4I1QA

Crystal structure of hbrap1 n-bar domain
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
200
structure length
200
Chain Sequence
KDERFEQSANNFYQQQAEGHKLYKDLKNFLSAVKVMHESSKRVSETLQEIYSSEWDGHEELKAIVWNNDLLWEDYEEKLADQAVRTMEIYVAQFSEIKERIAKRGRKLVDYDSARHHLEAVQNAKKKDEAKTAKAEEEFNKAQTVFEDLNQELLEELPILYNSRIGCYVTIFQNISNLRDVFYREMSKLNHNLYEVMSKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bridging integrator 2
publication title Bin2 Is a Membrane Sculpting N-BAR Protein That Influences Leucocyte Podosomes, Motility and Phagocytosis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 89
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 4i1qA00
1X03A 2EFKA 4ATMA 4DCNC 2EFLA 1I49A 1I4DA 2X3XA 5C5BB 1WDZA 2C08A 3DYTA 3ACOA 4AVMA 2Q13A 3QWEA 2FICA 4WPCA 4DYLA 3QE6A 3LLLA 2Z0VA 3PLTA 2Q12A 4AKVA 1URUA 2YKTA 1I4LA 3M3WA 4H8SA 3HAJA 3HAHA 2D1LA 3SYVA 1X04A 4WPEA 3HAIA 3SOGA 2RAJA 1I4TA 3I2WA 3OK8A 4FZSA 4NSWA 4I1QA 2D4CA 5C5BA 2X3WA 3Q0KA 1ZWWA 2Z0OA 1Y2OA 2V0OA 3CAZA 2RAIA 3Q84A 2ELBA 2X3VA 3ABHA 3G9GA 3QNIA 4BNEA 2RAKA 4NQIA 2Z0NA
chains in the Genus database with same CATH superfamily
1LQ7A 2Q13A 4EZRA 3DX2A 3SOGA 2RAJA 4EZPA 2YI9A 4NSWA 3EJPA 2D4CA 3EJSA 2V0OA 4IM0A 4IM3A 4EZYA 2JNSA 3O3MB 3CVRA 4EZZA 2D1LA 4JLCA 1DKXA 3DDGA 4EZQA 1W9MA 2LXYA 3VKHA 2GF4A 1E1DA 2Q12A 4UDXX 3SYVA 3T49A 4JN4A 4I1QA 2GAFD 4AZHA 1HXKA 3CZSA 2N3KA 2F7QA 2FICA 1GNLA 4JWDA 2OO2A 5E84A 2OBMA 2YLLA 5C5BA 4B9QA 1R33A 4BNEA 4EZWA 4R5KA 4R5LA 3BUDA 2ALWA 2WYIA 3EJRA 3KDRA 3UITA 3BUBA 3HAIA 3Q0KA 2YIVX 3LMFA 2X5CA 4UDYX 3CKDA 5KBPA 2Z8YA 4IWPA 3CV5A 4IWQA 1OAOA 3OWGA 2RT6A 4FZOA 1GNTA 3I2WA 4EZXA 1OA1A 3Q84A 4EZNA 1TQTA 3BVWA 2O0I1 2NCZA 5C5BB 4G6QA 3VEAA 1DKYA 2QKWA 4AVMA 4DYLA 2WINM 4R5IA 3C7NA 2YLAA 5FLEX 3D51A 2F1BA 2ZXQA 2EWFA 3ABHA 3FD9A 3ER9B 4ATMA 2YIAA 4AZIA 2YL9A 4AZ6A 3RV0A 4F00A 4KIKA 2KHOA 3F7WA 4HR1A 4E3CA 1PS3A 4AZCA 2F7RA 1I4TA 1R34A 4FZSA 2OZNB 4JNEA 2EFKA 3DPQA 2EFLA 3LVTA 3I04A 1SU8A 3D4YA 1U00A 4F01A 4AZ5A 2EX3B 2F1AA 3BVTA 1TQWA 3T4AG 3RV1A 3DX3A 3RPMA 4NQIA 4EZOA 2F18A 2Z0NA 3QNJA 3OHXM 1GN9A 2X3XA 3D2FA 3DX1A 3QWEA 4M0MA 4FZPA 4JWEA 1R5EA 3D4ZA 3BUQA 3BVVA 3QA8A 2OW7A 1JQKA 1DKZA 3QNIA 2ND1A 4AZCB 3I01A 4AZGA 3DDFA 3DX4A 3QE6A 3BVXA 3PLTA 1URUA 1ZYLA 3B51X 2QFFA 3HAHA 2WYHA 1QX1A 2GA9D 3VEBA 3O3OB 2RAIA 1HWWA 1OA0A 2PMRA 1I49A 3D52A 4IW0A 1E2UA 3BLBA 3DPPA 3DYTA 3B52X 4AZBA 3ERCC 3LLLA 4NPHA 3OK8A 4R5GA 3I39X 2PY6A 3L3OM 1SU6A 4JL9A 4EZSA 3T48A 4JNFA 4DCNC 1I4DA 3ACOA 5TKYA 4WPCA 3ZEDA 1X04A 4E81A 5FIGA 3EJTA 3D50A 2X3WA 4D8JA 2Z0OA 4H6HA 1Y2OA 3T46A 3BUIA 2JNKA 2QXLA 4JWIA 2RAKA 3L3PA 4FM3A 4JWCA 1SUFA 4IWOA 2Z0VA 1I4LA 4H6IA 4H8SA 4EZUA 4R5JA 1O7DC 3DPOA 2YI8A 1UPXA 3EJQA 2X3VA 3G9GA 1YWMA 3T47A 1X03A 3A98A 2FYVA 4IM2A 2F7PA 2YL8A 2YL5A 2YIBA 1HTYA 3BVUA 2YL6A 2LM0A 2MI7A 4AZ7A 4KIKB 3EJUA 2ND0A 2ELBA 4HR1B 3CZNA 4PO2A 2OBLA 1WDZA 2C08A 1QWNA 3KAWA 1TQSA 3ER8C 1SU7A 3B53X 2F7OA 4AKVA 1O7DB 2YKTA 3M3WA 3HAJA 1TQUA 2OW6A 4HYBA 3KAVA 4EZVA 4WPEA 4HY9A 4EZTA 1MJGA 1QWUA 1TQVA 1E9VA 1ZWWA 3CAZA 3O3NB 3DX0A 3D2EA 3GI7A 3BUPA
chains in the Genus database with same CATH topology
1X03A 2EFKA 4ATMA 4DCNC 2EFLA 1I49A 1I4DA 2X3XA 5C5BB 1WDZA 2C08A 3DYTA 3ACOA 4AVMA 2Q13A 3QWEA 2FICA 4WPCA 4DYLA 3QE6A 3LLLA 2Z0VA 3PLTA 2Q12A 4AKVA 1URUA 2YKTA 1I4LA 3M3WA 4H8SA 3HAJA 3HAHA 2D1LA 3SYVA 1X04A 4WPEA 3HAIA 3SOGA 2RAJA 1I4TA 3I2WA 3OK8A 4FZSA 4NSWA 4I1QA 2D4CA 5C5BA 2X3WA 3Q0KA 1ZWWA 2Z0OA 1Y2OA 2V0OA 3CAZA 2RAIA 3Q84A 2ELBA 2X3VA 3ABHA 3G9GA 3QNIA 4BNEA 2RAKA 4NQIA 2Z0NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X03 A;  2EFK A;  4ATM A;  4DCN C;  2EFL A;  1I49 A;  1I4D A;  2X3X A;  5C5B B;  1WDZ A;  2C08 A;  3DYT A;  3ACO A;  4AVM A;  2Q13 A;  3QWE A;  2FIC A;  4WPC A;  4DYL A;  3QE6 A;  3LLL A;  2Z0V A;  3PLT A;  2Q12 A;  4AKV A;  1URU A;  2YKT A;  1I4L A;  3M3W A;  4H8S A;  3HAJ A;  3HAH A;  2D1L A;  3SYV A;  1X04 A;  4WPE A;  3HAI A;  3SOG A;  2RAJ A;  1I4T A;  3I2W A;  3OK8 A;  4FZS A;  4NSW A;  4I1Q A;  2D4C A;  5C5B A;  2X3W A;  3Q0K A;  1ZWW A;  2Z0O A;  1Y2O A;  2V0O A;  3CAZ A;  2RAI A;  3Q84 A;  2ELB A;  2X3V A;  3ABH A;  3G9G A;  3QNI A;  4BNE A;  2RAK A;  4NQI A;  2Z0N A; 
#chains in the Genus database with same CATH topology
 1LQ7 A;  2Q13 A;  4EZR A;  3DX2 A;  3SOG A;  2RAJ A;  4EZP A;  2YI9 A;  4NSW A;  3EJP A;  2D4C A;  3EJS A;  2V0O A;  4IM0 A;  4IM3 A;  4EZY A;  2JNS A;  3O3M B;  3CVR A;  4EZZ A;  2D1L A;  4JLC A;  1DKX A;  3DDG A;  4EZQ A;  1W9M A;  2LXY A;  3VKH A;  2GF4 A;  1E1D A;  2Q12 A;  4UDX X;  3SYV A;  3T49 A;  4JN4 A;  4I1Q A;  2GAF D;  4AZH A;  1HXK A;  3CZS A;  2N3K A;  2F7Q A;  2FIC A;  1GNL A;  4JWD A;  2OO2 A;  5E84 A;  2OBM A;  2YLL A;  5C5B A;  4B9Q A;  1R33 A;  4BNE A;  4EZW A;  4R5K A;  4R5L A;  3BUD A;  2ALW A;  2WYI A;  3EJR A;  3KDR A;  3UIT A;  3BUB A;  3HAI A;  3Q0K A;  2YIV X;  3LMF A;  2X5C A;  4UDY X;  3CKD A;  5KBP A;  2Z8Y A;  4IWP A;  3CV5 A;  4IWQ A;  1OAO A;  3OWG A;  2RT6 A;  4FZO A;  1GNT A;  3I2W A;  4EZX A;  1OA1 A;  3Q84 A;  4EZN A;  1TQT A;  3BVW A;  2O0I 1;  2NCZ A;  5C5B B;  4G6Q A;  3VEA A;  1DKY A;  2QKW A;  4AVM A;  4DYL A;  2WIN M;  4R5I A;  3C7N A;  2YLA A;  5FLE X;  3D51 A;  2F1B A;  2ZXQ A;  2EWF A;  3ABH A;  3FD9 A;  3ER9 B;  4ATM A;  2YIA A;  4AZI A;  2YL9 A;  4AZ6 A;  3RV0 A;  4F00 A;  4KIK A;  2KHO A;  3F7W A;  4HR1 A;  4E3C A;  1PS3 A;  4AZC A;  2F7R A;  1I4T A;  1R34 A;  4FZS A;  2OZN B;  4JNE A;  2EFK A;  3DPQ A;  2EFL A;  3LVT A;  3I04 A;  1SU8 A;  3D4Y A;  1U00 A;  4F01 A;  4AZ5 A;  2EX3 B;  2F1A A;  3BVT A;  1TQW A;  3T4A G;  3RV1 A;  3DX3 A;  3RPM A;  4NQI A;  4EZO A;  2F18 A;  2Z0N A;  3QNJ A;  3OHX M;  1GN9 A;  2X3X A;  3D2F A;  3DX1 A;  3QWE A;  4M0M A;  4FZP A;  4JWE A;  1R5E A;  3D4Z A;  3BUQ A;  3BVV A;  3QA8 A;  2OW7 A;  1JQK A;  1DKZ A;  3QNI A;  2ND1 A;  4AZC B;  3I01 A;  4AZG A;  3DDF A;  3DX4 A;  3QE6 A;  3BVX A;  3PLT A;  1URU A;  1ZYL A;  3B51 X;  2QFF A;  3HAH A;  2WYH A;  1QX1 A;  2GA9 D;  3VEB A;  3O3O B;  2RAI A;  1HWW A;  1OA0 A;  2PMR A;  1I49 A;  3D52 A;  4IW0 A;  1E2U A;  3BLB A;  3DPP A;  3DYT A;  3B52 X;  4AZB A;  3ERC C;  3LLL A;  4NPH A;  3OK8 A;  4R5G A;  3I39 X;  2PY6 A;  3L3O M;  1SU6 A;  4JL9 A;  4EZS A;  3T48 A;  4JNF A;  4DCN C;  1I4D A;  3ACO A;  5TKY A;  4WPC A;  3ZED A;  1X04 A;  4E81 A;  5FIG A;  3EJT A;  3D50 A;  2X3W A;  4D8J A;  2Z0O A;  4H6H A;  1Y2O A;  3T46 A;  3BUI A;  2JNK A;  2QXL A;  4JWI A;  2RAK A;  3L3P A;  4FM3 A;  4JWC A;  1SUF A;  4IWO A;  2Z0V A;  1I4L A;  4H6I A;  4H8S A;  4EZU A;  4R5J A;  1O7D C;  3DPO A;  2YI8 A;  1UPX A;  3EJQ A;  2X3V A;  3G9G A;  1YWM A;  3T47 A;  1X03 A;  3A98 A;  2FYV A;  4IM2 A;  2F7P A;  2YL8 A;  2YL5 A;  2YIB A;  1HTY A;  3BVU A;  2YL6 A;  2LM0 A;  2MI7 A;  4AZ7 A;  4KIK B;  3EJU A;  2ND0 A;  2ELB A;  4HR1 B;  3CZN A;  4PO2 A;  2OBL A;  1WDZ A;  2C08 A;  1QWN A;  3KAW A;  1TQS A;  3ER8 C;  1SU7 A;  3B53 X;  2F7O A;  4AKV A;  1O7D B;  2YKT A;  3M3W A;  3HAJ A;  1TQU A;  2OW6 A;  4HYB A;  3KAV A;  4EZV A;  4WPE A;  4HY9 A;  4EZT A;  1MJG A;  1QWU A;  1TQV A;  1E9V A;  1ZWW A;  3CAZ A;  3O3N B;  3DX0 A;  3D2E A;  3GI7 A;  3BUP A; 
#chains in the Genus database with same CATH homology
 1X03 A;  2EFK A;  4ATM A;  4DCN C;  2EFL A;  1I49 A;  1I4D A;  2X3X A;  5C5B B;  1WDZ A;  2C08 A;  3DYT A;  3ACO A;  4AVM A;  2Q13 A;  3QWE A;  2FIC A;  4WPC A;  4DYL A;  3QE6 A;  3LLL A;  2Z0V A;  3PLT A;  2Q12 A;  4AKV A;  1URU A;  2YKT A;  1I4L A;  3M3W A;  4H8S A;  3HAJ A;  3HAH A;  2D1L A;  3SYV A;  1X04 A;  4WPE A;  3HAI A;  3SOG A;  2RAJ A;  1I4T A;  3I2W A;  3OK8 A;  4FZS A;  4NSW A;  4I1Q A;  2D4C A;  5C5B A;  2X3W A;  3Q0K A;  1ZWW A;  2Z0O A;  1Y2O A;  2V0O A;  3CAZ A;  2RAI A;  3Q84 A;  2ELB A;  2X3V A;  3ABH A;  3G9G A;  3QNI A;  4BNE A;  2RAK A;  4NQI A;  2Z0N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...