4I1QA

Crystal structure of hbrap1 n-bar domain
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
200
structure length
200
Chain Sequence
KDERFEQSANNFYQQQAEGHKLYKDLKNFLSAVKVMHESSKRVSETLQEIYSSEWDGHEELKAIVWNNDLLWEDYEEKLADQAVRTMEIYVAQFSEIKERIAKRGRKLVDYDSARHHLEAVQNAKKKDEAKTAKAEEEFNKAQTVFEDLNQELLEELPILYNSRIGCYVTIFQNISNLRDVFYREMSKLNHNLYEVMSKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Bridging integrator 2
publication title Bin2 Is a Membrane Sculpting N-BAR Protein That Influences Leucocyte Podosomes, Motility and Phagocytosis
pubmed doi rcsb
source organism Homo sapiens
total genus 89
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 4i1qA00
1Y2OA 1I4DA 1URUA 1X03A 2Q12A 2X3VA 1I4TA 1I4LA 2EFKA 2Z0OA 3ACOA 4ATMA 3QE6A 1WDZA 4H8SA 4I1QA 3HAIA 3I2WA 2X3WA 3OK8A 3Q0KA 4WPCA 2EFLA 2YKTA 1I49A 2RAJA 4NQIA 3G9GA 3ABHA 2RAKA 3CAZA 5C5BB 3SYVA 3QWEA 2FICA 1ZWWA 4AVMA 4WPEA 2X3XA 2ELBA 2Z0VA 3Q84A 4DYLA 2C08A 3DYTA 3M3WA 1X04A 3HAJA 2V0OA 4FZSA 4AKVA 2RAIA 3PLTA 5C5BA 4NSWA 3LLLA 4DCNC 3QNIA 3HAHA 4BNEA 3SOGA 2D1LA 2Q13A 2D4CA 2Z0NA
chains in the Genus database with same CATH superfamily
5FLEX 1I4LA 2F7RA 3D52A 4KIKB 4F01A 1E9VA 4AZCA 3CKDA 3DDFA 1SUFA 1TQSA 2FYVA 4NPHA 1HTYA 2YIAA 2MI7A 5FIGA 4FM3A 1TQVA 3EJTA 4HY9A 3L3PA 2GAFD 3BUQA 3FD9A 4IWQA 2GA9D 4AZIA 2KHOA 2F7OA 2F1AA 3CAZA 2X3XA 3B52X 3HAJA 2EWFA 3OWGA 1URUA 2OBLA 2F7PA 2EFKA 4HYBA 2ALWA 4EZZA 2NCZA 3BLBA 2YL9A 2YLAA 1DKXA 4EZNA 3CZSA 3D2EA 3DX3A 3RPMA 4EZQA 4IM2A 1ZYLA 2D1LA 2D4CA 3T46A 2YL8A 2Z8YA 3C7NA 4R5JA 3EJUA 4EZUA 1HWWA 4JWEA 2QFFA 4AVMA 2ELBA 3Q84A 2GF4A 3KAVA 4E81A 3BUIA 1E2UA 1U00A 5TKYA 5C5BA 2RT6A 1X03A 2JNKA 4IM3A 4R5IA 4JL9A 1JQKA 2OBMA 5C5BB 4JWDA 4B9QA 4KIKA 3EJPA 4JWCA 4G6QA 2Q13A 4D8JA 3RV0A 4JNEA 1TQWA 1W9MA 2Z0OA 1R34A 4AZ7A 3BUPA 3I2WA 1SU8A 1TQUA 2WYIA 3ZEDA 3QWEA 4JWIA 3UITA 2LM0A 2YI8A 4IWOA 2YIBA 4NSWA 4AZ5A 2Q12A 1YWMA 1LQ7A 3QNJA 2WYHA 4H6HA 4EZSA 1OAOA 1ZWWA 4H6IA 3DX0A 3LMFA 4EZXA 4EZWA 4AZBA 4DCNC 1UPXA 3CV5A 3HAHA 2OZNB 2YIVX 1TQTA 4AZGA 1QX1A 1WDZA 1QWUA 2ND0A 3KAWA 3B51X 4EZVA 2PY6A 2Z0VA 4EZYA 3DYTA 1OA0A 2O0I1 3RV1A 2OO2A 2RAIA 3BVXA 3PLTA 4M0MA 1Y2OA 3B53X 4HR1B 4ATMA 3BVWA 3I04A 4R5KA 1MJGA 4IWPA 4JN4A 2YLLA 4JNFA 5KBPA 4FZOA 1O7DB 4UDXX 4JLCA 2LXYA 3SOGA 3BVUA 3DPPA 1I4DA 4F00A 4H8SA 2YL6A 2OW6A 2RAJA 3ER9B 3D50A 3SYVA 4WPEA 3BUDA 2YI9A 4EZTA 3DDGA 3GI7A 3VKHA 4EZPA 3QNIA 3BVVA 2N3KA 3DPOA 1GN9A 3T47A 1GNLA 4FZPA 3HAIA 3O3NB 2X3WA 3OK8A 4WPCA 2EFLA 2YKTA 3CVRA 2YL5A 3KDRA 1E1DA 2WINM 2V0OA 4BNEA 2OW7A 2Z0NA 3T49A 2F1BA 4UDYX 1O7DC 5E84A 3T48A 1DKZA 3QA8A 1QWNA 1I49A 3D4ZA 4EZOA 4R5GA 3A98A 4FZSA 4AZCB 2F7QA 4AZHA 3DX4A 4IW0A 1R5EA 3D51A 4I1QA 4IM0A 4NQIA 3L3OM 2PMRA 3VEBA 4HR1A 4AZ6A 3EJQA 4AKVA 3T4AG 3DX2A 3BUBA 3BVTA 2ND1A 1OA1A 1DKYA 1I4TA 3Q0KA 2RAKA 2C08A 1PS3A 1HXKA 3DPQA 2EX3B 3O3OB 3LVTA 4EZRA 2X3VA 3EJSA 3QE6A 3ERCC 1SU6A 3EJRA 2JNSA 3ER8C 2FICA 3I39X 4DYLA 3M3WA 1X04A 3D2FA 2X5CA 4E3CA 3VEAA 3OHXM 4R5LA 1R33A 4PO2A 2QXLA 3ACOA 1GNTA 3ABHA 3G9GA 3DX1A 2QKWA 3D4YA 3O3MB 2F18A 3LLLA 3I01A 3F7WA 3CZNA 2ZXQA 1SU7A
chains in the Genus database with same CATH topology
1Y2OA 1I4DA 1URUA 1X03A 2Q12A 2X3VA 1I4TA 1I4LA 2EFKA 2Z0OA 3ACOA 4ATMA 3QE6A 1WDZA 4H8SA 4I1QA 3HAIA 3I2WA 2X3WA 3OK8A 3Q0KA 4WPCA 2EFLA 2YKTA 1I49A 2RAJA 4NQIA 3G9GA 3ABHA 2RAKA 3CAZA 5C5BB 3SYVA 3QWEA 2FICA 1ZWWA 4AVMA 4WPEA 2X3XA 2ELBA 2Z0VA 3Q84A 4DYLA 2C08A 3DYTA 3M3WA 1X04A 3HAJA 2V0OA 4FZSA 4AKVA 2RAIA 3PLTA 5C5BA 4NSWA 3LLLA 4DCNC 3QNIA 3HAHA 4BNEA 3SOGA 2D1LA 2Q13A 2D4CA 2Z0NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y2O A;  1I4D A;  1URU A;  1X03 A;  2Q12 A;  2X3V A;  1I4T A;  1I4L A;  2EFK A;  2Z0O A;  3ACO A;  4ATM A;  3QE6 A;  1WDZ A;  4H8S A;  4I1Q A;  3HAI A;  3I2W A;  2X3W A;  3OK8 A;  3Q0K A;  4WPC A;  2EFL A;  2YKT A;  1I49 A;  2RAJ A;  4NQI A;  3G9G A;  3ABH A;  2RAK A;  3CAZ A;  5C5B B;  3SYV A;  3QWE A;  2FIC A;  1ZWW A;  4AVM A;  4WPE A;  2X3X A;  2ELB A;  2Z0V A;  3Q84 A;  4DYL A;  2C08 A;  3DYT A;  3M3W A;  1X04 A;  3HAJ A;  2V0O A;  4FZS A;  4AKV A;  2RAI A;  3PLT A;  5C5B A;  4NSW A;  3LLL A;  4DCN C;  3QNI A;  3HAH A;  4BNE A;  3SOG A;  2D1L A;  2Q13 A;  2D4C A;  2Z0N A; 
#chains in the Genus database with same CATH topology
 5FLE X;  1I4L A;  2F7R A;  3D52 A;  4KIK B;  4F01 A;  1E9V A;  4AZC A;  3CKD A;  3DDF A;  1SUF A;  1TQS A;  2FYV A;  4NPH A;  1HTY A;  2YIA A;  2MI7 A;  5FIG A;  4FM3 A;  1TQV A;  3EJT A;  4HY9 A;  3L3P A;  2GAF D;  3BUQ A;  3FD9 A;  4IWQ A;  2GA9 D;  4AZI A;  2KHO A;  2F7O A;  2F1A A;  3CAZ A;  2X3X A;  3B52 X;  3HAJ A;  2EWF A;  3OWG A;  1URU A;  2OBL A;  2F7P A;  2EFK A;  4HYB A;  2ALW A;  4EZZ A;  2NCZ A;  3BLB A;  2YL9 A;  2YLA A;  1DKX A;  4EZN A;  3CZS A;  3D2E A;  3DX3 A;  3RPM A;  4EZQ A;  4IM2 A;  1ZYL A;  2D1L A;  2D4C A;  3T46 A;  2YL8 A;  2Z8Y A;  3C7N A;  4R5J A;  3EJU A;  4EZU A;  1HWW A;  4JWE A;  2QFF A;  4AVM A;  2ELB A;  3Q84 A;  2GF4 A;  3KAV A;  4E81 A;  3BUI A;  1E2U A;  1U00 A;  5TKY A;  5C5B A;  2RT6 A;  1X03 A;  2JNK A;  4IM3 A;  4R5I A;  4JL9 A;  1JQK A;  2OBM A;  5C5B B;  4JWD A;  4B9Q A;  4KIK A;  3EJP A;  4JWC A;  4G6Q A;  2Q13 A;  4D8J A;  3RV0 A;  4JNE A;  1TQW A;  1W9M A;  2Z0O A;  1R34 A;  4AZ7 A;  3BUP A;  3I2W A;  1SU8 A;  1TQU A;  2WYI A;  3ZED A;  3QWE A;  4JWI A;  3UIT A;  2LM0 A;  2YI8 A;  4IWO A;  2YIB A;  4NSW A;  4AZ5 A;  2Q12 A;  1YWM A;  1LQ7 A;  3QNJ A;  2WYH A;  4H6H A;  4EZS A;  1OAO A;  1ZWW A;  4H6I A;  3DX0 A;  3LMF A;  4EZX A;  4EZW A;  4AZB A;  4DCN C;  1UPX A;  3CV5 A;  3HAH A;  2OZN B;  2YIV X;  1TQT A;  4AZG A;  1QX1 A;  1WDZ A;  1QWU A;  2ND0 A;  3KAW A;  3B51 X;  4EZV A;  2PY6 A;  2Z0V A;  4EZY A;  3DYT A;  1OA0 A;  2O0I 1;  3RV1 A;  2OO2 A;  2RAI A;  3BVX A;  3PLT A;  4M0M A;  1Y2O A;  3B53 X;  4HR1 B;  4ATM A;  3BVW A;  3I04 A;  4R5K A;  1MJG A;  4IWP A;  4JN4 A;  2YLL A;  4JNF A;  5KBP A;  4FZO A;  1O7D B;  4UDX X;  4JLC A;  2LXY A;  3SOG A;  3BVU A;  3DPP A;  1I4D A;  4F00 A;  4H8S A;  2YL6 A;  2OW6 A;  2RAJ A;  3ER9 B;  3D50 A;  3SYV A;  4WPE A;  3BUD A;  2YI9 A;  4EZT A;  3DDG A;  3GI7 A;  3VKH A;  4EZP A;  3QNI A;  3BVV A;  2N3K A;  3DPO A;  1GN9 A;  3T47 A;  1GNL A;  4FZP A;  3HAI A;  3O3N B;  2X3W A;  3OK8 A;  4WPC A;  2EFL A;  2YKT A;  3CVR A;  2YL5 A;  3KDR A;  1E1D A;  2WIN M;  2V0O A;  4BNE A;  2OW7 A;  2Z0N A;  3T49 A;  2F1B A;  4UDY X;  1O7D C;  5E84 A;  3T48 A;  1DKZ A;  3QA8 A;  1QWN A;  1I49 A;  3D4Z A;  4EZO A;  4R5G A;  3A98 A;  4FZS A;  4AZC B;  2F7Q A;  4AZH A;  3DX4 A;  4IW0 A;  1R5E A;  3D51 A;  4I1Q A;  4IM0 A;  4NQI A;  3L3O M;  2PMR A;  3VEB A;  4HR1 A;  4AZ6 A;  3EJQ A;  4AKV A;  3T4A G;  3DX2 A;  3BUB A;  3BVT A;  2ND1 A;  1OA1 A;  1DKY A;  1I4T A;  3Q0K A;  2RAK A;  2C08 A;  1PS3 A;  1HXK A;  3DPQ A;  2EX3 B;  3O3O B;  3LVT A;  4EZR A;  2X3V A;  3EJS A;  3QE6 A;  3ERC C;  1SU6 A;  3EJR A;  2JNS A;  3ER8 C;  2FIC A;  3I39 X;  4DYL A;  3M3W A;  1X04 A;  3D2F A;  2X5C A;  4E3C A;  3VEA A;  3OHX M;  4R5L A;  1R33 A;  4PO2 A;  2QXL A;  3ACO A;  1GNT A;  3ABH A;  3G9G A;  3DX1 A;  2QKW A;  3D4Y A;  3O3M B;  2F18 A;  3LLL A;  3I01 A;  3F7W A;  3CZN A;  2ZXQ A;  1SU7 A; 
#chains in the Genus database with same CATH homology
 1Y2O A;  1I4D A;  1URU A;  1X03 A;  2Q12 A;  2X3V A;  1I4T A;  1I4L A;  2EFK A;  2Z0O A;  3ACO A;  4ATM A;  3QE6 A;  1WDZ A;  4H8S A;  4I1Q A;  3HAI A;  3I2W A;  2X3W A;  3OK8 A;  3Q0K A;  4WPC A;  2EFL A;  2YKT A;  1I49 A;  2RAJ A;  4NQI A;  3G9G A;  3ABH A;  2RAK A;  3CAZ A;  5C5B B;  3SYV A;  3QWE A;  2FIC A;  1ZWW A;  4AVM A;  4WPE A;  2X3X A;  2ELB A;  2Z0V A;  3Q84 A;  4DYL A;  2C08 A;  3DYT A;  3M3W A;  1X04 A;  3HAJ A;  2V0O A;  4FZS A;  4AKV A;  2RAI A;  3PLT A;  5C5B A;  4NSW A;  3LLL A;  4DCN C;  3QNI A;  3HAH A;  4BNE A;  3SOG A;  2D1L A;  2Q13 A;  2D4C A;  2Z0N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...