2BCS A;  2M2W A;  3PNC A;  4WBZ A;  4NM2 A;  4QZB A;  4X4U A;  1OU5 A;  3BUD A;  1ZQW A;  4YMO A;  2X3X A;  7ICI A;  9ICC A;  3I39 X;  2PFO A;  4WC5 A;  3C2L A;  7ICU A;  8ICS A;  5F2V O;  5C5B A;  4PHD A;  4K8V A;  5HRH A;  1MQ2 A;  9ICN A;  3EJT A;  4KLL A;  2Z8Y A;  4MKP A;  2Z0O A;  1ZQG A;  2IUB A;  4K9B A;  2OZN B;  4IM3 A;  5J0O A;  4HR1 B;  5J0T A;  4YD1 A;  4ATB A;  4IW0 A;  2BCU A;  3JPP A;  8ICQ A;  4IQU A;  3KDR A;  4I2B A;  3MBY A;  4JWM A;  4EZV A;  5CFT A;  3D2E A;  4X0A A;  2PY6 A;  3Q84 A;  4E8F A;  1ZQL A;  2O0I 1;  4S3N A;  3B51 X;  7ICQ A;  2X5C A;  4RT3 A;  2ALW A;  3CVR A;  4EZZ A;  3D4Z A;  7ICF A;  4RQ5 A;  4E80 A;  3OV7 A;  4WC1 A;  3HJ4 A;  4JLX A;  3ER9 B;  3UXO A;  3LK9 A;  1ZQH A;  4RQ6 A;  4UB4 A;  2ZH2 A;  4UDX X;  1TFW A;  3NKU A;  3UPS A;  1ZQF A;  4DOC A;  3QA8 A;  3CZS A;  9ICU A;  1W9M A;  1YWM A;  2ZH6 A;  3OWG A;  3UXP A;  2YLL A;  4AT8 A;  4I2J A;  4WQK A;  2ZH1 A;  4O5K A;  4Z6E A;  4AZH A;  2ZHB A;  3ZED A;  4JWD A;  4EZN A;  1ZQX A;  4WC2 A;  5HRG A;  4E7X A;  3RH6 A;  1R34 A;  4DYL A;  2BPC A;  5DDY A;  1MIY A;  3HW8 A;  4R5G A;  4UAY A;  4AT8 B;  2Q12 A;  1R8B A;  1SU8 A;  5JTG A;  2QFF A;  4IQT A;  4P4O A;  2RAJ A;  4WPE A;  2KHO A;  1JQK A;  3O3O B;  1ZQQ A;  5HRD A;  2Z0N A;  4NKU A;  5CA7 A;  4MFA A;  3ISC A;  3B53 X;  3CZN A;  4AZC B;  3RV1 A;  4LZG A;  8ICH A;  4KLT A;  4X4R A;  4EZY A;  3BLB A;  4NQI A;  1UET A;  7ICN A;  3V7K A;  2YIA A;  2EWR A;  4P2H A;  1MIV A;  4XA5 A;  5J2G A;  1GNT A;  3B0X A;  4I0U A;  4R63 A;  2X3W A;  3L3P A;  3OVA A;  2BCR A;  4F5P A;  1U00 A;  4O6A A;  1OAO A;  8ICB A;  1BPZ A;  1HWW A;  3HAI A;  4I1Q A;  4PGX A;  3I01 A;  9ICB A;  4F01 A;  5IIL A;  2MI7 A;  4NXZ A;  1R8C A;  3RJK A;  3C66 A;  5EOZ A;  2N3K A;  2GAF D;  2YI8 A;  3WFO A;  2ZXQ A;  4DO9 A;  4I2E A;  9ICF A;  2QXL A;  4WOY A;  3C5G A;  3C2M A;  2IHM A;  4UBB A;  4AT7 A;  4QZF A;  4G6Q A;  3BVW A;  3C5F A;  1ZQR A;  3JPQ A;  4LEV A;  4I2C A;  5DBC A;  3AQK A;  5CB1 A;  3WFQ E;  3WFR E;  4AZ6 A;  2C08 A;  1GN9 A;  3WFS C;  7ICP A;  2BPF A;  3GI7 A;  4K4H A;  3I04 A;  4R5J A;  3SYV A;  4X4O A;  4KIK B;  2OBL A;  4KLM A;  1Y2O A;  3DDF A;  3RV0 A;  1HUO A;  3OHX M;  5J2F A;  2RAK A;  1ZQT A;  4M0A A;  3H39 A;  2ZH8 A;  2ZH3 A;  4Z6C A;  8ICZ A;  3HX0 A;  3AUO A;  1ZQK A;  4X4N A;  2FMS A;  4F00 A;  9ICM A;  3RJH A;  3D4Y A;  4R5L A;  2PFN A;  2ND0 A;  2YIB A;  3PHZ A;  4X0B A;  5TKY A;  4UB5 A;  3EJS A;  4H6H A;  4EBK A;  4TUP A;  1TVA A;  2Q13 A;  4MF8 A;  4FHY A;  3C18 A;  7ICE A;  4PGQ A;  2YI9 A;  1ZJM A;  2BCV A;  3M3W A;  1UEU A;  3EJP A;  3AU2 A;  5J0R A;  1I4T A;  4EZT A;  1KDH A;  8ICP A;  4GXK A;  4I29 A;  4NM1 A;  4YMN A;  3OK8 A;  1KNY A;  2O1P A;  5J2I A;  3UQ2 A;  4UAZ A;  4I2A A;  4YD2 A;  4QZH A;  1TQU A;  2GA9 D;  3T49 A;  2ISO A;  1HXK A;  4JN4 A;  5C5B B;  4EZX A;  4TUS A;  5J2J A;  1VJ7 A;  3LMF A;  4AT9 A;  1MIW A;  4YN4 A;  5D62 A;  1SUF A;  1XSN A;  7ICM A;  3H37 A;  4JNE A;  1QWU A;  3OGU A;  3C2K A;  4HR1 A;  3T47 A;  4XQ7 A;  4R5K A;  3EJQ A;  3BVX A;  4KLG A;  5J2B A;  2YLA A;  4F5O A;  4NLN A;  3G9G A;  4M0M A;  4O67 A;  4OAG A;  2ELB A;  3JYY A;  5D4B A;  5CHE A;  4NXU A;  4FHW A;  7ICS A;  8ICE A;  3O3M B;  3T46 A;  2B4V A;  4B9Q A;  5DBA A;  3CK6 A;  4Z6F A;  4WH5 A;  4RQ1 A;  3BVT A;  1MJG A;  7ICR A;  4P4M A;  3CKD A;  3MGH A;  1OA1 A;  7ICJ A;  3ACO A;  8ICN A;  4WQL A;  4X4T A;  2BPG A;  4O5C A;  4K9A A;  3C7N A;  3DX0 A;  1I4L A;  4BNE A;  4JWI A;  4I2G A;  4M9N A;  4AVM A;  3NYB A;  3T48 A;  5DB8 A;  1BPX A;  1SU6 A;  2DR7 A;  3HAH A;  3JZ0 A;  3D51 A;  2FIC A;  4PHA A;  9ICT A;  1NO5 A;  4AT7 B;  4EV6 A;  5BOM A;  2EFK A;  3B52 X;  2ZH4 A;  4JWN A;  3HJ1 A; 
#chains in the Genus database with same CATH homology
 3K7D A;  2YIA A;  2EWR A;  1OA0 A;  1GNT A;  5FLE X;  4FM3 A;  4O68 A;  3DPO A;  5D63 A;  3EF2 A;  1U00 A;  2FCL A;  4O6A A;  1OAO A;  4OAF A;  3ERC C;  2B51 A;  3I01 A;  4EZU A;  4F01 A;  4JWC A;  4K96 A;  4JWE A;  4NXV A;  2N3K A;  2GAF D;  2YI8 A;  2ND1 A;  4IM2 A;  5B3P A;  2QXL A;  4WOY A;  1UPX A;  1E1D A;  3T4A G;  2LM0 A;  4G6Q A;  4E81 A;  4JNF A;  4EZP A;  4NXW A;  4KB6 A;  4HX0 A;  4LEV A;  4KM5 A;  1GN9 A;  3A98 A;  4NXX A;  3KAV A;  3GI7 A;  2YIV X;  3I04 A;  3I39 X;  4R5J A;  4KIK B;  2OBL A;  4R5I A;  4FO1 A;  3RV0 A;  4EZW A;  3OHX M;  4K8V A;  4NXT A;  3F7W A;  1GNL A;  2Z8Y A;  4MKP A;  1E9V A;  5B3Q A;  4IWP A;  4F00 A;  4K9B A;  4EZO A;  4JLC A;  4IM3 A;  3DPP A;  4R5L A;  4HR1 B;  2ND0 A;  2YIB A;  3PHZ A;  5TKY A;  4H6H A;  4IW0 A;  5CFS A;  4H6I A;  4UDY X;  3KDR A;  2EWF A;  5D61 A;  4EZV A;  5CFT A;  2NCZ A;  3D2E A;  2PY6 A;  2YI9 A;  4LEW A;  4HYB A;  1DKX A;  3MCR A;  4EZT A;  3B51 X;  4OAI Z;  3KAW A;  4EZS A;  2X5C A;  4EZQ A;  4EZZ A;  4NPH A;  4XJE A;  2JNS A;  2GA9 D;  2B56 A;  4KIK A;  3T49 A;  4JLX A;  4JN4 A;  4O69 A;  3UIT A;  4EZX A;  3ER9 B;  4IM0 A;  2EX3 B;  3LMF A;  4OAH A;  4LEZ A;  4UDX X;  3NKU A;  1DKZ A;  1SUF A;  5D62 A;  3QA8 A;  4JNE A;  4HR1 A;  1W9M A;  3T47 A;  3VEB A;  3OWG A;  4R5K A;  4JL9 A;  4WQK A;  5CFU A;  4M0M A;  4O67 A;  4K97 A;  4OAG A;  3ZED A;  4JWD A;  5CHE A;  4NXU A;  4EZN A;  2OBM A;  4IWQ A;  1GPJ A;  2RT6 A;  3O3M B;  3T46 A;  3ER8 C;  4B9Q A;  3FD9 A;  3VKH A;  2B4V A;  5E84 A;  4JLZ A;  4HY9 A;  4WH5 A;  1ZYL A;  4IWO A;  4R5G A;  1MJG A;  1SU8 A;  3VEA A;  3L3O M;  3D2F A;  1OA1 A;  2QFF A;  4LEY A;  2KHO A;  3DPQ A;  4D8J A;  4WQL A;  4K98 A;  1JQK A;  3O3O B;  4K9A A;  3C7N A;  1DKY A;  3QNJ A;  4JWI A;  4N7R A;  1E2U A;  3T48 A;  1SU6 A;  4E3C A;  3B53 X;  1SU7 A;  3O3N B;  4EZR A;  4PO2 A;  3RV1 A;  2IHO A;  5FIG A;  4K99 A;  2WIN M;  3B52 X;  4EZY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...