2X5CA

Crystal structure of hypothetical protein orf131 from pyrobaculum spherical virus
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
99
structure length
99
Chain Sequence
YKQEYDMAADLVRMLRGLGVFMHAKCPRCGAEGSVSIVETKNGYKYLVIRHPDGGTHTVPKTDISAILKELCEVKKDLEYVLKRYKEYEEEGGVKFCAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL PROTEIN ORF131
publication title The Scottish Structural Proteomics Facility: Targets, Methods and Outputs.
pubmed doi rcsb
source organism Pyrobaculum spherical virus
molecule tags Viral protein
total genus 31
structure length 99
sequence length 99
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.200 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 2x5cA01
2X5CA
chains in the Genus database with same CATH superfamily
3T46A 3GI7A 1W9MA 1GNTA 1TQTA 3HAJA 3D4YA 2LXYA 2YIVX 3BVVA 1I4TA 2F7PA 1PS3A 3CZSA 3CKDA 3KAWA 4JN4A 2OZNB 2JNKA 4M0MA 2OBLA 4AZIA 3BUIA 2EX3B 3T47A 4EZTA 3QNIA 3DX3A 3BLBA 3EJQA 1HXKA 4JNEA 1X03A 3HAIA 4JWIA 1E9VA 2RAIA 5C5BA 1R5EA 3DPOA 4IWQA 5KBPA 1GNLA 2NCZA 2YL5A 1OAOA 2MI7A 4FZOA 4I1QA 2D1LA 3BVWA 4G6QA 1DKXA 4R5LA 1SU6A 3A98A 1YWMA 4EZPA 2QXLA 3RV1A 4JNFA 3DX0A 3F7WA 3EJRA 2F18A 2Z0NA 4KIKA 2YIBA 1E2UA 3QWEA 3QA8A 1JQKA 2OW7A 2YL8A 3CVRA 4F01A 3VEAA 2YLLA 2C08A 3CZNA 4WPEA 2GAFD 3LLLA 3D52A 2GA9D 3Q0KA 4WPCA 2RT6A 4AZ7A 1QX1A 3BUDA 2F1BA 1DKZA 3ACOA 2KHOA 1LQ7A 3I39X 4AZCA 1O7DC 3L3OM 2PY6A 4H6IA 4EZWA 4AZBA 3B53X 3I2WA 4B9QA 4HY9A 2V0OA 3T4AG 4EZRA 2X3WA 3DDGA 2YL9A 2ND0A 1TQVA 1URUA 2OW6A 4E3CA 3O3OB 3EJUA 5C5BB 5TKYA 3ERCC 4EZXA 3C7NA 1TQSA 3PLTA 1I4LA 4EZVA 2X3VA 3O3NB 2Z0OA 1E1DA 4F00A 1SU8A 3EJPA 3EJSA 3CV5A 4IM3A 1U00A 3KDRA 4KIKB 4EZUA 2RAKA 2F7RA 1SU7A 3HAHA 1UPXA 4IWPA 3D50A 4AZGA 1QWUA 3VKHA 4IM2A 1HWWA 3BVXA 3QNJA 3DYTA 3OHXM 4JL9A 3UITA 2JNSA 3KAVA 3ZEDA 3D2FA 2EWFA 4D8JA 4FZSA 2ZXQA 4R5IA 3QE6A 3RPMA 2WYIA 4FM3A 4HYBA 3I01A 2Z0VA 4AZCB 4UDYX 2Z8YA 2ND1A 2O0I1 3DDFA 4R5GA 5E84A 1ZWWA 3DX2A 4DCNC 4EZZA 1HTYA 3D2EA 3DX1A 4HR1A 2EFKA 1R33A 3SYVA 3BVUA 2D4CA 3CAZA 1MJGA 3L3PA 4AZHA 2YIAA 1TQUA 2LM0A 4ATMA 4NSWA 2YKTA 4H8SA 3B51X 2PMRA 1Y2OA 3LMFA 1ZYLA 2RAJA 3BUQA 2YLAA 4IW0A 4H6HA 2N3KA 2GF4A 4EZNA 2FYVA 1GN9A 4R5JA 3DPQA 4IM0A 1QWNA 1X04A 2OO2A 4IWOA 2OBMA 4BNEA 2ALWA 4JLCA 3Q84A 2Q13A 3ER9B 4NQIA 2QFFA 3D51A 2YL6A 2F1AA 3ER8C 4E81A 1WDZA 3M3WA 4EZSA 3BUPA 4AZ6A 3G9GA 1OA0A 2YI8A 3OK8A 3B52X 1OA1A 3ABHA 2WYHA 4R5KA 4DYLA 4EZQA 2F7QA 3OWGA 3I04A 5FLEX 4UDXX 3BUBA 4JWDA 4AZ5A 1I4DA 4FZPA 3T49A 1SUFA 5FIGA 2X5CA 2YI9A 3DX4A 3LVTA 3SOGA 4NPHA 1DKYA 2QKWA 3DPPA 2FICA 2F7OA 2WINM 4HR1B 2Q12A 4EZYA 3BVTA 3RV0A 4EZOA 3T48A 4AKVA 3EJTA 3FD9A 4JWEA 1O7DB 3O3MB 1I49A 1TQWA 2X3XA 2ELBA 3D4ZA 4AVMA 1R34A 4PO2A 2EFLA 4JWCA 3VEBA
chains in the Genus database with same CATH topology
3T46A 3GI7A 4EZNA 1W9MA 1GNTA 3VKHA 4IM2A 1GN9A 4R5JA 2GA9D 4H6HA 3QNJA 3DPQA 4IM0A 2RT6A 4IWOA 2OBMA 2YIVX 3OHXM 4JL9A 1DKZA 4JLCA 2KHOA 4JN4A 3KAWA 2JNSA 3UITA 3ER9B 2QFFA 4M0MA 2OBLA 3KAVA 3ZEDA 3D2FA 2EWFA 4D8JA 2EX3B 3T47A 4EZTA 4R5IA 3ER8C 3I39X 4E81A 3L3OM 4EZSA 4FM3A 2PY6A 4H6IA 4HYBA 3I01A 4EZWA 4B9QA 3B53X 1OA0A 4HY9A 2YI8A 3VEBA 4JNEA 4UDYX 3B52X 1OA1A 2Z8YA 3T4AG 4JWIA 4R5KA 4EZRA 4EZQA 3OWGA 2ND1A 1E9VA 3I04A 2ND0A 5FLEX 4UDXX 3DPOA 4R5GA 4E3CA 4IWQA 4JWDA 5E84A 1GNLA 3O3OB 4EZZA 3T49A 1SUFA 2NCZA 5TKYA 3ERCC 4EZXA 3C7NA 1OAOA 5FIGA 2X5CA 3D2EA 2YI9A 4G6QA 4HR1A 4NPHA 1DKXA 1DKYA 4R5LA 1SU6A 3A98A 3DPPA 4EZVA 4EZPA 1MJGA 2WINM 2QXLA 4HR1B 2YIAA 3RV1A 3O3NB 4JNFA 4EZYA 3RV0A 3F7WA 4EZOA 2LM0A 1E1DA 4F00A 1SU8A 3T48A 4KIKA 2YIBA 1E2UA 3B51X 3FD9A 4IM3A 4JWEA 1U00A 3KDRA 4KIKB 3O3MB 3QA8A 4EZUA 1JQKA 3LMFA 4F01A 1ZYLA 3VEAA 1SU7A 4PO2A 1UPXA 4IWPA 4IW0A 4JWCA 2GAFD 2N3KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X5C A; 
#chains in the Genus database with same CATH topology
 3T46 A;  3GI7 A;  1W9M A;  1GNT A;  1TQT A;  3HAJ A;  3D4Y A;  2LXY A;  2YIV X;  3BVV A;  1I4T A;  2F7P A;  1PS3 A;  3CZS A;  3CKD A;  3KAW A;  4JN4 A;  2OZN B;  2JNK A;  4M0M A;  2OBL A;  4AZI A;  3BUI A;  2EX3 B;  3T47 A;  4EZT A;  3QNI A;  3DX3 A;  3BLB A;  3EJQ A;  1HXK A;  4JNE A;  1X03 A;  3HAI A;  4JWI A;  1E9V A;  2RAI A;  5C5B A;  1R5E A;  3DPO A;  4IWQ A;  5KBP A;  1GNL A;  2NCZ A;  2YL5 A;  1OAO A;  2MI7 A;  4FZO A;  4I1Q A;  2D1L A;  3BVW A;  4G6Q A;  1DKX A;  4R5L A;  1SU6 A;  3A98 A;  1YWM A;  4EZP A;  2QXL A;  3RV1 A;  4JNF A;  3DX0 A;  3F7W A;  3EJR A;  2F18 A;  2Z0N A;  4KIK A;  2YIB A;  1E2U A;  3QWE A;  3QA8 A;  1JQK A;  2OW7 A;  2YL8 A;  3CVR A;  4F01 A;  3VEA A;  2YLL A;  2C08 A;  3CZN A;  4WPE A;  2GAF D;  3LLL A;  3D52 A;  2GA9 D;  3Q0K A;  4WPC A;  2RT6 A;  4AZ7 A;  1QX1 A;  3BUD A;  2F1B A;  1DKZ A;  3ACO A;  2KHO A;  1LQ7 A;  3I39 X;  4AZC A;  1O7D C;  3L3O M;  2PY6 A;  4H6I A;  4EZW A;  4AZB A;  3B53 X;  3I2W A;  4B9Q A;  4HY9 A;  2V0O A;  3T4A G;  4EZR A;  2X3W A;  3DDG A;  2YL9 A;  2ND0 A;  1TQV A;  1URU A;  2OW6 A;  4E3C A;  3O3O B;  3EJU A;  5C5B B;  5TKY A;  3ERC C;  4EZX A;  3C7N A;  1TQS A;  3PLT A;  1I4L A;  4EZV A;  2X3V A;  3O3N B;  2Z0O A;  1E1D A;  4F00 A;  1SU8 A;  3EJP A;  3EJS A;  3CV5 A;  4IM3 A;  1U00 A;  3KDR A;  4KIK B;  4EZU A;  2RAK A;  2F7R A;  1SU7 A;  3HAH A;  1UPX A;  4IWP A;  3D50 A;  4AZG A;  1QWU A;  3VKH A;  4IM2 A;  1HWW A;  3BVX A;  3QNJ A;  3DYT A;  3OHX M;  4JL9 A;  3UIT A;  2JNS A;  3KAV A;  3ZED A;  3D2F A;  2EWF A;  4D8J A;  4FZS A;  2ZXQ A;  4R5I A;  3QE6 A;  3RPM A;  2WYI A;  4FM3 A;  4HYB A;  3I01 A;  2Z0V A;  4AZC B;  4UDY X;  2Z8Y A;  2ND1 A;  2O0I 1;  3DDF A;  4R5G A;  5E84 A;  1ZWW A;  3DX2 A;  4DCN C;  4EZZ A;  1HTY A;  3D2E A;  3DX1 A;  4HR1 A;  2EFK A;  1R33 A;  3SYV A;  3BVU A;  2D4C A;  3CAZ A;  1MJG A;  3L3P A;  4AZH A;  2YIA A;  1TQU A;  2LM0 A;  4ATM A;  4NSW A;  2YKT A;  4H8S A;  3B51 X;  2PMR A;  1Y2O A;  3LMF A;  1ZYL A;  2RAJ A;  3BUQ A;  2YLA A;  4IW0 A;  4H6H A;  2N3K A;  2GF4 A;  4EZN A;  2FYV A;  1GN9 A;  4R5J A;  3DPQ A;  4IM0 A;  1QWN A;  1X04 A;  2OO2 A;  4IWO A;  2OBM A;  4BNE A;  2ALW A;  4JLC A;  3Q84 A;  2Q13 A;  3ER9 B;  4NQI A;  2QFF A;  3D51 A;  2YL6 A;  2F1A A;  3ER8 C;  4E81 A;  1WDZ A;  3M3W A;  4EZS A;  3BUP A;  4AZ6 A;  3G9G A;  1OA0 A;  2YI8 A;  3OK8 A;  3B52 X;  1OA1 A;  3ABH A;  2WYH A;  4R5K A;  4DYL A;  4EZQ A;  2F7Q A;  3OWG A;  3I04 A;  5FLE X;  4UDX X;  3BUB A;  4JWD A;  4AZ5 A;  1I4D A;  4FZP A;  3T49 A;  1SUF A;  5FIG A;  2X5C A;  2YI9 A;  3DX4 A;  3LVT A;  3SOG A;  4NPH A;  1DKY A;  2QKW A;  3DPP A;  2FIC A;  2F7O A;  2WIN M;  4HR1 B;  2Q12 A;  4EZY A;  3BVT A;  3RV0 A;  4EZO A;  3T48 A;  4AKV A;  3EJT A;  3FD9 A;  4JWE A;  1O7D B;  3O3M B;  1I49 A;  1TQW A;  2X3X A;  2ELB A;  3D4Z A;  4AVM A;  1R34 A;  4PO2 A;  2EFL A;  4JWC A;  3VEB A; 
#chains in the Genus database with same CATH homology
 3T46 A;  3GI7 A;  4EZN A;  1W9M A;  1GNT A;  3VKH A;  4IM2 A;  1GN9 A;  4R5J A;  2GA9 D;  4H6H A;  3QNJ A;  3DPQ A;  4IM0 A;  2RT6 A;  4IWO A;  2OBM A;  2YIV X;  3OHX M;  4JL9 A;  1DKZ A;  4JLC A;  2KHO A;  4JN4 A;  3KAW A;  2JNS A;  3UIT A;  3ER9 B;  2QFF A;  4M0M A;  2OBL A;  3KAV A;  3ZED A;  3D2F A;  2EWF A;  4D8J A;  2EX3 B;  3T47 A;  4EZT A;  4R5I A;  3ER8 C;  3I39 X;  4E81 A;  3L3O M;  4EZS A;  4FM3 A;  2PY6 A;  4H6I A;  4HYB A;  3I01 A;  4EZW A;  4B9Q A;  3B53 X;  1OA0 A;  4HY9 A;  2YI8 A;  3VEB A;  4JNE A;  4UDY X;  3B52 X;  1OA1 A;  2Z8Y A;  3T4A G;  4JWI A;  4R5K A;  4EZR A;  4EZQ A;  3OWG A;  2ND1 A;  1E9V A;  3I04 A;  2ND0 A;  5FLE X;  4UDX X;  3DPO A;  4R5G A;  4E3C A;  4IWQ A;  4JWD A;  5E84 A;  1GNL A;  3O3O B;  4EZZ A;  3T49 A;  1SUF A;  2NCZ A;  5TKY A;  3ERC C;  4EZX A;  3C7N A;  1OAO A;  5FIG A;  2X5C A;  3D2E A;  2YI9 A;  4G6Q A;  4HR1 A;  4NPH A;  1DKX A;  1DKY A;  4R5L A;  1SU6 A;  3A98 A;  3DPP A;  4EZV A;  4EZP A;  1MJG A;  2WIN M;  2QXL A;  4HR1 B;  2YIA A;  3RV1 A;  3O3N B;  4JNF A;  4EZY A;  3RV0 A;  3F7W A;  4EZO A;  2LM0 A;  1E1D A;  4F00 A;  1SU8 A;  3T48 A;  4KIK A;  2YIB A;  1E2U A;  3B51 X;  3FD9 A;  4IM3 A;  4JWE A;  1U00 A;  3KDR A;  4KIK B;  3O3M B;  3QA8 A;  4EZU A;  1JQK A;  3LMF A;  4F01 A;  1ZYL A;  3VEA A;  1SU7 A;  4PO2 A;  1UPX A;  4IWP A;  4IW0 A;  4JWC A;  2GAF D;  2N3K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...