2GAFD

Crystal structure of the vaccinia polyadenylate polymerase heterodimer (apo form)
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
468
structure length
447
Chain Sequence
NITLKIIETYLGRVPSVNEYHMLKSQARNIQKITVFNKDIFVSLVKKNKKRFFSDVNTSASEIKDRILSYFSKQTQTYNIGKLFTIIELQSVLVTTYTDILGVLTIKAPTSMEELARDMLNSMNVAVIVSSLVKNVNKLMEEYLRRHNKSCICYGSYSLYLINPNIRYGDIDILQTNSRTFLIDLAFLIKFITGNNIILSKIPYLRNYMVIKDENDNHIIDSFNIRQDTMNVVPKIFIDNIYIVDPTFQLLNMIKMFSQIDRLEDLSKDPEKFNARMATMLEYVRYTHGIVFDGKRNNMPMKCIIDENNRIVTVTTKDYFSFKKCLVYLDENVLSSDILDLNADTSCDFESVTNSVYLIHDNIMYTYFSNTILLSDKGKVHEISARGLCAHILLYQMLTSGEYKQCLSDLLNSMMNRDKIPIYSHTERDKKPGRHGFINIEKDIIVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase
publication title Crystal structures of the vaccinia virus polyadenylate polymerase heterodimer: insights into ATP selectivity and processivity.
pubmed doi rcsb
source organism Vaccinia virus
molecule tags Transferase
total genus 136
structure length 447
sequence length 468
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2006-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF03296 Pox_polyA_pol Poxvirus poly(A) polymerase nucleotidyltransferase domain
D PF12629 Pox_polyA_pol_C Poxvirus poly(A) polymerase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.320 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 2gafD01
3.30.460.60 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 2gafD03
3ERCC 3OWGA 2GA9D 3ER8C 2GAFD 3ER9B
chains in the Genus database with same CATH superfamily
4KLHA 9ICVA 1Y2OA 3H39A 2ZH6A 1JAJA 5CFUA 4M47A 3V7KA 1ZQZA 3BVUA 2FICA 4YD1A 2IHOA 2ND0A 2ALWA 2O0I1 4WPCA 4QZAA 5F2VO 5HRDA 1KDHA 4M9HA 4KLQA 2GAFD 3CKDA 1HUOA 3D4YA 4KLSA 4EZOA 3BUIA 4AKVA 1ZJNA 7ICIA 1MQ3A 1GNTA 4WCWA 1UEUA 5DB6A 4I0UA 4KIKB 2BPCA 4AZCB 4PH5A 3OK8A 1JQKA 4NM2A 1KEJA 3AQMA 4B9QA 4MFAA 2DR9A 1TQTA 2M2UA 2FMPA 3PMNA 4RPZA 4YN4A 4M04A 1SU7A 3CZSA 1ZQSA 4JN4A 3DPPA 2Z0OA 4F01A 4GXIA 3I2WA 1BPYA 4I28A 5JTGA 1OU5A 2BPFA 2YI9A 3AQLA 5HHHA 4AVMA 3B0XA 3CAZA 2FMSA 2DR5A 8ICSA 1PS3A 4LVSA 3RH5A 4JNFA 4X4UA 4RQ4A 1WDZA 8ICQA 3RV0A 3EF2A 4ATBB 1ZQWA 3KDRA 2Z0NA 5EOZA 4X4SA 5J2IA 4E3CA 4O69A 2I9GA 3WFQE 1MJGA 7ICUA 4O5KA 3DDGA 1R89A 3DX4A 4UD5A 4EZZA 3DYTA 4P4MA 4E81A 2QFFA 4IM2A 3JYYA 3KAVA 4M2YA 1BPBA 2NRKA 3BUDA 4DOBA 3L9DA 4QZEA 7ICMA 2NCZA 2YIVX 5J0SA 4K99A 3UITA 2Q13A 2ZH4A 9ICIA 3UQ2A 3QE6A 3WFRE 2ZH1A 3G9GA 4QZFA 5BOMA 4RWOA 3LMFA 2ZHBA 4PPXA 4FHXA 1TQUA 5J29A 3JPTA 4EZQA 5CB1A 4RT2A 3BUPA 3C2KA 1RPLA 3TFRA 9ICMA 4EZVA 4UBCA 2YLAA 4KLTA 2Q66A 2DVIA 4JLCA 5J0YA 5DBAA 1R8AA 4AT9B 1QX1A 2RT6A 3D51A 1SUFA 3D4ZA 2FMQA 2BCQA 5IINA 2VANA 9ICJA 4KIKA 2EFKA 4AZCA 4JLZA 4TUPA 1JMSA 2OBLA 1QWNA 5CP2A 4JNEA 3QA8A 1MIWA 4LEYA 2F18A 5J0WA 3JPNA 2JNKA 2EWRA 4RT3A 4K9AA 1Q78A 2F1AA 5J0TA 9ICRA 2O1PA 4WC2A 4D8JA 4NLZA 4X4VA 1ZQQA 4I1QA 4RQ5A 3UXPA 4KLLA 2ZH8A 4NLKA 4NKTA 4X5VA 3EJQA 4M5DA 5J2FA 3M3WA 4YMOA 5B3QA 2YL9A 4I27A 4UAWA 5TKYA 2F7QA 4FHWA 4M9GA 3C66A 4FM3A 1UPXA 1R8CA 2RAIA 1BPEA 3T46A 3T4AG 4WC6A 8ICOA 4F5RA 3SYVA 4EBJA 2B56A 2OW7A 4AZ7A 5DDYA 8ICJA 7ICRA 4QZ9A 4R65A 4QZDA 2F7PA 4R5IA 4R63A 2N3KA 4K4HA 2Z8YA 1FA0A 4R5GA 5FIGA 9ICGA 4X4QA 4XA5A 4R64A 3LQCB 4AT7A 4M9LA 4RQ7A 4N7RA 7ICKA 2EFLA 2M2TA 4GXJA 9ICCA 2YL8A 3JPSA 2X3XA 2BCUA 5J0XA 5D61A 3LK9A 4X0AA 3DX0A 4JWMA 3RJIA 4UAYA 1BPZA 4IQUA 3ISCA 4I2HA 1GPJA 4EV6A 3RJEA 1ZQLA 4P4OA 4JWEA 4LEZA 1PX5A 4WC4A 3PMLA 4NXVA 4AT8B 1ZJMA 4F5QA 1YWMA 4K4IA 1TFWA 4WBZA 5D46A 5CHGA 3A98A 2WINM 3C18A 3H37A 4PO2A 7ICLA 4AZBA 3BVVA 1ZQFA 5HRBA 5HRHA 4XRHA 1E2UA 3QNJA 4R66A 4GXKA 4YD2A 4P4PA 1ZWWA 2Z0VA 8ICHA 4NXXA 8ICUA 3F7WA 5DKWA 3RJJA 3OWGA 8ICMA 4RQ8A 3GI7A 5IIKA 4EZXA 5D49A 4WPEA 2PBEA 4O68A 5J2GA 4MF2A 5KBPA 4FHVA 2OO2A 2FCLA 1XSLA 3OVSA 3DDFA 5DECA 3CV5A 2F7OA 5CR0A 3D50A 4Z6DA 3MDCA 4IWPA 4UB5A 1MIVA 1ZQCA 8ICNA 3B53X 5HRLA 8ICYA 5J2AA 1OAOA 5HRIA 4EZUA 4KLGA 4IM3A 4QZBA 3RJKA 4KLIA 4EBKA 7ICGA 4IQTA 1R33A 1XSNA 1ZQXA 3CVRA 3ERCC 3ACOA 5TZVA 4E7XA 1ZQRA 2IHMA 4R5LA 1DKXA 4AZIA 4G6QA 9ICXA 4EZYA 1VFGA 5CA7A 4UBBA 1ZQNA 2BCSA 4RWNA 4RQ1A 4EZWA 5IIMA 4AZHA 4FH5A 2YKTA 3HJ4A 3OUYA 2HN1A 3MDAA 3T47A 3BUQA 5FLEX 2QXLA 5HR9A 8ICBA 3MGIA 3LVTA 2BCRA 1GNLA 8ICAA 5B3PA 3B52X 4DO9A 2PFPA 3GDXA 2ZH2A 2GA9D 3UPQA 3BLBA 1UEVA 4PGQA 1HWWA 4RPYA 9ICNA 7ICNA 9ICUA 3EJSA 1TQSA 4X0BA 1NOMA 1DKZA 4FH3A 3MBYA 2ISPA 8ICFA 8ICXA 2IUBA 3FD9A 4NSWA 2ZH5A 1SU6A 4EGWA 2WYHA 3BUBA 3Q84A 8ICLA 2X3VA 2YL6A 2W9MA 3AU2A 1BPXA 3O3NB 3HAIA 4LT6A 4TUSA 4KB6A 4UAZA 3BVTA 4JWCA 3HIYA 3RJGA 2GF4A 4UD4A 5J0UA 3V72A 9ICOA 4NXTA 3EJUA 7ICEA 2EWFA 4EZTA 3H38A 3UXOA 1R34A 8ICRA 3ER8C 9ICLA 4H6IA 3BVWA 3MGHA 5C5BB 2MI7A 4FO1A 3UPSA 4WBYA 4HR1B 4O5EA 3BVXA 1ZQBA 1ZQMA 3VEAA 2PFOA 3I39X 4FZOA 8ICTA 1TFYA 4MFCA 5J2DA 3DX3A 4JWIA 2QKWA 4XUSA 4F5PA 4NKUA 2DRAA 9ICSA 4JLXA 3OHXM 9ICKA 4ATBA 1TV9A 3KAWA 3WFPA 4QZ8A 2ZH3A 1JQRA 3B51X 3LLLA 3NKUA 2YI8A 1WOTA 4RQ0A 4I2DA 4K96A 2PFNA 4R5JA 3DX1A 4IQWA 3JZ0A 5CWRA 4YCXA 5CJ7A 3JPOA 3VKHA 5J2BA 9ICWA 1SU8A 9ICEA 4AZGA 1R8BA 3WFOA 1E1DA 3DPQA 7ICVA 2YIAA 5IIIA 1Q79A 4PGYA 2ND1A 4I2CA 5IIOA 5CHEA 3C2MA 4O5CA 4F5OA 1F5AA 4I2JA 2BE3A 3OVAA 3L3OM 2BBJA 4Z6CA 3H3AA 5DDMA 2PXIA 3K75D 7ICFA 3QNIA 4NM1A 4O6AA 3MCRA 4EP7A 4AT9A 1ZQPA 1HTYA 2YLLA 2HHPA 4IQVA 4KLJA 4KM5A 4PHAA 2M2WA 4I2GA 4EZPA 4MFFA 8ICPA 4KLDA 4WC3A 4O67A 4K4GA 3HAJA 3HWTA 3RJHA 4QZHA 3ER9B 4EZSA 4RQ2A 3RV1A 4AZ5A 4IM0A 2B4VA 4OAIZ 4RWPA 1ZQJA 1UETA 1E9VA 2YL5A 4NPHA 4RQ3A 1XSPA 2HN2A 4TUQA 5IIJA 2WYIA 4XJEA 4DOCA 3TFSA 1DKYA 2F7RA 1ZQDA 2KHOA 1ZQVA 4FZPA 2ZHAA 2BCVA 4NLNA 2D1LA 4IWOA 4F5NA 2ISOA 1ZQYA 4X4RA 9ICAA 1NO5A 2EX3B 4PGXA 2LXYA 3C7NA 3VEBA 3HW8A 4M0MA 2LM0A 4XQ7A 2BPGA 4K8VA 3C2LA 8ICIA 5HHIA 4HY9A 2PY6A 3NVOA 7ICJA 5J0QA 3I04A 5D4BA 3C5GA 5HC9A 5J2HA 4RPXA 4TURA 1TQVA 1OA0A 5J0RA 2DRBA 4H6HA 8ICEA 1ZQEA 4AZ6A 3PLTA 1O7DB 3RH6A 3D2FA 4BNEA 2OZNB 3I01A 5HRGA 4UB4A 4LZDA 2D4CA 1I4DA 4KLFA 3HJ1A 3EJTA 4WH5A 8ICVA 4Z6FA 9ICPA 3WFSC 4YMNA 4EEBA 4PHPA 2ELBA 4WOYA 4PHEA 1KNYA 4H8SA 2YIBA 4ATMA 4E80A 4AT8A 4WQLA 4EZNA 5J0PA 1ZQTA 3O3OB 5DB7A 3V7LA 4OAGA 3QWEA 3OGUA 1VJ7A 4FHPA 3RPMA 2Q12A 2JNSA 4X4OA 1HXKA 4NXZA 5HRFA 1ZQOA 3UQ0A 9ICFA 7ICSA 1QWUA 1TQWA 5DEDA 4XQ8A 5BOLA 4UB3A 1ZYLA 2DR8A 3NYBA 3T48A 4IW0A 4NXWA 1I4TA 3JPRA 1ZQHA 2F1BA 4YMMA 5J2KA 2RAKA 4WC1A 2O5AA 5DBCA 5J2EA 2C08A 4EZRA 5CFSA 4QZGA 4DOAA 5J2CA 4AT7B 3B0YA 4OAFA 5CFTA 1V4AA 1ZQIA 4I2FA 3ZEDA 3ISDA 4MKPA 3AUOA 1LQ7A 3HX0A 4RQ6A 3SOGA 4FHYA 3UXNA 4P2HA 2X5CA 2GWSA 4DCNC 4Z6EA 1GN9A 4FO6A 3O3MB 7ICPA 4PHDA 1MIYA 2PFQA 1ZQAA 4KLOA 2ZH9A 4QZCA 5DB9A 4K97A 7ICOA 4M0AA 9ICBA 9ICQA 4M9NA 3EJRA 8ICWA 4WC5A 4IWQA 4QZIA 1ZQKA 3DX2A 3JCFA 3L3PA 4WC0A 4S3NA 3RH4A 4IG8A 2V0OA 5J2JA 4X4TA 4X4NA 3HAHA 3ISBA 4I2EA 4KLEA 2OBMA 1HUZA 3OVBA 1R5EA 4JL9A 2RFFA 4I2IA 2ZH7A 3AQKA 9ICTA 3Q0KA 5E84A 4LEWA 4HYBA 3JPQA 4K9BA 4O9MA 3D52A 4R5KA 4EEDA 3C5FA 1ZQGA 3AU6A 4UDXX 3AQNA 1I49A 2B51A 1YLQA 4I2AA 4NQIA 2FYVA 8ICCA 2PMRA 4JWDA 4WC7A 1URUA 1X03A 2RAJA 2ZXQA 1TVAA 8ICKA 4DYLA 5D62A 4UB1A 3V7JA 3DPOA 4X4PA 1JN3A 4JWNA 4KLUA 7ICQA 4UDYX 7ICTA 4NXUA 1O7DC 8ICZA 3PHZA 4I2BA 5BPCA 3CK6A 4M9JA 4HX0A 2DR7A 2M2VA 3CZNA 4F00A 4RWQA 5DB8A 3NWIA 2ID1A 7ICHA 8ICGA 4NY8A 3K7DA 1I4LA 4KLMA 4OAHA 4MF8A 3JPPA 5C5BA 3D2EA 3ABHA 1MQ2A 4K98A 1U00A 1ZQUA 3OV7A 5HRKA 5DBBA 4FZSA 4HR1A 5J0OA 5HREA 3OUYB 3EJPA 4I29A 9ICHA 1OA1A 4LZGA 1BPDA 1RZTA 1X04A 3T49A 2OW6A 2BBHA 4WQKA 2P66A 3PNCA 1W9MA 4E8FA 5D63A 3RJFA 4LEVA 5IILA 2X3WA 4UB2A
chains in the Genus database with same CATH topology
2Z8YA 4WOYA 2EWFA 4R5GA 4EZTA 5FIGA 2YIBA 3ER8C 4H6IA 5CFUA 4WQLA 4EZNA 4FO1A 3O3OB 4OAGA 4N7RA 2IHOA 2ND0A 4HR1B 2JNSA 2GAFD 5D61A 3VEAA 4EZOA 3I39X 1GNTA 1ZYLA 1GPJA 4KIKB 4NXWA 3T48A 4IW0A 4JWIA 1JQKA 4JWEA 4LEZA 4B9QA 3OHXM 4JLXA 3KAWA 4EZRA 4NXVA 5CFSA 3B51X 3NKUA 4OAFA 5CFTA 2YI8A 3ZEDA 1SU7A 4K96A 4JN4A 3DPPA 4F01A 3A98A 4MKPA 2WINM 4R5JA 4PO2A 2YI9A 1E2UA 2X5CA 3QNJA 3VKHA 1GN9A 3O3MB 1SU8A 4JNFA 4NXXA 1E1DA 3DPQA 3F7WA 2YIAA 3RV0A 2ND1A 3EF2A 4K97A 3OWGA 3KDRA 5CHEA 3GI7A 4E3CA 4O69A 4IWQA 1MJGA 4EZXA 4O68A 3L3OM 4EZZA 2FCLA 4E81A 2QFFA 4IM2A 4O6AA 3MCRA 3KAVA 2OBMA 2NCZA 2YIVX 4KM5A 4K99A 3UITA 4IWPA 4JL9A 4EZPA 4O67A 3ER9B 3B53X 5E84A 4HYBA 4EZSA 4LEWA 3RV1A 4K9BA 4IM0A 2B4VA 4OAIZ 3LMFA 4R5KA 1OAOA 1E9VA 4NPHA 4UDXX 4EZUA 4EZQA 4IM3A 2B51A 4XJEA 1DKYA 4EZVA 3ERCC 2KHOA 4JWDA 4JLCA 5D62A 4IWOA 4R5LA 1DKXA 2RT6A 1SUFA 3DPOA 4G6QA 4EZYA 4UDYX 4NXUA 4KIKA 2EX3B 3PHZA 4EZWA 4JLZA 2OBLA 3C7NA 3VEBA 4JNEA 3T47A 4M0MA 3QA8A 2LM0A 5FLEX 2QXLA 4HX0A 4K8VA 4LEYA 2EWRA 4K9AA 4HY9A 4F00A 1GNLA 2PY6A 3I04A 4D8JA 5B3PA 3B52X 3K7DA 2GA9D 1OA0A 4H6HA 4OAHA 5B3QA 3D2EA 5TKYA 4K98A 1U00A 1DKZA 4FM3A 1UPXA 3D2FA 4HR1A 3FD9A 3I01A 1SU6A 3T46A 3T4AG 1OA1A 3T49A 3O3NB 4WH5A 2B56A 4WQKA 1W9MA 4KB6A 4JWCA 5D63A 4LEVA 4NXTA 4R5IA 2N3KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ERC C;  3OWG A;  2GA9 D;  3ER8 C;  2GAF D;  3ER9 B; 
#chains in the Genus database with same CATH topology
 4KLH A;  9ICV A;  1Y2O A;  3H39 A;  2ZH6 A;  1JAJ A;  5CFU A;  4M47 A;  3V7K A;  1ZQZ A;  3BVU A;  2FIC A;  4YD1 A;  2IHO A;  2ND0 A;  2ALW A;  2O0I 1;  4WPC A;  4QZA A;  5F2V O;  5HRD A;  1KDH A;  4M9H A;  4KLQ A;  2GAF D;  3CKD A;  1HUO A;  3D4Y A;  4KLS A;  4EZO A;  3BUI A;  4AKV A;  1ZJN A;  7ICI A;  1MQ3 A;  1GNT A;  4WCW A;  1UEU A;  5DB6 A;  4I0U A;  4KIK B;  2BPC A;  4AZC B;  4PH5 A;  3OK8 A;  1JQK A;  4NM2 A;  1KEJ A;  3AQM A;  4B9Q A;  4MFA A;  2DR9 A;  1TQT A;  2M2U A;  2FMP A;  3PMN A;  4RPZ A;  4YN4 A;  4M04 A;  1SU7 A;  3CZS A;  1ZQS A;  4JN4 A;  3DPP A;  2Z0O A;  4F01 A;  4GXI A;  3I2W A;  1BPY A;  4I28 A;  5JTG A;  1OU5 A;  2BPF A;  2YI9 A;  3AQL A;  5HHH A;  4AVM A;  3B0X A;  3CAZ A;  2FMS A;  2DR5 A;  8ICS A;  1PS3 A;  4LVS A;  3RH5 A;  4JNF A;  4X4U A;  4RQ4 A;  1WDZ A;  8ICQ A;  3RV0 A;  3EF2 A;  4ATB B;  1ZQW A;  3KDR A;  2Z0N A;  5EOZ A;  4X4S A;  5J2I A;  4E3C A;  4O69 A;  2I9G A;  3WFQ E;  1MJG A;  7ICU A;  4O5K A;  3DDG A;  1R89 A;  3DX4 A;  4UD5 A;  4EZZ A;  3DYT A;  4P4M A;  4E81 A;  2QFF A;  4IM2 A;  3JYY A;  3KAV A;  4M2Y A;  1BPB A;  2NRK A;  3BUD A;  4DOB A;  3L9D A;  4QZE A;  7ICM A;  2NCZ A;  2YIV X;  5J0S A;  4K99 A;  3UIT A;  2Q13 A;  2ZH4 A;  9ICI A;  3UQ2 A;  3QE6 A;  3WFR E;  2ZH1 A;  3G9G A;  4QZF A;  5BOM A;  4RWO A;  3LMF A;  2ZHB A;  4PPX A;  4FHX A;  1TQU A;  5J29 A;  3JPT A;  4EZQ A;  5CB1 A;  4RT2 A;  3BUP A;  3C2K A;  1RPL A;  3TFR A;  9ICM A;  4EZV A;  4UBC A;  2YLA A;  4KLT A;  2Q66 A;  2DVI A;  4JLC A;  5J0Y A;  5DBA A;  1R8A A;  4AT9 B;  1QX1 A;  2RT6 A;  3D51 A;  1SUF A;  3D4Z A;  2FMQ A;  2BCQ A;  5IIN A;  2VAN A;  9ICJ A;  4KIK A;  2EFK A;  4AZC A;  4JLZ A;  4TUP A;  1JMS A;  2OBL A;  1QWN A;  5CP2 A;  4JNE A;  3QA8 A;  1MIW A;  4LEY A;  2F18 A;  5J0W A;  3JPN A;  2JNK A;  2EWR A;  4RT3 A;  4K9A A;  1Q78 A;  2F1A A;  5J0T A;  9ICR A;  2O1P A;  4WC2 A;  4D8J A;  4NLZ A;  4X4V A;  1ZQQ A;  4I1Q A;  4RQ5 A;  3UXP A;  4KLL A;  2ZH8 A;  4NLK A;  4NKT A;  4X5V A;  3EJQ A;  4M5D A;  5J2F A;  3M3W A;  4YMO A;  5B3Q A;  2YL9 A;  4I27 A;  4UAW A;  5TKY A;  2F7Q A;  4FHW A;  4M9G A;  3C66 A;  4FM3 A;  1UPX A;  1R8C A;  2RAI A;  1BPE A;  3T46 A;  3T4A G;  4WC6 A;  8ICO A;  4F5R A;  3SYV A;  4EBJ A;  2B56 A;  2OW7 A;  4AZ7 A;  5DDY A;  8ICJ A;  7ICR A;  4QZ9 A;  4R65 A;  4QZD A;  2F7P A;  4R5I A;  4R63 A;  2N3K A;  4K4H A;  2Z8Y A;  1FA0 A;  4R5G A;  5FIG A;  9ICG A;  4X4Q A;  4XA5 A;  4R64 A;  3LQC B;  4AT7 A;  4M9L A;  4RQ7 A;  4N7R A;  7ICK A;  2EFL A;  2M2T A;  4GXJ A;  9ICC A;  2YL8 A;  3JPS A;  2X3X A;  2BCU A;  5J0X A;  5D61 A;  3LK9 A;  4X0A A;  3DX0 A;  4JWM A;  3RJI A;  4UAY A;  1BPZ A;  4IQU A;  3ISC A;  4I2H A;  1GPJ A;  4EV6 A;  3RJE A;  1ZQL A;  4P4O A;  4JWE A;  4LEZ A;  1PX5 A;  4WC4 A;  3PML A;  4NXV A;  4AT8 B;  1ZJM A;  4F5Q A;  1YWM A;  4K4I A;  1TFW A;  4WBZ A;  5D46 A;  5CHG A;  3A98 A;  2WIN M;  3C18 A;  3H37 A;  4PO2 A;  7ICL A;  4AZB A;  3BVV A;  1ZQF A;  5HRB A;  5HRH A;  4XRH A;  1E2U A;  3QNJ A;  4R66 A;  4GXK A;  4YD2 A;  4P4P A;  1ZWW A;  2Z0V A;  8ICH A;  4NXX A;  8ICU A;  3F7W A;  5DKW A;  3RJJ A;  3OWG A;  8ICM A;  4RQ8 A;  3GI7 A;  5IIK A;  4EZX A;  5D49 A;  4WPE A;  2PBE A;  4O68 A;  5J2G A;  4MF2 A;  5KBP A;  4FHV A;  2OO2 A;  2FCL A;  1XSL A;  3OVS A;  3DDF A;  5DEC A;  3CV5 A;  2F7O A;  5CR0 A;  3D50 A;  4Z6D A;  3MDC A;  4IWP A;  4UB5 A;  1MIV A;  1ZQC A;  8ICN A;  3B53 X;  5HRL A;  8ICY A;  5J2A A;  1OAO A;  5HRI A;  4EZU A;  4KLG A;  4IM3 A;  4QZB A;  3RJK A;  4KLI A;  4EBK A;  7ICG A;  4IQT A;  1R33 A;  1XSN A;  1ZQX A;  3CVR A;  3ERC C;  3ACO A;  5TZV A;  4E7X A;  1ZQR A;  2IHM A;  4R5L A;  1DKX A;  4AZI A;  4G6Q A;  9ICX A;  4EZY A;  1VFG A;  5CA7 A;  4UBB A;  1ZQN A;  2BCS A;  4RWN A;  4RQ1 A;  4EZW A;  5IIM A;  4AZH A;  4FH5 A;  2YKT A;  3HJ4 A;  3OUY A;  2HN1 A;  3MDA A;  3T47 A;  3BUQ A;  5FLE X;  2QXL A;  5HR9 A;  8ICB A;  3MGI A;  3LVT A;  2BCR A;  1GNL A;  8ICA A;  5B3P A;  3B52 X;  4DO9 A;  2PFP A;  3GDX A;  2ZH2 A;  2GA9 D;  3UPQ A;  3BLB A;  1UEV A;  4PGQ A;  1HWW A;  4RPY A;  9ICN A;  7ICN A;  9ICU A;  3EJS A;  1TQS A;  4X0B A;  1NOM A;  1DKZ A;  4FH3 A;  3MBY A;  2ISP A;  8ICF A;  8ICX A;  2IUB A;  3FD9 A;  4NSW A;  2ZH5 A;  1SU6 A;  4EGW A;  2WYH A;  3BUB A;  3Q84 A;  8ICL A;  2X3V A;  2YL6 A;  2W9M A;  3AU2 A;  1BPX A;  3O3N B;  3HAI A;  4LT6 A;  4TUS A;  4KB6 A;  4UAZ A;  3BVT A;  4JWC A;  3HIY A;  3RJG A;  2GF4 A;  4UD4 A;  5J0U A;  3V72 A;  9ICO A;  4NXT A;  3EJU A;  7ICE A;  2EWF A;  4EZT A;  3H38 A;  3UXO A;  1R34 A;  8ICR A;  3ER8 C;  9ICL A;  4H6I A;  3BVW A;  3MGH A;  5C5B B;  2MI7 A;  4FO1 A;  3UPS A;  4WBY A;  4HR1 B;  4O5E A;  3BVX A;  1ZQB A;  1ZQM A;  3VEA A;  2PFO A;  3I39 X;  4FZO A;  8ICT A;  1TFY A;  4MFC A;  5J2D A;  3DX3 A;  4JWI A;  2QKW A;  4XUS A;  4F5P A;  4NKU A;  2DRA A;  9ICS A;  4JLX A;  3OHX M;  9ICK A;  4ATB A;  1TV9 A;  3KAW A;  3WFP A;  4QZ8 A;  2ZH3 A;  1JQR A;  3B51 X;  3LLL A;  3NKU A;  2YI8 A;  1WOT A;  4RQ0 A;  4I2D A;  4K96 A;  2PFN A;  4R5J A;  3DX1 A;  4IQW A;  3JZ0 A;  5CWR A;  4YCX A;  5CJ7 A;  3JPO A;  3VKH A;  5J2B A;  9ICW A;  1SU8 A;  9ICE A;  4AZG A;  1R8B A;  3WFO A;  1E1D A;  3DPQ A;  7ICV A;  2YIA A;  5III A;  1Q79 A;  4PGY A;  2ND1 A;  4I2C A;  5IIO A;  5CHE A;  3C2M A;  4O5C A;  4F5O A;  1F5A A;  4I2J A;  2BE3 A;  3OVA A;  3L3O M;  2BBJ A;  4Z6C A;  3H3A A;  5DDM A;  2PXI A;  3K75 D;  7ICF A;  3QNI A;  4NM1 A;  4O6A A;  3MCR A;  4EP7 A;  4AT9 A;  1ZQP A;  1HTY A;  2YLL A;  2HHP A;  4IQV A;  4KLJ A;  4KM5 A;  4PHA A;  2M2W A;  4I2G A;  4EZP A;  4MFF A;  8ICP A;  4KLD A;  4WC3 A;  4O67 A;  4K4G A;  3HAJ A;  3HWT A;  3RJH A;  4QZH A;  3ER9 B;  4EZS A;  4RQ2 A;  3RV1 A;  4AZ5 A;  4IM0 A;  2B4V A;  4OAI Z;  4RWP A;  1ZQJ A;  1UET A;  1E9V A;  2YL5 A;  4NPH A;  4RQ3 A;  1XSP A;  2HN2 A;  4TUQ A;  5IIJ A;  2WYI A;  4XJE A;  4DOC A;  3TFS A;  1DKY A;  2F7R A;  1ZQD A;  2KHO A;  1ZQV A;  4FZP A;  2ZHA A;  2BCV A;  4NLN A;  2D1L A;  4IWO A;  4F5N A;  2ISO A;  1ZQY A;  4X4R A;  9ICA A;  1NO5 A;  2EX3 B;  4PGX A;  2LXY A;  3C7N A;  3VEB A;  3HW8 A;  4M0M A;  2LM0 A;  4XQ7 A;  2BPG A;  4K8V A;  3C2L A;  8ICI A;  5HHI A;  4HY9 A;  2PY6 A;  3NVO A;  7ICJ A;  5J0Q A;  3I04 A;  5D4B A;  3C5G A;  5HC9 A;  5J2H A;  4RPX A;  4TUR A;  1TQV A;  1OA0 A;  5J0R A;  2DRB A;  4H6H A;  8ICE A;  1ZQE A;  4AZ6 A;  3PLT A;  1O7D B;  3RH6 A;  3D2F A;  4BNE A;  2OZN B;  3I01 A;  5HRG A;  4UB4 A;  4LZD A;  2D4C A;  1I4D A;  4KLF A;  3HJ1 A;  3EJT A;  4WH5 A;  8ICV A;  4Z6F A;  9ICP A;  3WFS C;  4YMN A;  4EEB A;  4PHP A;  2ELB A;  4WOY A;  4PHE A;  1KNY A;  4H8S A;  2YIB A;  4ATM A;  4E80 A;  4AT8 A;  4WQL A;  4EZN A;  5J0P A;  1ZQT A;  3O3O B;  5DB7 A;  3V7L A;  4OAG A;  3QWE A;  3OGU A;  1VJ7 A;  4FHP A;  3RPM A;  2Q12 A;  2JNS A;  4X4O A;  1HXK A;  4NXZ A;  5HRF A;  1ZQO A;  3UQ0 A;  9ICF A;  7ICS A;  1QWU A;  1TQW A;  5DED A;  4XQ8 A;  5BOL A;  4UB3 A;  1ZYL A;  2DR8 A;  3NYB A;  3T48 A;  4IW0 A;  4NXW A;  1I4T A;  3JPR A;  1ZQH A;  2F1B A;  4YMM A;  5J2K A;  2RAK A;  4WC1 A;  2O5A A;  5DBC A;  5J2E A;  2C08 A;  4EZR A;  5CFS A;  4QZG A;  4DOA A;  5J2C A;  4AT7 B;  3B0Y A;  4OAF A;  5CFT A;  1V4A A;  1ZQI A;  4I2F A;  3ZED A;  3ISD A;  4MKP A;  3AUO A;  1LQ7 A;  3HX0 A;  4RQ6 A;  3SOG A;  4FHY A;  3UXN A;  4P2H A;  2X5C A;  2GWS A;  4DCN C;  4Z6E A;  1GN9 A;  4FO6 A;  3O3M B;  7ICP A;  4PHD A;  1MIY A;  2PFQ A;  1ZQA A;  4KLO A;  2ZH9 A;  4QZC A;  5DB9 A;  4K97 A;  7ICO A;  4M0A A;  9ICB A;  9ICQ A;  4M9N A;  3EJR A;  8ICW A;  4WC5 A;  4IWQ A;  4QZI A;  1ZQK A;  3DX2 A;  3JCF A;  3L3P A;  4WC0 A;  4S3N A;  3RH4 A;  4IG8 A;  2V0O A;  5J2J A;  4X4T A;  4X4N A;  3HAH A;  3ISB A;  4I2E A;  4KLE A;  2OBM A;  1HUZ A;  3OVB A;  1R5E A;  4JL9 A;  2RFF A;  4I2I A;  2ZH7 A;  3AQK A;  9ICT A;  3Q0K A;  5E84 A;  4LEW A;  4HYB A;  3JPQ A;  4K9B A;  4O9M A;  3D52 A;  4R5K A;  4EED A;  3C5F A;  1ZQG A;  3AU6 A;  4UDX X;  3AQN A;  1I49 A;  2B51 A;  1YLQ A;  4I2A A;  4NQI A;  2FYV A;  8ICC A;  2PMR A;  4JWD A;  4WC7 A;  1URU A;  1X03 A;  2RAJ A;  2ZXQ A;  1TVA A;  8ICK A;  4DYL A;  5D62 A;  4UB1 A;  3V7J A;  3DPO A;  4X4P A;  1JN3 A;  4JWN A;  4KLU A;  7ICQ A;  4UDY X;  7ICT A;  4NXU A;  1O7D C;  8ICZ A;  3PHZ A;  4I2B A;  5BPC A;  3CK6 A;  4M9J A;  4HX0 A;  2DR7 A;  2M2V A;  3CZN A;  4F00 A;  4RWQ A;  5DB8 A;  3NWI A;  2ID1 A;  7ICH A;  8ICG A;  4NY8 A;  3K7D A;  1I4L A;  4KLM A;  4OAH A;  4MF8 A;  3JPP A;  5C5B A;  3D2E A;  3ABH A;  1MQ2 A;  4K98 A;  1U00 A;  1ZQU A;  3OV7 A;  5HRK A;  5DBB A;  4FZS A;  4HR1 A;  5J0O A;  5HRE A;  3OUY B;  3EJP A;  4I29 A;  9ICH A;  1OA1 A;  4LZG A;  1BPD A;  1RZT A;  1X04 A;  3T49 A;  2OW6 A;  2BBH A;  4WQK A;  2P66 A;  3PNC A;  1W9M A;  4E8F A;  5D63 A;  3RJF A;  4LEV A;  5IIL A;  2X3W A;  4UB2 A; 
#chains in the Genus database with same CATH homology
 2Z8Y A;  4WOY A;  2EWF A;  4R5G A;  4EZT A;  5FIG A;  2YIB A;  3ER8 C;  4H6I A;  5CFU A;  4WQL A;  4EZN A;  4FO1 A;  3O3O B;  4OAG A;  4N7R A;  2IHO A;  2ND0 A;  4HR1 B;  2JNS A;  2GAF D;  5D61 A;  3VEA A;  4EZO A;  3I39 X;  1GNT A;  1ZYL A;  1GPJ A;  4KIK B;  4NXW A;  3T48 A;  4IW0 A;  4JWI A;  1JQK A;  4JWE A;  4LEZ A;  4B9Q A;  3OHX M;  4JLX A;  3KAW A;  4EZR A;  4NXV A;  5CFS A;  3B51 X;  3NKU A;  4OAF A;  5CFT A;  2YI8 A;  3ZED A;  1SU7 A;  4K96 A;  4JN4 A;  3DPP A;  4F01 A;  3A98 A;  4MKP A;  2WIN M;  4R5J A;  4PO2 A;  2YI9 A;  1E2U A;  2X5C A;  3QNJ A;  3VKH A;  1GN9 A;  3O3M B;  1SU8 A;  4JNF A;  4NXX A;  1E1D A;  3DPQ A;  3F7W A;  2YIA A;  3RV0 A;  2ND1 A;  3EF2 A;  4K97 A;  3OWG A;  3KDR A;  5CHE A;  3GI7 A;  4E3C A;  4O69 A;  4IWQ A;  1MJG A;  4EZX A;  4O68 A;  3L3O M;  4EZZ A;  2FCL A;  4E81 A;  2QFF A;  4IM2 A;  4O6A A;  3MCR A;  3KAV A;  2OBM A;  2NCZ A;  2YIV X;  4KM5 A;  4K99 A;  3UIT A;  4IWP A;  4JL9 A;  4EZP A;  4O67 A;  3ER9 B;  3B53 X;  5E84 A;  4HYB A;  4EZS A;  4LEW A;  3RV1 A;  4K9B A;  4IM0 A;  2B4V A;  4OAI Z;  3LMF A;  4R5K A;  1OAO A;  1E9V A;  4NPH A;  4UDX X;  4EZU A;  4EZQ A;  4IM3 A;  2B51 A;  4XJE A;  1DKY A;  4EZV A;  3ERC C;  2KHO A;  4JWD A;  4JLC A;  5D62 A;  4IWO A;  4R5L A;  1DKX A;  2RT6 A;  1SUF A;  3DPO A;  4G6Q A;  4EZY A;  4UDY X;  4NXU A;  4KIK A;  2EX3 B;  3PHZ A;  4EZW A;  4JLZ A;  2OBL A;  3C7N A;  3VEB A;  4JNE A;  3T47 A;  4M0M A;  3QA8 A;  2LM0 A;  5FLE X;  2QXL A;  4HX0 A;  4K8V A;  4LEY A;  2EWR A;  4K9A A;  4HY9 A;  4F00 A;  1GNL A;  2PY6 A;  3I04 A;  4D8J A;  5B3P A;  3B52 X;  3K7D A;  2GA9 D;  1OA0 A;  4H6H A;  4OAH A;  5B3Q A;  3D2E A;  5TKY A;  4K98 A;  1U00 A;  1DKZ A;  4FM3 A;  1UPX A;  3D2F A;  4HR1 A;  3FD9 A;  3I01 A;  1SU6 A;  3T46 A;  3T4A G;  1OA1 A;  3T49 A;  3O3N B;  4WH5 A;  2B56 A;  4WQK A;  1W9M A;  4KB6 A;  4JWC A;  5D63 A;  4LEV A;  4NXT A;  4R5I A;  2N3K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...