1URUA

Amphiphysin bar domain from drosophila
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
217
structure length
217
Chain Sequence
QNLGKVDRTADEIFDDHLNNFNRQQASANRLQKEFNNYIRCVRAAQAASKTLMDSVCEIYEPQWSGYDALQAQTGASESLWADFAHKLGDQVLIPLNTYTGQFPEMKKKVEKRNRKLIDYDGQRHSFQNLQANANKRKDDVKLTKGREQLEEARRTYEILNTELHDELPALYDSRILFLVTNLQTLFATEQVFHNETAKIYSELEAIVDKLATESQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AMPHIPHYSIN
publication title Bar Domains as Sensors of Membrane Curvature: The Amphiphysin Bar Structure
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Endocytosis
total genus 92
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2003-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03114 BAR BAR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 1uruA01
4DYLA 2Z0OA 2Q12A 2X3XA 3QE6A 2Z0VA 2X3WA 3HAIA 2RAKA 3ABHA 5C5BA 3G9GA 2Q13A 3ACOA 2EFLA 4FZSA 2D1LA 3QWEA 4BNEA 2X3VA 2RAJA 3Q0KA 4DCNC 4WPEA 2FICA 4AVMA 3DYTA 3QNIA 3CAZA 3Q84A 4NQIA 3SYVA 1Y2OA 2Z0NA 4NSWA 2YKTA 4ATMA 1WDZA 1I4LA 2V0OA 3SOGA 2EFKA 3OK8A 3PLTA 1I4TA 1X04A 4H8SA 2C08A 1I49A 1X03A 4AKVA 2ELBA 3HAHA 3I2WA 3LLLA 3HAJA 2D4CA 1ZWWA 4WPCA 5C5BB 3M3WA 1URUA 4I1QA 2RAIA 1I4DA
chains in the Genus database with same CATH superfamily
2YL9A 2X3WA 3BUBA 1UPXA 4FZSA 4EZOA 3BUQA 3FD9A 1TQVA 1SU6A 4NSWA 4JWEA 3QA8A 4H6IA 3I39X 2YLLA 5KBPA 2F1AA 1HTYA 3HAJA 3DDFA 2X3XA 3UITA 2EFLA 4WPEA 2X3VA 1E2UA 1Y2OA 2NCZA 4EZUA 3RPMA 4JL9A 4AZHA 3ER9B 3L3PA 3D50A 1E1DA 2C08A 3DX0A 4R5GA 3DX3A 3HAHA 2F7OA 3LLLA 4NPHA 2LXYA 2YL5A 2F18A 2OBLA 4ATMA 4M0MA 3C7NA 3DX4A 3O3MB 3EJTA 4AKVA 3EJRA 4HR1B 4FZOA 2D4CA 2PY6A 1YWMA 3ERCC 2YIBA 4AZCA 3ABHA 3D2FA 4JN4A 1E9VA 2YL8A 1R33A 2YKTA 3O3NB 3B53X 4HYBA 4IWOA 3VKHA 2EWFA 4JLCA 4WPCA 3M3WA 4IM3A 2Z0OA 2FYVA 5FIGA 4E81A 2F1BA 3O3OB 3CKDA 1GNLA 1R5EA 3D4YA 4IWPA 1HXKA 4R5JA 4IW0A 2PMRA 4AZ6A 2V0OA 1GN9A 1X04A 1I49A 2RT6A 3BUDA 2MI7A 1QWNA 2ND0A 2Q13A 4DCNC 3Q0KA 3T4AG 4EZZA 4FZPA 1PS3A 3SOGA 3BVXA 3VEBA 3F7WA 2F7PA 4H8SA 4H6HA 2ELBA 3EJPA 4EZRA 2F7QA 3ZEDA 1SU8A 1QWUA 4HR1A 2JNKA 4EZQA 2YIAA 3G9GA 2OZNB 1TQWA 3BUPA 3OWGA 1R34A 3OK8A 1TQUA 4EZNA 1O7DB 4UDYX 3HAIA 4EZYA 2RAKA 4G6QA 3OHXM 5C5BA 4BNEA 2FICA 4AZGA 4E3CA 3CAZA 2QXLA 3T46A 2YLAA 3CV5A 2EFKA 1QX1A 3D2EA 3RV0A 3DPPA 3RV1A 1SUFA 2QFFA 4I1QA 3QE6A 2GA9D 2D1LA 1ZYLA 3I01A 4NQIA 3EJQA 3KAVA 3DX1A 2N3KA 1MJGA 1X03A 1HWWA 4EZVA 3VEAA 3BLBA 3B51X 2GAFD 3D4ZA 1TQSA 3BUIA 3DDGA 4AZ7A 3DX2A 3GI7A 4F00A 4R5LA 2YI8A 1DKXA 4R5IA 5E84A 2ALWA 2O0I1 3T47A 1ZWWA 1URUA 2EX3B 4AZBA 4D8JA 4UDXX 3DPOA 2Q12A 3ACOA 5FLEX 1GNTA 3DYTA 4JNEA 4KIKB 2ND1A 1DKYA 3ER8C 3BVUA 2WYIA 2Z8YA 3BVWA 2RAIA 4DYLA 2OW6A 3D51A 3LVTA 3BVVA 4AVMA 4JWDA 1W9MA 3DPQA 2Z0NA 3T48A 2GF4A 3T49A 4EZWA 3KDRA 4EZTA 4EZSA 3CVRA 4FM3A 4IM0A 1JQKA 3D52A 2KHOA 2Z0VA 2YL6A 3QWEA 3EJSA 2RAJA 1I4LA 4IM2A 1I4TA 4JNFA 1DKZA 2ZXQA 1O7DC 4EZPA 1SU7A 2YI9A 4HY9A 3CZSA 3A98A 2OW7A 3KAWA 3Q84A 4B9QA 5TKYA 1WDZA 1OAOA 4KIKA 3PLTA 3B52X 2YIVX 3BVTA 4F01A 3LMFA 3I04A 1I4DA 2JNSA 4JWIA 3CZNA 2WYHA 1U00A 4IWQA 2WINM 3SYVA 3EJUA 3QNJA 1TQTA 4R5KA 1LQ7A 3L3OM 1OA1A 5C5BB 1OA0A 2X5CA 2QKWA 4AZIA 4AZ5A 4JWCA 4EZXA 3QNIA 2OO2A 2F7RA 2OBMA 2LM0A 4PO2A 3I2WA 4AZCB
chains in the Genus database with same CATH topology
4DYLA 2Z0OA 2Q12A 2X3XA 3QE6A 2Z0VA 2X3WA 3HAIA 2RAKA 3ABHA 5C5BA 3G9GA 2Q13A 3ACOA 2EFLA 4FZSA 2D1LA 3QWEA 4BNEA 2X3VA 2RAJA 3Q0KA 4DCNC 4WPEA 2FICA 4AVMA 3DYTA 3QNIA 3CAZA 3Q84A 4NQIA 3SYVA 1Y2OA 2Z0NA 4NSWA 2YKTA 4ATMA 1WDZA 1I4LA 2V0OA 3SOGA 2EFKA 3OK8A 3PLTA 1I4TA 1X04A 4H8SA 2C08A 1I49A 1X03A 4AKVA 2ELBA 3HAHA 3I2WA 3LLLA 3HAJA 2D4CA 1ZWWA 4WPCA 5C5BB 3M3WA 1URUA 4I1QA 2RAIA 1I4DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DYL A;  2Z0O A;  2Q12 A;  2X3X A;  3QE6 A;  2Z0V A;  2X3W A;  3HAI A;  2RAK A;  3ABH A;  5C5B A;  3G9G A;  2Q13 A;  3ACO A;  2EFL A;  4FZS A;  2D1L A;  3QWE A;  4BNE A;  2X3V A;  2RAJ A;  3Q0K A;  4DCN C;  4WPE A;  2FIC A;  4AVM A;  3DYT A;  3QNI A;  3CAZ A;  3Q84 A;  4NQI A;  3SYV A;  1Y2O A;  2Z0N A;  4NSW A;  2YKT A;  4ATM A;  1WDZ A;  1I4L A;  2V0O A;  3SOG A;  2EFK A;  3OK8 A;  3PLT A;  1I4T A;  1X04 A;  4H8S A;  2C08 A;  1I49 A;  1X03 A;  4AKV A;  2ELB A;  3HAH A;  3I2W A;  3LLL A;  3HAJ A;  2D4C A;  1ZWW A;  4WPC A;  5C5B B;  3M3W A;  1URU A;  4I1Q A;  2RAI A;  1I4D A; 
#chains in the Genus database with same CATH topology
 2YL9 A;  2X3W A;  3BUB A;  1UPX A;  4FZS A;  4EZO A;  3BUQ A;  3FD9 A;  1TQV A;  1SU6 A;  4NSW A;  4JWE A;  3QA8 A;  4H6I A;  3I39 X;  2YLL A;  5KBP A;  2F1A A;  1HTY A;  3HAJ A;  3DDF A;  2X3X A;  3UIT A;  2EFL A;  4WPE A;  2X3V A;  1E2U A;  1Y2O A;  2NCZ A;  4EZU A;  3RPM A;  4JL9 A;  4AZH A;  3ER9 B;  3L3P A;  3D50 A;  1E1D A;  2C08 A;  3DX0 A;  4R5G A;  3DX3 A;  3HAH A;  2F7O A;  3LLL A;  4NPH A;  2LXY A;  2YL5 A;  2F18 A;  2OBL A;  4ATM A;  4M0M A;  3C7N A;  3DX4 A;  3O3M B;  3EJT A;  4AKV A;  3EJR A;  4HR1 B;  4FZO A;  2D4C A;  2PY6 A;  1YWM A;  3ERC C;  2YIB A;  4AZC A;  3ABH A;  3D2F A;  4JN4 A;  1E9V A;  2YL8 A;  1R33 A;  2YKT A;  3O3N B;  3B53 X;  4HYB A;  4IWO A;  3VKH A;  2EWF A;  4JLC A;  4WPC A;  3M3W A;  4IM3 A;  2Z0O A;  2FYV A;  5FIG A;  4E81 A;  2F1B A;  3O3O B;  3CKD A;  1GNL A;  1R5E A;  3D4Y A;  4IWP A;  1HXK A;  4R5J A;  4IW0 A;  2PMR A;  4AZ6 A;  2V0O A;  1GN9 A;  1X04 A;  1I49 A;  2RT6 A;  3BUD A;  2MI7 A;  1QWN A;  2ND0 A;  2Q13 A;  4DCN C;  3Q0K A;  3T4A G;  4EZZ A;  4FZP A;  1PS3 A;  3SOG A;  3BVX A;  3VEB A;  3F7W A;  2F7P A;  4H8S A;  4H6H A;  2ELB A;  3EJP A;  4EZR A;  2F7Q A;  3ZED A;  1SU8 A;  1QWU A;  4HR1 A;  2JNK A;  4EZQ A;  2YIA A;  3G9G A;  2OZN B;  1TQW A;  3BUP A;  3OWG A;  1R34 A;  3OK8 A;  1TQU A;  4EZN A;  1O7D B;  4UDY X;  3HAI A;  4EZY A;  2RAK A;  4G6Q A;  3OHX M;  5C5B A;  4BNE A;  2FIC A;  4AZG A;  4E3C A;  3CAZ A;  2QXL A;  3T46 A;  2YLA A;  3CV5 A;  2EFK A;  1QX1 A;  3D2E A;  3RV0 A;  3DPP A;  3RV1 A;  1SUF A;  2QFF A;  4I1Q A;  3QE6 A;  2GA9 D;  2D1L A;  1ZYL A;  3I01 A;  4NQI A;  3EJQ A;  3KAV A;  3DX1 A;  2N3K A;  1MJG A;  1X03 A;  1HWW A;  4EZV A;  3VEA A;  3BLB A;  3B51 X;  2GAF D;  3D4Z A;  1TQS A;  3BUI A;  3DDG A;  4AZ7 A;  3DX2 A;  3GI7 A;  4F00 A;  4R5L A;  2YI8 A;  1DKX A;  4R5I A;  5E84 A;  2ALW A;  2O0I 1;  3T47 A;  1ZWW A;  1URU A;  2EX3 B;  4AZB A;  4D8J A;  4UDX X;  3DPO A;  2Q12 A;  3ACO A;  5FLE X;  1GNT A;  3DYT A;  4JNE A;  4KIK B;  2ND1 A;  1DKY A;  3ER8 C;  3BVU A;  2WYI A;  2Z8Y A;  3BVW A;  2RAI A;  4DYL A;  2OW6 A;  3D51 A;  3LVT A;  3BVV A;  4AVM A;  4JWD A;  1W9M A;  3DPQ A;  2Z0N A;  3T48 A;  2GF4 A;  3T49 A;  4EZW A;  3KDR A;  4EZT A;  4EZS A;  3CVR A;  4FM3 A;  4IM0 A;  1JQK A;  3D52 A;  2KHO A;  2Z0V A;  2YL6 A;  3QWE A;  3EJS A;  2RAJ A;  1I4L A;  4IM2 A;  1I4T A;  4JNF A;  1DKZ A;  2ZXQ A;  1O7D C;  4EZP A;  1SU7 A;  2YI9 A;  4HY9 A;  3CZS A;  3A98 A;  2OW7 A;  3KAW A;  3Q84 A;  4B9Q A;  5TKY A;  1WDZ A;  1OAO A;  4KIK A;  3PLT A;  3B52 X;  2YIV X;  3BVT A;  4F01 A;  3LMF A;  3I04 A;  1I4D A;  2JNS A;  4JWI A;  3CZN A;  2WYH A;  1U00 A;  4IWQ A;  2WIN M;  3SYV A;  3EJU A;  3QNJ A;  1TQT A;  4R5K A;  1LQ7 A;  3L3O M;  1OA1 A;  5C5B B;  1OA0 A;  2X5C A;  2QKW A;  4AZI A;  4AZ5 A;  4JWC A;  4EZX A;  3QNI A;  2OO2 A;  2F7R A;  2OBM A;  2LM0 A;  4PO2 A;  3I2W A;  4AZC B; 
#chains in the Genus database with same CATH homology
 4DYL A;  2Z0O A;  2Q12 A;  2X3X A;  3QE6 A;  2Z0V A;  2X3W A;  3HAI A;  2RAK A;  3ABH A;  5C5B A;  3G9G A;  2Q13 A;  3ACO A;  2EFL A;  4FZS A;  2D1L A;  3QWE A;  4BNE A;  2X3V A;  2RAJ A;  3Q0K A;  4DCN C;  4WPE A;  2FIC A;  4AVM A;  3DYT A;  3QNI A;  3CAZ A;  3Q84 A;  4NQI A;  3SYV A;  1Y2O A;  2Z0N A;  4NSW A;  2YKT A;  4ATM A;  1WDZ A;  1I4L A;  2V0O A;  3SOG A;  2EFK A;  3OK8 A;  3PLT A;  1I4T A;  1X04 A;  4H8S A;  2C08 A;  1I49 A;  1X03 A;  4AKV A;  2ELB A;  3HAH A;  3I2W A;  3LLL A;  3HAJ A;  2D4C A;  1ZWW A;  4WPC A;  5C5B B;  3M3W A;  1URU A;  4I1Q A;  2RAI A;  1I4D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...