4I1QA

Crystal structure of hbrap1 n-bar domain
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
200
structure length
200
Chain Sequence
KDERFEQSANNFYQQQAEGHKLYKDLKNFLSAVKVMHESSKRVSETLQEIYSSEWDGHEELKAIVWNNDLLWEDYEEKLADQAVRTMEIYVAQFSEIKERIAKRGRKLVDYDSARHHLEAVQNAKKKDEAKTAKAEEEFNKAQTVFEDLNQELLEELPILYNSRIGCYVTIFQNISNLRDVFYREMSKLNHNLYEVMSKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bridging integrator 2
publication title Bin2 Is a Membrane Sculpting N-BAR Protein That Influences Leucocyte Podosomes, Motility and Phagocytosis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 89
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 4i1qA00
4AVMA 2ELBA 3Q0KA 4FZSA 5C5BA 2C08A 1WDZA 3ACOA 1X04A 1X03A 1Y2OA 2Z0NA 3PLTA 3CAZA 5C5BB 3QNIA 3OK8A 3SOGA 4NSWA 3HAJA 2D1LA 2D4CA 2RAJA 2X3XA 3ABHA 3HAIA 3SYVA 4WPEA 4BNEA 3LLLA 3HAHA 2RAIA 1ZWWA 3QWEA 2EFLA 1I4TA 2EFKA 2Q12A 2V0OA 3DYTA 2Z0OA 3G9GA 1I4LA 4DCNC 4I1QA 3QE6A 1URUA 2X3WA 3M3WA 2FICA 4NQIA 4ATMA 4WPCA 4DYLA 3Q84A 1I49A 1I4DA 2RAKA 2Z0VA 2X3VA 4H8SA 4AKVA 2YKTA 3I2WA 2Q13A
chains in the Genus database with same CATH superfamily
3VEAA 1SU8A 2C08A 1WDZA 3DPOA 1Y2OA 3DX1A 4EZOA 2ND0A 3QNIA 3HAJA 3HAIA 2EX3B 4WPEA 1UPXA 3SYVA 3CZNA 4EZSA 5TKYA 4FM3A 3BLBA 1GN9A 3ERCC 2YIVX 4KIKA 3I01A 3KDRA 4KIKB 4UDXX 2O0I1 4R5GA 2YL9A 3KAVA 2D1LA 4UDYX 1U00A 2YL6A 3HAHA 3BUPA 2Q13A 4JWIA 1E9VA 4NPHA 1X04A 3BVWA 2RAJA 3EJSA 3A98A 2JNSA 4EZXA 1I4TA 2EFKA 4DCNC 3ER8C 4I1QA 3DX2A 2YL5A 3EJUA 3M3WA 2F7RA 1O7DC 4HR1B 1I4DA 4H8SA 3RV0A 3Q0KA 3BUBA 3O3OB 1HWWA 1JQKA 3T49A 1ZWWA 3OHXM 2LXYA 2Z0OA 4JWCA 2PMRA 4IW0A 2GA9D 2WINM 1OAOA 1GNTA 5KBPA 2F1BA 2N3KA 3EJPA 3DX3A 2Z0NA 4AZCA 2YI9A 3B51X 2YIAA 2OW7A 5E84A 4BNEA 3D4ZA 1R34A 2Z8YA 2MI7A 3T48A 3QNJA 2OBLA 2Z0VA 1YWMA 2F7PA 1GNLA 2YLLA 4H6HA 3L3PA 1HTYA 4D8JA 3L3OM 4E3CA 1OA1A 3FD9A 4AZ6A 2V0OA 4AZGA 3DDGA 4WPCA 4F00A 3ZEDA 3EJTA 4AKVA 2KHOA 3T4AG 4EZUA 3O3NB 3CZSA 4R5JA 4JNFA 3BUQA 2JNKA 1SU7A 3DPQA 3T46A 1QWNA 3VEBA 1URUA 3D52A 2QKWA 2YI8A 3BVUA 1TQVA 2ZXQA 3OWGA 3Q84A 3BUIA 4AZ5A 1DKYA 3QE6A 2OO2A 3DPPA 3LMFA 1ZYLA 4EZPA 4JN4A 2D4CA 3BUDA 4EZRA 1E2UA 3DX4A 4IWPA 3T47A 2WYIA 2OW6A 1R5EA 1PS3A 4FZOA 1TQWA 4JWDA 3I39X 1QWUA 4FZSA 4H6IA 3EJRA 4AZ7A 4NSWA 3RPMA 3D4YA 2GF4A 3G9GA 1MJGA 5FLEX 1QX1A 3I04A 4NQIA 3CVRA 3VKHA 1O7DB 4R5KA 2FYVA 3ER9B 3CAZA 1DKXA 1TQSA 4AZCB 2F1AA 1I4LA 4G6QA 1SU6A 4IWOA 4DYLA 4JL9A 4B9QA 4JWEA 2PY6A 2ALWA 2QXLA 2OBMA 3ACOA 3PLTA 4PO2A 4IM2A 3DDFA 3CV5A 4EZVA 4HYBA 3DYTA 3D2EA 1TQTA 2LM0A 4EZTA 2GAFD 4FZPA 4R5LA 4AZBA 3F7WA 3B52X 1HXKA 2X5CA 2EFLA 5FIGA 4EZWA 3DX0A 4IWQA 1SUFA 4E81A 4AZHA 2OZNB 2X3XA 2YIBA 3ABHA 3D51A 4AZIA 3LLLA 2EWFA 3UITA 2X3WA 2RT6A 4EZZA 4JNEA 3EJQA 2RAKA 2X3VA 4F01A 4R5IA 1LQ7A 5C5BA 2QFFA 5C5BB 3SOGA 4EZQA 1DKZA 4HY9A 4HR1A 3BVTA 2FICA 4ATMA 2YL8A 1R33A 1I49A 1E1DA 2NCZA 3CKDA 3RV1A 4M0MA 1X03A 3B53X 3O3MB 2ND1A 3OK8A 4IM3A 2RAIA 2Q12A 2F7QA 3D2FA 4EZYA 3LVTA 2YKTA 3BVVA 2F7OA 3D50A 3I2WA 4AVMA 3QA8A 2ELBA 1TQUA 4IM0A 1W9MA 3QWEA 3C7NA 4EZNA 3GI7A 3KAWA 1OA0A 4JLCA 3BVXA 2YLAA 2F18A 2WYHA
chains in the Genus database with same CATH topology
4AVMA 2ELBA 3Q0KA 4FZSA 5C5BA 2C08A 1WDZA 3ACOA 1X04A 1X03A 1Y2OA 2Z0NA 3PLTA 3CAZA 5C5BB 3QNIA 3OK8A 3SOGA 4NSWA 3HAJA 2D1LA 2D4CA 2RAJA 2X3XA 3ABHA 3HAIA 3SYVA 4WPEA 4BNEA 3LLLA 3HAHA 2RAIA 1ZWWA 3QWEA 2EFLA 1I4TA 2EFKA 2Q12A 2V0OA 3DYTA 2Z0OA 3G9GA 1I4LA 4DCNC 4I1QA 3QE6A 1URUA 2X3WA 3M3WA 2FICA 4NQIA 4ATMA 4WPCA 4DYLA 3Q84A 1I49A 1I4DA 2RAKA 2Z0VA 2X3VA 4H8SA 4AKVA 2YKTA 3I2WA 2Q13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AVM A;  2ELB A;  3Q0K A;  4FZS A;  5C5B A;  2C08 A;  1WDZ A;  3ACO A;  1X04 A;  1X03 A;  1Y2O A;  2Z0N A;  3PLT A;  3CAZ A;  5C5B B;  3QNI A;  3OK8 A;  3SOG A;  4NSW A;  3HAJ A;  2D1L A;  2D4C A;  2RAJ A;  2X3X A;  3ABH A;  3HAI A;  3SYV A;  4WPE A;  4BNE A;  3LLL A;  3HAH A;  2RAI A;  1ZWW A;  3QWE A;  2EFL A;  1I4T A;  2EFK A;  2Q12 A;  2V0O A;  3DYT A;  2Z0O A;  3G9G A;  1I4L A;  4DCN C;  4I1Q A;  3QE6 A;  1URU A;  2X3W A;  3M3W A;  2FIC A;  4NQI A;  4ATM A;  4WPC A;  4DYL A;  3Q84 A;  1I49 A;  1I4D A;  2RAK A;  2Z0V A;  2X3V A;  4H8S A;  4AKV A;  2YKT A;  3I2W A;  2Q13 A; 
#chains in the Genus database with same CATH topology
 3VEA A;  1SU8 A;  2C08 A;  1WDZ A;  3DPO A;  1Y2O A;  3DX1 A;  4EZO A;  2ND0 A;  3QNI A;  3HAJ A;  3HAI A;  2EX3 B;  4WPE A;  1UPX A;  3SYV A;  3CZN A;  4EZS A;  5TKY A;  4FM3 A;  3BLB A;  1GN9 A;  3ERC C;  2YIV X;  4KIK A;  3I01 A;  3KDR A;  4KIK B;  4UDX X;  2O0I 1;  4R5G A;  2YL9 A;  3KAV A;  2D1L A;  4UDY X;  1U00 A;  2YL6 A;  3HAH A;  3BUP A;  2Q13 A;  4JWI A;  1E9V A;  4NPH A;  1X04 A;  3BVW A;  2RAJ A;  3EJS A;  3A98 A;  2JNS A;  4EZX A;  1I4T A;  2EFK A;  4DCN C;  3ER8 C;  4I1Q A;  3DX2 A;  2YL5 A;  3EJU A;  3M3W A;  2F7R A;  1O7D C;  4HR1 B;  1I4D A;  4H8S A;  3RV0 A;  3Q0K A;  3BUB A;  3O3O B;  1HWW A;  1JQK A;  3T49 A;  1ZWW A;  3OHX M;  2LXY A;  2Z0O A;  4JWC A;  2PMR A;  4IW0 A;  2GA9 D;  2WIN M;  1OAO A;  1GNT A;  5KBP A;  2F1B A;  2N3K A;  3EJP A;  3DX3 A;  2Z0N A;  4AZC A;  2YI9 A;  3B51 X;  2YIA A;  2OW7 A;  5E84 A;  4BNE A;  3D4Z A;  1R34 A;  2Z8Y A;  2MI7 A;  3T48 A;  3QNJ A;  2OBL A;  2Z0V A;  1YWM A;  2F7P A;  1GNL A;  2YLL A;  4H6H A;  3L3P A;  1HTY A;  4D8J A;  3L3O M;  4E3C A;  1OA1 A;  3FD9 A;  4AZ6 A;  2V0O A;  4AZG A;  3DDG A;  4WPC A;  4F00 A;  3ZED A;  3EJT A;  4AKV A;  2KHO A;  3T4A G;  4EZU A;  3O3N B;  3CZS A;  4R5J A;  4JNF A;  3BUQ A;  2JNK A;  1SU7 A;  3DPQ A;  3T46 A;  1QWN A;  3VEB A;  1URU A;  3D52 A;  2QKW A;  2YI8 A;  3BVU A;  1TQV A;  2ZXQ A;  3OWG A;  3Q84 A;  3BUI A;  4AZ5 A;  1DKY A;  3QE6 A;  2OO2 A;  3DPP A;  3LMF A;  1ZYL A;  4EZP A;  4JN4 A;  2D4C A;  3BUD A;  4EZR A;  1E2U A;  3DX4 A;  4IWP A;  3T47 A;  2WYI A;  2OW6 A;  1R5E A;  1PS3 A;  4FZO A;  1TQW A;  4JWD A;  3I39 X;  1QWU A;  4FZS A;  4H6I A;  3EJR A;  4AZ7 A;  4NSW A;  3RPM A;  3D4Y A;  2GF4 A;  3G9G A;  1MJG A;  5FLE X;  1QX1 A;  3I04 A;  4NQI A;  3CVR A;  3VKH A;  1O7D B;  4R5K A;  2FYV A;  3ER9 B;  3CAZ A;  1DKX A;  1TQS A;  4AZC B;  2F1A A;  1I4L A;  4G6Q A;  1SU6 A;  4IWO A;  4DYL A;  4JL9 A;  4B9Q A;  4JWE A;  2PY6 A;  2ALW A;  2QXL A;  2OBM A;  3ACO A;  3PLT A;  4PO2 A;  4IM2 A;  3DDF A;  3CV5 A;  4EZV A;  4HYB A;  3DYT A;  3D2E A;  1TQT A;  2LM0 A;  4EZT A;  2GAF D;  4FZP A;  4R5L A;  4AZB A;  3F7W A;  3B52 X;  1HXK A;  2X5C A;  2EFL A;  5FIG A;  4EZW A;  3DX0 A;  4IWQ A;  1SUF A;  4E81 A;  4AZH A;  2OZN B;  2X3X A;  2YIB A;  3ABH A;  3D51 A;  4AZI A;  3LLL A;  2EWF A;  3UIT A;  2X3W A;  2RT6 A;  4EZZ A;  4JNE A;  3EJQ A;  2RAK A;  2X3V A;  4F01 A;  4R5I A;  1LQ7 A;  5C5B A;  2QFF A;  5C5B B;  3SOG A;  4EZQ A;  1DKZ A;  4HY9 A;  4HR1 A;  3BVT A;  2FIC A;  4ATM A;  2YL8 A;  1R33 A;  1I49 A;  1E1D A;  2NCZ A;  3CKD A;  3RV1 A;  4M0M A;  1X03 A;  3B53 X;  3O3M B;  2ND1 A;  3OK8 A;  4IM3 A;  2RAI A;  2Q12 A;  2F7Q A;  3D2F A;  4EZY A;  3LVT A;  2YKT A;  3BVV A;  2F7O A;  3D50 A;  3I2W A;  4AVM A;  3QA8 A;  2ELB A;  1TQU A;  4IM0 A;  1W9M A;  3QWE A;  3C7N A;  4EZN A;  3GI7 A;  3KAW A;  1OA0 A;  4JLC A;  3BVX A;  2YLA A;  2F18 A;  2WYH A; 
#chains in the Genus database with same CATH homology
 4AVM A;  2ELB A;  3Q0K A;  4FZS A;  5C5B A;  2C08 A;  1WDZ A;  3ACO A;  1X04 A;  1X03 A;  1Y2O A;  2Z0N A;  3PLT A;  3CAZ A;  5C5B B;  3QNI A;  3OK8 A;  3SOG A;  4NSW A;  3HAJ A;  2D1L A;  2D4C A;  2RAJ A;  2X3X A;  3ABH A;  3HAI A;  3SYV A;  4WPE A;  4BNE A;  3LLL A;  3HAH A;  2RAI A;  1ZWW A;  3QWE A;  2EFL A;  1I4T A;  2EFK A;  2Q12 A;  2V0O A;  3DYT A;  2Z0O A;  3G9G A;  1I4L A;  4DCN C;  4I1Q A;  3QE6 A;  1URU A;  2X3W A;  3M3W A;  2FIC A;  4NQI A;  4ATM A;  4WPC A;  4DYL A;  3Q84 A;  1I49 A;  1I4D A;  2RAK A;  2Z0V A;  2X3V A;  4H8S A;  4AKV A;  2YKT A;  3I2W A;  2Q13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...