1URUA

Amphiphysin bar domain from drosophila
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
217
structure length
217
Chain Sequence
QNLGKVDRTADEIFDDHLNNFNRQQASANRLQKEFNNYIRCVRAAQAASKTLMDSVCEIYEPQWSGYDALQAQTGASESLWADFAHKLGDQVLIPLNTYTGQFPEMKKKVEKRNRKLIDYDGQRHSFQNLQANANKRKDDVKLTKGREQLEEARRTYEILNTELHDELPALYDSRILFLVTNLQTLFATEQVFHNETAKIYSELEAIVDKLATESQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AMPHIPHYSIN
publication title Bar Domains as Sensors of Membrane Curvature: The Amphiphysin Bar Structure
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Endocytosis
total genus 92
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2003-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03114 BAR BAR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 1uruA01
3M3WA 2Q13A 2Q12A 3I2WA 4AKVA 4DCNC 3CAZA 3ACOA 4H8SA 2C08A 3HAHA 1I4LA 3Q0KA 1I49A 2ELBA 4NQIA 4WPCA 2EFKA 3Q84A 3SOGA 4DYLA 3HAIA 3DYTA 4AVMA 3HAJA 4I1QA 1X04A 4ATMA 2Z0NA 2X3VA 2YKTA 2D4CA 1X03A 3SYVA 2RAJA 4WPEA 2V0OA 5C5BA 1WDZA 2EFLA 2X3WA 2Z0OA 3OK8A 2D1LA 2X3XA 1I4TA 3PLTA 3QNIA 4BNEA 1I4DA 1Y2OA 2Z0VA 2RAKA 3QE6A 3LLLA 3QWEA 2RAIA 4NSWA 1ZWWA 2FICA 4FZSA 3ABHA 5C5BB 1URUA 3G9GA
chains in the Genus database with same CATH superfamily
3M3WA 1GN9A 3OHXM 4I1QA 1X04A 1DKYA 2NCZA 2Z0OA 3PLTA 4IWPA 2PMRA 3I39X 5E84A 3T48A 3O3OB 1I49A 4JWEA 3DX1A 3HAIA 1R34A 3DPPA 2LM0A 3VEAA 2RAKA 2ND0A 3SYVA 1OA0A 2Q12A 4KIKB 4H8SA 1I4LA 2FYVA 4NQIA 2WYHA 4EZTA 1OAOA 2WINM 4AZHA 3L3PA 3CZSA 3BLBA 1TQUA 3D2EA 2YI8A 3ER9B 4EZXA 4R5GA 1W9MA 3G9GA 2Q13A 3ACOA 3HAHA 3DPQA 4HY9A 3DDGA 3D50A 2YLAA 1QWNA 1MJGA 1OA1A 3RPMA 3C7NA 3DX4A 1DKZA 1WDZA 2F7QA 3UITA 2F7OA 4HR1B 3QWEA 4AZGA 1ZWWA 3DDFA 1UPXA 4IM3A 4JL9A 1R33A 4H6HA 1ZYLA 2ALWA 2GAFD 4FM3A 3RV0A 2D4CA 1X03A 2OO2A 4H6IA 4FZPA 4HYBA 4AZIA 4AZ6A 3O3NB 1E1DA 4IM0A 4R5IA 3I01A 4NPHA 4JWDA 4JN4A 3T47A 4EZYA 4IWOA 2F7RA 3RV1A 3EJTA 3QNJA 3SOGA 3ZEDA 3DYTA 3GI7A 4ATMA 2X3WA 1LQ7A 1I4TA 4BNEA 4AZBA 1Y2OA 2Z0VA 2YI9A 1HXKA 4AZ7A 4EZRA 3T49A 1GNTA 3BVWA 2YL9A 1DKXA 3Q84A 2X3VA 2JNSA 4F00A 2ND1A 2Z8YA 3EJQA 2QKWA 2N3KA 4KIKA 3CV5A 3KDRA 2RAIA 3O3MB 3FD9A 3D2FA 4DCNC 3BUIA 3T4AG 2YLLA 5TKYA 1QWUA 1SU8A 2EFKA 2F7PA 3BVVA 3HAJA 4EZUA 1HWWA 4EZZA 3VKHA 1TQTA 2EFLA 3EJUA 2D1LA 3D52A 3D4YA 3DX0A 1HTYA 3ABHA 3QA8A 2C08A 2ZXQA 3ER8C 4EZWA 4D8JA 2MI7A 4HR1A 3D4ZA 2RAJA 3F7WA 3OK8A 2X3XA 2WYIA 4E3CA 4NSWA 3B52X 4FZSA 5C5BB 4IW0A 5KBPA 3LVTA 4AVMA 3DX3A 1SUFA 2YL5A 3CZNA 4WPEA 3DX2A 1O7DC 1TQWA 4EZNA 4E81A 2OBLA 3T46A 3QNIA 2F1AA 3I04A 1URUA 3L3OM 4AKVA 3B51X 1JQKA 2GA9D 3BUDA 3OWGA 2Z0NA 3EJSA 4EZQA 3BUPA 4F01A 1R5EA 3LMFA 2V0OA 4M0MA 4JLCA 3BVTA 4PO2A 3VEBA 2OBMA 4AZCB 2YL8A 2ELBA 4JNFA 1SU6A 2KHOA 3B53X 4EZVA 2GF4A 2LXYA 3KAWA 2JNKA 4G6QA 3BVXA 3BVUA 3ERCC 1QX1A 3BUQA 2RT6A 2OW7A 3LLLA 5FLEX 4EZOA 3KAVA 3A98A 2YIBA 2YIVX 4WPCA 3CKDA 4EZSA 4JWCA 3EJRA 3D51A 2F1BA 2PY6A 4R5JA 2F18A 2OZNB 2FICA 1TQVA 1U00A 1SU7A 2EWFA 3EJPA 4AZ5A 1TQSA 1E9VA 1PS3A 2O0I1 4FZOA 2EX3B 5C5BA 4JNEA 3BUBA 4R5LA 4R5KA 4UDYX 4IM2A 3I2WA 3CAZA 4UDXX 5FIGA 3CVRA 4B9QA 4EZPA 2X5CA 1GNLA 1YWMA 1E2UA 4IWQA 3Q0KA 4DYLA 4JWIA 2YKTA 2OW6A 2QFFA 2QXLA 1O7DB 4AZCA 2YL6A 2YIAA 1I4DA 3QE6A 3DPOA
chains in the Genus database with same CATH topology
3M3WA 2Q13A 2Q12A 3I2WA 4AKVA 4DCNC 3CAZA 3ACOA 4H8SA 2C08A 3HAHA 1I4LA 3Q0KA 1I49A 2ELBA 4NQIA 4WPCA 2EFKA 3Q84A 3SOGA 4DYLA 3HAIA 3DYTA 4AVMA 3HAJA 4I1QA 1X04A 4ATMA 2Z0NA 2X3VA 2YKTA 2D4CA 1X03A 3SYVA 2RAJA 4WPEA 2V0OA 5C5BA 1WDZA 2EFLA 2X3WA 2Z0OA 3OK8A 2D1LA 2X3XA 1I4TA 3PLTA 3QNIA 4BNEA 1I4DA 1Y2OA 2Z0VA 2RAKA 3QE6A 3LLLA 3QWEA 2RAIA 4NSWA 1ZWWA 2FICA 4FZSA 3ABHA 5C5BB 1URUA 3G9GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M3W A;  2Q13 A;  2Q12 A;  3I2W A;  4AKV A;  4DCN C;  3CAZ A;  3ACO A;  4H8S A;  2C08 A;  3HAH A;  1I4L A;  3Q0K A;  1I49 A;  2ELB A;  4NQI A;  4WPC A;  2EFK A;  3Q84 A;  3SOG A;  4DYL A;  3HAI A;  3DYT A;  4AVM A;  3HAJ A;  4I1Q A;  1X04 A;  4ATM A;  2Z0N A;  2X3V A;  2YKT A;  2D4C A;  1X03 A;  3SYV A;  2RAJ A;  4WPE A;  2V0O A;  5C5B A;  1WDZ A;  2EFL A;  2X3W A;  2Z0O A;  3OK8 A;  2D1L A;  2X3X A;  1I4T A;  3PLT A;  3QNI A;  4BNE A;  1I4D A;  1Y2O A;  2Z0V A;  2RAK A;  3QE6 A;  3LLL A;  3QWE A;  2RAI A;  4NSW A;  1ZWW A;  2FIC A;  4FZS A;  3ABH A;  5C5B B;  1URU A;  3G9G A; 
#chains in the Genus database with same CATH topology
 3M3W A;  1GN9 A;  3OHX M;  4I1Q A;  1X04 A;  1DKY A;  2NCZ A;  2Z0O A;  3PLT A;  4IWP A;  2PMR A;  3I39 X;  5E84 A;  3T48 A;  3O3O B;  1I49 A;  4JWE A;  3DX1 A;  3HAI A;  1R34 A;  3DPP A;  2LM0 A;  3VEA A;  2RAK A;  2ND0 A;  3SYV A;  1OA0 A;  2Q12 A;  4KIK B;  4H8S A;  1I4L A;  2FYV A;  4NQI A;  2WYH A;  4EZT A;  1OAO A;  2WIN M;  4AZH A;  3L3P A;  3CZS A;  3BLB A;  1TQU A;  3D2E A;  2YI8 A;  3ER9 B;  4EZX A;  4R5G A;  1W9M A;  3G9G A;  2Q13 A;  3ACO A;  3HAH A;  3DPQ A;  4HY9 A;  3DDG A;  3D50 A;  2YLA A;  1QWN A;  1MJG A;  1OA1 A;  3RPM A;  3C7N A;  3DX4 A;  1DKZ A;  1WDZ A;  2F7Q A;  3UIT A;  2F7O A;  4HR1 B;  3QWE A;  4AZG A;  1ZWW A;  3DDF A;  1UPX A;  4IM3 A;  4JL9 A;  1R33 A;  4H6H A;  1ZYL A;  2ALW A;  2GAF D;  4FM3 A;  3RV0 A;  2D4C A;  1X03 A;  2OO2 A;  4H6I A;  4FZP A;  4HYB A;  4AZI A;  4AZ6 A;  3O3N B;  1E1D A;  4IM0 A;  4R5I A;  3I01 A;  4NPH A;  4JWD A;  4JN4 A;  3T47 A;  4EZY A;  4IWO A;  2F7R A;  3RV1 A;  3EJT A;  3QNJ A;  3SOG A;  3ZED A;  3DYT A;  3GI7 A;  4ATM A;  2X3W A;  1LQ7 A;  1I4T A;  4BNE A;  4AZB A;  1Y2O A;  2Z0V A;  2YI9 A;  1HXK A;  4AZ7 A;  4EZR A;  3T49 A;  1GNT A;  3BVW A;  2YL9 A;  1DKX A;  3Q84 A;  2X3V A;  2JNS A;  4F00 A;  2ND1 A;  2Z8Y A;  3EJQ A;  2QKW A;  2N3K A;  4KIK A;  3CV5 A;  3KDR A;  2RAI A;  3O3M B;  3FD9 A;  3D2F A;  4DCN C;  3BUI A;  3T4A G;  2YLL A;  5TKY A;  1QWU A;  1SU8 A;  2EFK A;  2F7P A;  3BVV A;  3HAJ A;  4EZU A;  1HWW A;  4EZZ A;  3VKH A;  1TQT A;  2EFL A;  3EJU A;  2D1L A;  3D52 A;  3D4Y A;  3DX0 A;  1HTY A;  3ABH A;  3QA8 A;  2C08 A;  2ZXQ A;  3ER8 C;  4EZW A;  4D8J A;  2MI7 A;  4HR1 A;  3D4Z A;  2RAJ A;  3F7W A;  3OK8 A;  2X3X A;  2WYI A;  4E3C A;  4NSW A;  3B52 X;  4FZS A;  5C5B B;  4IW0 A;  5KBP A;  3LVT A;  4AVM A;  3DX3 A;  1SUF A;  2YL5 A;  3CZN A;  4WPE A;  3DX2 A;  1O7D C;  1TQW A;  4EZN A;  4E81 A;  2OBL A;  3T46 A;  3QNI A;  2F1A A;  3I04 A;  1URU A;  3L3O M;  4AKV A;  3B51 X;  1JQK A;  2GA9 D;  3BUD A;  3OWG A;  2Z0N A;  3EJS A;  4EZQ A;  3BUP A;  4F01 A;  1R5E A;  3LMF A;  2V0O A;  4M0M A;  4JLC A;  3BVT A;  4PO2 A;  3VEB A;  2OBM A;  4AZC B;  2YL8 A;  2ELB A;  4JNF A;  1SU6 A;  2KHO A;  3B53 X;  4EZV A;  2GF4 A;  2LXY A;  3KAW A;  2JNK A;  4G6Q A;  3BVX A;  3BVU A;  3ERC C;  1QX1 A;  3BUQ A;  2RT6 A;  2OW7 A;  3LLL A;  5FLE X;  4EZO A;  3KAV A;  3A98 A;  2YIB A;  2YIV X;  4WPC A;  3CKD A;  4EZS A;  4JWC A;  3EJR A;  3D51 A;  2F1B A;  2PY6 A;  4R5J A;  2F18 A;  2OZN B;  2FIC A;  1TQV A;  1U00 A;  1SU7 A;  2EWF A;  3EJP A;  4AZ5 A;  1TQS A;  1E9V A;  1PS3 A;  2O0I 1;  4FZO A;  2EX3 B;  5C5B A;  4JNE A;  3BUB A;  4R5L A;  4R5K A;  4UDY X;  4IM2 A;  3I2W A;  3CAZ A;  4UDX X;  5FIG A;  3CVR A;  4B9Q A;  4EZP A;  2X5C A;  1GNL A;  1YWM A;  1E2U A;  4IWQ A;  3Q0K A;  4DYL A;  4JWI A;  2YKT A;  2OW6 A;  2QFF A;  2QXL A;  1O7D B;  4AZC A;  2YL6 A;  2YIA A;  1I4D A;  3QE6 A;  3DPO A; 
#chains in the Genus database with same CATH homology
 3M3W A;  2Q13 A;  2Q12 A;  3I2W A;  4AKV A;  4DCN C;  3CAZ A;  3ACO A;  4H8S A;  2C08 A;  3HAH A;  1I4L A;  3Q0K A;  1I49 A;  2ELB A;  4NQI A;  4WPC A;  2EFK A;  3Q84 A;  3SOG A;  4DYL A;  3HAI A;  3DYT A;  4AVM A;  3HAJ A;  4I1Q A;  1X04 A;  4ATM A;  2Z0N A;  2X3V A;  2YKT A;  2D4C A;  1X03 A;  3SYV A;  2RAJ A;  4WPE A;  2V0O A;  5C5B A;  1WDZ A;  2EFL A;  2X3W A;  2Z0O A;  3OK8 A;  2D1L A;  2X3X A;  1I4T A;  3PLT A;  3QNI A;  4BNE A;  1I4D A;  1Y2O A;  2Z0V A;  2RAK A;  3QE6 A;  3LLL A;  3QWE A;  2RAI A;  4NSW A;  1ZWW A;  2FIC A;  4FZS A;  3ABH A;  5C5B B;  1URU A;  3G9G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...