2JNSA

Solution structure of the bromodomain-containing protein 4 et domain
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
90
structure length
90
Chain Sequence
GSSGSSGESEEEDKCKPMSYEEKRQLSLDINKLPGEKLGRVVHIIQSREPSLKNSNPDEIEIDFETLKPSTLRELERYVTSCLRKKRKPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bromodomain-containing protein 4
publication title Solution structure of the Bromodomain-containing protein 4 ET domain
rcsb
source organism Mus musculus
molecule tags Unknown function
total genus 20
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2007-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17035 BET Bromodomain extra-terminal - transcription regulation
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.220 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 2jnsA01
2NCZA 2ND0A 2N3KA 2ND1A 2JNSA
chains in the Genus database with same CATH superfamily
3BVTA 4I1QA 1DKYA 5C5BB 1JQKA 2YIBA 2X5CA 4DCNC 3DX3A 3B52X 4EZZA 1I49A 1MJGA 1HWWA 2WYIA 3FD9A 4JN4A 4FZOA 4JL9A 3BUPA 3O3MB 4AZ5A 4M0MA 2OZNB 1SU6A 3DX4A 2OW7A 3T48A 3CZSA 1W9MA 3ZEDA 4JWCA 4HR1A 4IWQA 1Y2OA 2ALWA 2C08A 2GAFD 2RAJA 3D51A 2LXYA 4F01A 2PY6A 4R5IA 2LM0A 3I04A 3PLTA 3BUQA 3EJUA 3DX0A 2FYVA 3Q0KA 3DPOA 2X3VA 1WDZA 4WPEA 3EJRA 4EZWA 2NCZA 4G6QA 4EZSA 4EZRA 4PO2A 2KHOA 4NPHA 2YL9A 1I4TA 2YLAA 3L3OM 4F00A 3LVTA 1TQVA 1DKXA 3DPPA 2EFLA 2RAIA 3F7WA 4NQIA 4AZBA 4D8JA 1DKZA 3CZNA 1O7DC 2Q13A 4IWPA 2EWFA 3RPMA 1SUFA 3B51X 1X03A 3SYVA 2JNKA 1GNLA 4HYBA 3QNJA 4IW0A 4R5GA 3CKDA 4AZCB 3LMFA 4R5KA 2V0OA 1E9VA 4IM0A 1R34A 2ELBA 1R33A 1LQ7A 4JWIA 3VKHA 2YI8A 4EZPA 2RT6A 2OW6A 3L3PA 3UITA 2D4CA 4H8SA 2F7PA 2F7RA 4JWDA 2MI7A 1HTYA 3RV1A 3EJTA 4BNEA 3I39X 2D1LA 2QKWA 4JWEA 4AKVA 3GI7A 4KIKA 3T4AG 2N3KA 3DDFA 1U00A 4AVMA 4DYLA 3BVVA 3D50A 4NSWA 2GA9D 3BUIA 4H6IA 2WINM 4HR1B 4UDXX 1HXKA 2PMRA 4IM2A 2GF4A 5TKYA 2YIVX 4IM3A 2YIAA 5E84A 3VEAA 3A98A 2OO2A 3I2WA 2Q12A 3KDRA 4EZTA 4HY9A 4UDYX 1YWMA 2FICA 4JNFA 3T47A 2JNSA 2F18A 1SU8A 4EZOA 2WYHA 1SU7A 2X3WA 1O7DB 2YI9A 4EZUA 3CV5A 3BVWA 4AZHA 3T49A 3Q84A 3QA8A 3D2FA 4B9QA 2ZXQA 4EZVA 3T46A 3VEBA 2F1BA 2F7OA 4FM3A 4EZYA 1E2UA 3D4YA 3EJQA 4EZQA 5C5BA 3KAVA 4AZIA 3HAIA 1TQTA 2F7QA 1I4LA 2EFKA 3DX1A 2QFFA 3EJPA 1GNTA 3QWEA 4EZXA 2Z0VA 2YKTA 2OBMA 5FIGA 3BUDA 4E81A 1QX1A 3DPQA 3SOGA 3B53X 3O3OB 1TQUA 3OWGA 2YL5A 3HAJA 4JNEA 3HAHA 1QWUA 4AZ7A 1TQSA 3DYTA 3EJSA 3BLBA 4FZPA 4JLCA 2YLLA 1E1DA 1QWNA 3BUBA 3CVRA 2Z0NA 3OK8A 3ERCC 3OHXM 1OAOA 3ABHA 3D4ZA 4AZ6A 3KAWA 2X3XA 4KIKB 2ND1A 4E3CA 3D52A 1X04A 4H6HA 1GN9A 2Z8YA 3ACOA 2OBLA 3BVXA 4R5JA 1ZWWA 3LLLA 1OA1A 4WPCA 1UPXA 3O3NB 2F1AA 4EZNA 2ND0A 1I4DA 3D2EA 4FZSA 2QXLA 3M3WA 2RAKA 2EX3B 2Z0OA 1R5EA 3DDGA 1OA0A 3QE6A 3RV0A 4IWOA 4R5LA 3CAZA 2YL6A 4AZCA 3ER8C 3G9GA 4ATMA 3DX2A 4AZGA 1TQWA 3QNIA 1PS3A 5KBPA 3BVUA 5FLEX 2O0I1 3I01A 1ZYLA 2YL8A 1URUA 3C7NA 3ER9B
chains in the Genus database with same CATH topology
4JLCA 1E1DA 1DKYA 1JQKA 2YIBA 2X5CA 3KDRA 4EZTA 4HY9A 4UDYX 4D8JA 1DKZA 3B52X 4EZZA 1MJGA 4JNFA 4IWPA 3T47A 2JNSA 2EWFA 3FD9A 3ERCC 4JN4A 3OHXM 1SUFA 4JL9A 1OAOA 3B51X 1SU8A 3O3MB 1GNLA 3KAWA 4HYBA 4EZOA 4M0MA 3QNJA 1SU6A 4KIKB 1SU7A 2ND1A 4IW0A 4R5GA 4E3CA 2YI9A 4EZUA 3LMFA 4H6HA 3T48A 1GN9A 1W9MA 2Z8YA 4R5KA 3ZEDA 4JWCA 4HR1A 3T49A 4IWQA 1E9VA 2OBLA 4IM0A 4R5JA 3QA8A 3D2FA 4B9QA 4EZVA 4JWIA 3VKHA 3T46A 1OA1A 2GAFD 2YI8A 1UPXA 3O3NB 4EZPA 3VEBA 4FM3A 2RT6A 4EZYA 4EZNA 1E2UA 4EZQA 2ND0A 4F01A 3KAVA 3UITA 2PY6A 4R5IA 2LM0A 3D2EA 3I04A 2QXLA 2EX3B 4JWDA 3RV1A 3DPOA 3I39X 4JWEA 1OA0A 3GI7A 4KIKA 1GNTA 4IWOA 4R5LA 3RV0A 3T4AG 4EZXA 3ER8C 2N3KA 4EZWA 1U00A 2NCZA 4G6QA 2OBMA 5FIGA 4E81A 4EZSA 2GA9D 4EZRA 3DPQA 4PO2A 4H6IA 3B53X 2KHOA 3O3OB 4NPHA 2WINM 4HR1B 4UDXX 3OWGA 4IM2A 4JNEA 5FLEX 5TKYA 3L3OM 3ER9B 2YIVX 4IM3A 4F00A 3I01A 1ZYLA 2YIAA 5E84A 1DKXA 3VEAA 3DPPA 3C7NA 2QFFA 3A98A 3F7WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NCZ A;  2ND0 A;  2N3K A;  2ND1 A;  2JNS A; 
#chains in the Genus database with same CATH topology
 3BVT A;  4I1Q A;  1DKY A;  5C5B B;  1JQK A;  2YIB A;  2X5C A;  4DCN C;  3DX3 A;  3B52 X;  4EZZ A;  1I49 A;  1MJG A;  1HWW A;  2WYI A;  3FD9 A;  4JN4 A;  4FZO A;  4JL9 A;  3BUP A;  3O3M B;  4AZ5 A;  4M0M A;  2OZN B;  1SU6 A;  3DX4 A;  2OW7 A;  3T48 A;  3CZS A;  1W9M A;  3ZED A;  4JWC A;  4HR1 A;  4IWQ A;  1Y2O A;  2ALW A;  2C08 A;  2GAF D;  2RAJ A;  3D51 A;  2LXY A;  4F01 A;  2PY6 A;  4R5I A;  2LM0 A;  3I04 A;  3PLT A;  3BUQ A;  3EJU A;  3DX0 A;  2FYV A;  3Q0K A;  3DPO A;  2X3V A;  1WDZ A;  4WPE A;  3EJR A;  4EZW A;  2NCZ A;  4G6Q A;  4EZS A;  4EZR A;  4PO2 A;  2KHO A;  4NPH A;  2YL9 A;  1I4T A;  2YLA A;  3L3O M;  4F00 A;  3LVT A;  1TQV A;  1DKX A;  3DPP A;  2EFL A;  2RAI A;  3F7W A;  4NQI A;  4AZB A;  4D8J A;  1DKZ A;  3CZN A;  1O7D C;  2Q13 A;  4IWP A;  2EWF A;  3RPM A;  1SUF A;  3B51 X;  1X03 A;  3SYV A;  2JNK A;  1GNL A;  4HYB A;  3QNJ A;  4IW0 A;  4R5G A;  3CKD A;  4AZC B;  3LMF A;  4R5K A;  2V0O A;  1E9V A;  4IM0 A;  1R34 A;  2ELB A;  1R33 A;  1LQ7 A;  4JWI A;  3VKH A;  2YI8 A;  4EZP A;  2RT6 A;  2OW6 A;  3L3P A;  3UIT A;  2D4C A;  4H8S A;  2F7P A;  2F7R A;  4JWD A;  2MI7 A;  1HTY A;  3RV1 A;  3EJT A;  4BNE A;  3I39 X;  2D1L A;  2QKW A;  4JWE A;  4AKV A;  3GI7 A;  4KIK A;  3T4A G;  2N3K A;  3DDF A;  1U00 A;  4AVM A;  4DYL A;  3BVV A;  3D50 A;  4NSW A;  2GA9 D;  3BUI A;  4H6I A;  2WIN M;  4HR1 B;  4UDX X;  1HXK A;  2PMR A;  4IM2 A;  2GF4 A;  5TKY A;  2YIV X;  4IM3 A;  2YIA A;  5E84 A;  3VEA A;  3A98 A;  2OO2 A;  3I2W A;  2Q12 A;  3KDR A;  4EZT A;  4HY9 A;  4UDY X;  1YWM A;  2FIC A;  4JNF A;  3T47 A;  2JNS A;  2F18 A;  1SU8 A;  4EZO A;  2WYH A;  1SU7 A;  2X3W A;  1O7D B;  2YI9 A;  4EZU A;  3CV5 A;  3BVW A;  4AZH A;  3T49 A;  3Q84 A;  3QA8 A;  3D2F A;  4B9Q A;  2ZXQ A;  4EZV A;  3T46 A;  3VEB A;  2F1B A;  2F7O A;  4FM3 A;  4EZY A;  1E2U A;  3D4Y A;  3EJQ A;  4EZQ A;  5C5B A;  3KAV A;  4AZI A;  3HAI A;  1TQT A;  2F7Q A;  1I4L A;  2EFK A;  3DX1 A;  2QFF A;  3EJP A;  1GNT A;  3QWE A;  4EZX A;  2Z0V A;  2YKT A;  2OBM A;  5FIG A;  3BUD A;  4E81 A;  1QX1 A;  3DPQ A;  3SOG A;  3B53 X;  3O3O B;  1TQU A;  3OWG A;  2YL5 A;  3HAJ A;  4JNE A;  3HAH A;  1QWU A;  4AZ7 A;  1TQS A;  3DYT A;  3EJS A;  3BLB A;  4FZP A;  4JLC A;  2YLL A;  1E1D A;  1QWN A;  3BUB A;  3CVR A;  2Z0N A;  3OK8 A;  3ERC C;  3OHX M;  1OAO A;  3ABH A;  3D4Z A;  4AZ6 A;  3KAW A;  2X3X A;  4KIK B;  2ND1 A;  4E3C A;  3D52 A;  1X04 A;  4H6H A;  1GN9 A;  2Z8Y A;  3ACO A;  2OBL A;  3BVX A;  4R5J A;  1ZWW A;  3LLL A;  1OA1 A;  4WPC A;  1UPX A;  3O3N B;  2F1A A;  4EZN A;  2ND0 A;  1I4D A;  3D2E A;  4FZS A;  2QXL A;  3M3W A;  2RAK A;  2EX3 B;  2Z0O A;  1R5E A;  3DDG A;  1OA0 A;  3QE6 A;  3RV0 A;  4IWO A;  4R5L A;  3CAZ A;  2YL6 A;  4AZC A;  3ER8 C;  3G9G A;  4ATM A;  3DX2 A;  4AZG A;  1TQW A;  3QNI A;  1PS3 A;  5KBP A;  3BVU A;  5FLE X;  2O0I 1;  3I01 A;  1ZYL A;  2YL8 A;  1URU A;  3C7N A;  3ER9 B; 
#chains in the Genus database with same CATH homology
 4JLC A;  1E1D A;  1DKY A;  1JQK A;  2YIB A;  2X5C A;  3KDR A;  4EZT A;  4HY9 A;  4UDY X;  4D8J A;  1DKZ A;  3B52 X;  4EZZ A;  1MJG A;  4JNF A;  4IWP A;  3T47 A;  2JNS A;  2EWF A;  3FD9 A;  3ERC C;  4JN4 A;  3OHX M;  1SUF A;  4JL9 A;  1OAO A;  3B51 X;  1SU8 A;  3O3M B;  1GNL A;  3KAW A;  4HYB A;  4EZO A;  4M0M A;  3QNJ A;  1SU6 A;  4KIK B;  1SU7 A;  2ND1 A;  4IW0 A;  4R5G A;  4E3C A;  2YI9 A;  4EZU A;  3LMF A;  4H6H A;  3T48 A;  1GN9 A;  1W9M A;  2Z8Y A;  4R5K A;  3ZED A;  4JWC A;  4HR1 A;  3T49 A;  4IWQ A;  1E9V A;  2OBL A;  4IM0 A;  4R5J A;  3QA8 A;  3D2F A;  4B9Q A;  4EZV A;  4JWI A;  3VKH A;  3T46 A;  1OA1 A;  2GAF D;  2YI8 A;  1UPX A;  3O3N B;  4EZP A;  3VEB A;  4FM3 A;  2RT6 A;  4EZY A;  4EZN A;  1E2U A;  4EZQ A;  2ND0 A;  4F01 A;  3KAV A;  3UIT A;  2PY6 A;  4R5I A;  2LM0 A;  3D2E A;  3I04 A;  2QXL A;  2EX3 B;  4JWD A;  3RV1 A;  3DPO A;  3I39 X;  4JWE A;  1OA0 A;  3GI7 A;  4KIK A;  1GNT A;  4IWO A;  4R5L A;  3RV0 A;  3T4A G;  4EZX A;  3ER8 C;  2N3K A;  4EZW A;  1U00 A;  2NCZ A;  4G6Q A;  2OBM A;  5FIG A;  4E81 A;  4EZS A;  2GA9 D;  4EZR A;  3DPQ A;  4PO2 A;  4H6I A;  3B53 X;  2KHO A;  3O3O B;  4NPH A;  2WIN M;  4HR1 B;  4UDX X;  3OWG A;  4IM2 A;  4JNE A;  5FLE X;  5TKY A;  3L3O M;  3ER9 B;  2YIV X;  4IM3 A;  4F00 A;  3I01 A;  1ZYL A;  2YIA A;  5E84 A;  1DKX A;  3VEA A;  3DPP A;  3C7N A;  2QFF A;  3A98 A;  3F7W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...