1URUA

Amphiphysin bar domain from drosophila
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
217
structure length
217
Chain Sequence
QNLGKVDRTADEIFDDHLNNFNRQQASANRLQKEFNNYIRCVRAAQAASKTLMDSVCEIYEPQWSGYDALQAQTGASESLWADFAHKLGDQVLIPLNTYTGQFPEMKKKVEKRNRKLIDYDGQRHSFQNLQANANKRKDDVKLTKGREQLEEARRTYEILNTELHDELPALYDSRILFLVTNLQTLFATEQVFHNETAKIYSELEAIVDKLATESQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis
molecule keywords AMPHIPHYSIN
publication title Bar Domains as Sensors of Membrane Curvature: The Amphiphysin Bar Structure
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 92
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2003-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03114 BAR BAR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 1uruA01
2Z0OA 3HAJA 2YKTA 3SYVA 5C5BB 4I1QA 3ACOA 4NQIA 3SOGA 4DYLA 4DCNC 2V0OA 2D1LA 3QE6A 2RAJA 4H8SA 2EFKA 1X03A 4ATMA 3HAIA 1I4DA 1ZWWA 2Q12A 3PLTA 2X3VA 2RAKA 4AKVA 2EFLA 2ELBA 4NSWA 1I4LA 2X3XA 3QNIA 3Q84A 1URUA 3HAHA 3Q0KA 1WDZA 2C08A 4WPCA 1Y2OA 3I2WA 5C5BA 3ABHA 2Z0VA 3LLLA 4AVMA 3G9GA 4WPEA 4FZSA 1I49A 2Z0NA 2D4CA 4BNEA 1X04A 2FICA 3M3WA 2Q13A 3CAZA 3DYTA 1I4TA 2X3WA 3OK8A 3QWEA 2RAIA
chains in the Genus database with same CATH superfamily
3SOGA 4DCNC 3RV0A 2Z8YA 2OBMA 1TQVA 4R5GA 2EFLA 1QX1A 1Y2OA 4EZQA 1LQ7A 4IWPA 3O3MB 1X04A 2F7OA 3CAZA 4HY9A 3LMFA 3BUDA 4IWQA 3EJUA 1URUA 3CV5A 2C08A 2GA9D 3T46A 2ND0A 3OK8A 3EJRA 3EJSA 4M0MA 3EJPA 1TQSA 3DDFA 4AZ5A 3DX1A 2X3XA 1DKZA 4JNFA 3BUIA 1ZYLA 2GAFD 3DPOA 4KIKA 4BNEA 4JWDA 4AZ7A 2ZXQA 1DKYA 4AKVA 3DX3A 4AZCA 1W9MA 3ACOA 2F18A 3QE6A 3GI7A 3O3OB 3BVVA 2YI9A 2F1AA 4R5LA 2RT6A 3D2EA 2FYVA 4IM2A 4AZCB 3ABHA 4H6IA 3LLLA 4AVMA 4H6HA 2NCZA 3L3PA 2F7RA 3HAJA 4IWOA 1OAOA 2O0I1 4I1QA 1DKXA 4H8SA 1ZWWA 2ELBA 4NSWA 2LM0A 4JN4A 4R5IA 3QA8A 2Z0VA 3RPMA 1OA0A 4FZSA 3I39X 1TQTA 4IW0A 2D4CA 2WINM 4PO2A 4D8JA 2YKTA 4DYLA 3VEAA 3BVTA 1SU6A 3BVXA 1I4DA 2YLAA 3T48A 2YLLA 3HAHA 4AZ6A 3OHXM 4B9QA 4F00A 4R5KA 3ER8C 1GN9A 4EZOA 3RV1A 3DX4A 2F1BA 2OZNB 3FD9A 2X3WA 4G6QA 4UDXX 4FZPA 2PMRA 2X3VA 3D50A 2ND1A 3EJTA 1WDZA 2QFFA 3I01A 4EZSA 4JL9A 2RAIA 3KAWA 1TQWA 4AZGA 4EZVA 4IM0A 1X03A 4ATMA 3CZSA 1QWNA 2MI7A 4JLCA 4EZZA 2YL8A 1SU7A 4IM3A 1I49A 2OBLA 2Z0NA 2QXLA 3M3WA 2Q13A 3BUBA 5FIGA 3D4ZA 1U00A 5FLEX 2EWFA 3LVTA 4EZUA 2YIAA 4AZBA 2LXYA 1GNTA 1R34A 2RAKA 2X5CA 2OW6A 3Q84A 3I04A 1YWMA 4JNEA 3I2WA 3D2FA 3D52A 3DPPA 4AZHA 1GNLA 4AZIA 1I4TA 2F7QA 5TKYA 3D4YA 3VKHA 5KBPA 4JWCA 3BLBA 4E3CA 3Q0KA 3L3OM 3QNJA 1SUFA 4HYBA 1UPXA 4R5JA 4NPHA 4FZOA 2GF4A 4EZXA 2WYIA 2Q12A 2YL5A 3B53X 3C7NA 2YIVX 4F01A 4WPCA 2PY6A 3B52X 5C5BA 2JNSA 3CKDA 4EZRA 4WPEA 3T47A 3ZEDA 1PS3A 1HXKA 1QWUA 3A98A 3SYVA 5C5BB 1O7DC 2V0OA 2RAJA 3F7WA 2YL9A 4JWEA 4UDYX 3G9GA 1OA1A 1HWWA 3DYTA 4EZTA 1R33A 2Z0OA 2YIBA 3CZNA 3CVRA 2QKWA 1I4LA 3T4AG 3KDRA 1SU8A 3BUQA 3BVUA 1TQUA 2F7PA 2FICA 2EX3B 3ER9B 2OO2A 2N3KA 1MJGA 3BUPA 3HAIA 3D51A 4JWIA 1E2UA 3OWGA 4EZPA 4EZYA 3QWEA 4HR1A 4FM3A 2D1LA 4EZNA 4KIKB 1E9VA 2EFKA 3DX0A 5E84A 3PLTA 2OW7A 4EZWA 1E1DA 1JQKA 3QNIA 3KAVA 1HTYA 4HR1B 3VEBA 1R5EA 1O7DB 3B51X 3ERCC 3DDGA 2YI8A 4NQIA 2ALWA 3O3NB 2YL6A 4E81A 3BVWA 3DX2A 2JNKA 3T49A 2KHOA 3UITA 3DPQA 3EJQA 2WYHA
chains in the Genus database with same CATH topology
2Z0OA 3HAJA 2YKTA 3SYVA 5C5BB 4I1QA 3ACOA 4NQIA 3SOGA 4DYLA 4DCNC 2V0OA 2D1LA 3QE6A 2RAJA 4H8SA 2EFKA 1X03A 4ATMA 3HAIA 1I4DA 1ZWWA 2Q12A 3PLTA 2X3VA 2RAKA 4AKVA 2EFLA 2ELBA 4NSWA 1I4LA 2X3XA 3QNIA 3Q84A 1URUA 3HAHA 3Q0KA 1WDZA 2C08A 4WPCA 1Y2OA 3I2WA 5C5BA 3ABHA 2Z0VA 3LLLA 4AVMA 3G9GA 4WPEA 4FZSA 1I49A 2Z0NA 2D4CA 4BNEA 1X04A 2FICA 3M3WA 2Q13A 3CAZA 3DYTA 1I4TA 2X3WA 3OK8A 3QWEA 2RAIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z0O A;  3HAJ A;  2YKT A;  3SYV A;  5C5B B;  4I1Q A;  3ACO A;  4NQI A;  3SOG A;  4DYL A;  4DCN C;  2V0O A;  2D1L A;  3QE6 A;  2RAJ A;  4H8S A;  2EFK A;  1X03 A;  4ATM A;  3HAI A;  1I4D A;  1ZWW A;  2Q12 A;  3PLT A;  2X3V A;  2RAK A;  4AKV A;  2EFL A;  2ELB A;  4NSW A;  1I4L A;  2X3X A;  3QNI A;  3Q84 A;  1URU A;  3HAH A;  3Q0K A;  1WDZ A;  2C08 A;  4WPC A;  1Y2O A;  3I2W A;  5C5B A;  3ABH A;  2Z0V A;  3LLL A;  4AVM A;  3G9G A;  4WPE A;  4FZS A;  1I49 A;  2Z0N A;  2D4C A;  4BNE A;  1X04 A;  2FIC A;  3M3W A;  2Q13 A;  3CAZ A;  3DYT A;  1I4T A;  2X3W A;  3OK8 A;  3QWE A;  2RAI A; 
#chains in the Genus database with same CATH topology
 3SOG A;  4DCN C;  3RV0 A;  2Z8Y A;  2OBM A;  1TQV A;  4R5G A;  2EFL A;  1QX1 A;  1Y2O A;  4EZQ A;  1LQ7 A;  4IWP A;  3O3M B;  1X04 A;  2F7O A;  3CAZ A;  4HY9 A;  3LMF A;  3BUD A;  4IWQ A;  3EJU A;  1URU A;  3CV5 A;  2C08 A;  2GA9 D;  3T46 A;  2ND0 A;  3OK8 A;  3EJR A;  3EJS A;  4M0M A;  3EJP A;  1TQS A;  3DDF A;  4AZ5 A;  3DX1 A;  2X3X A;  1DKZ A;  4JNF A;  3BUI A;  1ZYL A;  2GAF D;  3DPO A;  4KIK A;  4BNE A;  4JWD A;  4AZ7 A;  2ZXQ A;  1DKY A;  4AKV A;  3DX3 A;  4AZC A;  1W9M A;  3ACO A;  2F18 A;  3QE6 A;  3GI7 A;  3O3O B;  3BVV A;  2YI9 A;  2F1A A;  4R5L A;  2RT6 A;  3D2E A;  2FYV A;  4IM2 A;  4AZC B;  3ABH A;  4H6I A;  3LLL A;  4AVM A;  4H6H A;  2NCZ A;  3L3P A;  2F7R A;  3HAJ A;  4IWO A;  1OAO A;  2O0I 1;  4I1Q A;  1DKX A;  4H8S A;  1ZWW A;  2ELB A;  4NSW A;  2LM0 A;  4JN4 A;  4R5I A;  3QA8 A;  2Z0V A;  3RPM A;  1OA0 A;  4FZS A;  3I39 X;  1TQT A;  4IW0 A;  2D4C A;  2WIN M;  4PO2 A;  4D8J A;  2YKT A;  4DYL A;  3VEA A;  3BVT A;  1SU6 A;  3BVX A;  1I4D A;  2YLA A;  3T48 A;  2YLL A;  3HAH A;  4AZ6 A;  3OHX M;  4B9Q A;  4F00 A;  4R5K A;  3ER8 C;  1GN9 A;  4EZO A;  3RV1 A;  3DX4 A;  2F1B A;  2OZN B;  3FD9 A;  2X3W A;  4G6Q A;  4UDX X;  4FZP A;  2PMR A;  2X3V A;  3D50 A;  2ND1 A;  3EJT A;  1WDZ A;  2QFF A;  3I01 A;  4EZS A;  4JL9 A;  2RAI A;  3KAW A;  1TQW A;  4AZG A;  4EZV A;  4IM0 A;  1X03 A;  4ATM A;  3CZS A;  1QWN A;  2MI7 A;  4JLC A;  4EZZ A;  2YL8 A;  1SU7 A;  4IM3 A;  1I49 A;  2OBL A;  2Z0N A;  2QXL A;  3M3W A;  2Q13 A;  3BUB A;  5FIG A;  3D4Z A;  1U00 A;  5FLE X;  2EWF A;  3LVT A;  4EZU A;  2YIA A;  4AZB A;  2LXY A;  1GNT A;  1R34 A;  2RAK A;  2X5C A;  2OW6 A;  3Q84 A;  3I04 A;  1YWM A;  4JNE A;  3I2W A;  3D2F A;  3D52 A;  3DPP A;  4AZH A;  1GNL A;  4AZI A;  1I4T A;  2F7Q A;  5TKY A;  3D4Y A;  3VKH A;  5KBP A;  4JWC A;  3BLB A;  4E3C A;  3Q0K A;  3L3O M;  3QNJ A;  1SUF A;  4HYB A;  1UPX A;  4R5J A;  4NPH A;  4FZO A;  2GF4 A;  4EZX A;  2WYI A;  2Q12 A;  2YL5 A;  3B53 X;  3C7N A;  2YIV X;  4F01 A;  4WPC A;  2PY6 A;  3B52 X;  5C5B A;  2JNS A;  3CKD A;  4EZR A;  4WPE A;  3T47 A;  3ZED A;  1PS3 A;  1HXK A;  1QWU A;  3A98 A;  3SYV A;  5C5B B;  1O7D C;  2V0O A;  2RAJ A;  3F7W A;  2YL9 A;  4JWE A;  4UDY X;  3G9G A;  1OA1 A;  1HWW A;  3DYT A;  4EZT A;  1R33 A;  2Z0O A;  2YIB A;  3CZN A;  3CVR A;  2QKW A;  1I4L A;  3T4A G;  3KDR A;  1SU8 A;  3BUQ A;  3BVU A;  1TQU A;  2F7P A;  2FIC A;  2EX3 B;  3ER9 B;  2OO2 A;  2N3K A;  1MJG A;  3BUP A;  3HAI A;  3D51 A;  4JWI A;  1E2U A;  3OWG A;  4EZP A;  4EZY A;  3QWE A;  4HR1 A;  4FM3 A;  2D1L A;  4EZN A;  4KIK B;  1E9V A;  2EFK A;  3DX0 A;  5E84 A;  3PLT A;  2OW7 A;  4EZW A;  1E1D A;  1JQK A;  3QNI A;  3KAV A;  1HTY A;  4HR1 B;  3VEB A;  1R5E A;  1O7D B;  3B51 X;  3ERC C;  3DDG A;  2YI8 A;  4NQI A;  2ALW A;  3O3N B;  2YL6 A;  4E81 A;  3BVW A;  3DX2 A;  2JNK A;  3T49 A;  2KHO A;  3UIT A;  3DPQ A;  3EJQ A;  2WYH A; 
#chains in the Genus database with same CATH homology
 2Z0O A;  3HAJ A;  2YKT A;  3SYV A;  5C5B B;  4I1Q A;  3ACO A;  4NQI A;  3SOG A;  4DYL A;  4DCN C;  2V0O A;  2D1L A;  3QE6 A;  2RAJ A;  4H8S A;  2EFK A;  1X03 A;  4ATM A;  3HAI A;  1I4D A;  1ZWW A;  2Q12 A;  3PLT A;  2X3V A;  2RAK A;  4AKV A;  2EFL A;  2ELB A;  4NSW A;  1I4L A;  2X3X A;  3QNI A;  3Q84 A;  1URU A;  3HAH A;  3Q0K A;  1WDZ A;  2C08 A;  4WPC A;  1Y2O A;  3I2W A;  5C5B A;  3ABH A;  2Z0V A;  3LLL A;  4AVM A;  3G9G A;  4WPE A;  4FZS A;  1I49 A;  2Z0N A;  2D4C A;  4BNE A;  1X04 A;  2FIC A;  3M3W A;  2Q13 A;  3CAZ A;  3DYT A;  1I4T A;  2X3W A;  3OK8 A;  3QWE A;  2RAI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...