2X5CA

Crystal structure of hypothetical protein orf131 from pyrobaculum spherical virus
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
99
structure length
99
Chain Sequence
YKQEYDMAADLVRMLRGLGVFMHAKCPRCGAEGSVSIVETKNGYKYLVIRHPDGGTHTVPKTDISAILKELCEVKKDLEYVLKRYKEYEEEGGVKFCAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords HYPOTHETICAL PROTEIN ORF131
publication title The Scottish Structural Proteomics Facility: Targets, Methods and Outputs.
pubmed doi rcsb
source organism Pyrobaculum spherical virus
total genus 31
structure length 99
sequence length 99
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.200 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 2x5cA01
2X5CA
chains in the Genus database with same CATH superfamily
1TQSA 2O0I1 4F01A 2X5CA 4AVMA 1QX1A 1HWWA 2YLLA 3KAWA 4FZOA 2YKTA 4E3CA 3CAZA 2FICA 4EZOA 4AZGA 4EZXA 4JWIA 2YL5A 2YIBA 2LXYA 2OW6A 3QNIA 4EZPA 4IWPA 4JNEA 3T46A 1JQKA 1O7DB 3DPPA 3RV0A 3D2EA 2YL8A 3CV5A 2X3WA 3BVWA 1ZYLA 4EZNA 2QXLA 2Z8YA 3SOGA 4AZ5A 3B51X 3BVXA 3EJSA 1TQVA 2YL6A 3D2FA 3UITA 1PS3A 2WINM 1GNLA 3OHXM 1WDZA 3D4ZA 5C5BA 1E9VA 2EFKA 2YIAA 3I04A 2KHOA 3QE6A 1OA1A 2Q13A 4HR1A 4WPCA 3ERCC 4JWEA 3T48A 2F1BA 2EX3B 2PY6A 4WPEA 3L3OM 4UDYX 1GNTA 4AZIA 4H8SA 2WYIA 3DYTA 3M3WA 4R5LA 3G9GA 1I49A 1Y2OA 2V0OA 1R33A 3ACOA 2FYVA 2RAIA 2EWFA 1R34A 3T47A 4IWQA 3VKHA 1I4DA 1I4TA 3DX4A 4KIKB 3OWGA 1QWNA 1X04A 2PMRA 3QWEA 4AZCB 3T4AG 1ZWWA 2YL9A 3KDRA 5FLEX 2Z0VA 4NPHA 4AZBA 2GAFD 3D4YA 4IM2A 1YWMA 4NSWA 2YIVX 2F7OA 4IW0A 5TKYA 2OW7A 1I4LA 4AZ6A 3BUDA 4B9QA 3O3OB 3QNJA 3EJRA 4JWDA 4EZVA 4EZSA 4R5IA 2NCZA 4IM0A 1W9MA 4FZSA 1TQTA 1SU8A 4JN4A 3CVRA 4EZZA 2OO2A 4PO2A 4R5GA 2F7RA 4AZHA 2Q12A 4IM3A 2F1AA 3D51A 1TQWA 3B52X 3LVTA 3VEAA 1R5EA 1OA0A 3LMFA 1TQUA 3ZEDA 1SUFA 3D50A 2JNSA 3D52A 1E1DA 4H6IA 2ND0A 3DX3A 4M0MA 3BVTA 2X3VA 4F00A 3LLLA 3HAHA 3RV1A 3BUBA 4JNFA 3FD9A 4HY9A 2F7PA 5C5BB 1DKXA 2ND1A 3SYVA 3BVVA 3C7NA 5KBPA 2ZXQA 1DKZA 3DX0A 5FIGA 3RPMA 2OBLA 2RT6A 3I39X 4FM3A 4EZTA 3L3PA 1SU7A 3EJTA 2MI7A 4I1QA 4E81A 3PLTA 3HAIA 4KIKA 3VEBA 4AZCA 3HAJA 2X3XA 2F18A 4HYBA 4EZQA 2EFLA 1U00A 3DX1A 3Q0KA 3DDGA 3BUIA 2YI8A 2D1LA 4R5JA 3KAVA 2OZNB 3B53X 4IWOA 2ELBA 2N3KA 1UPXA 3T49A 3CZSA 3BLBA 3F7WA 3I2WA 3OK8A 2YLAA 3BUQA 3BVUA 4UDXX 2ALWA 3DX2A 4ATMA 3CKDA 3EJQA 3O3NB 3ABHA 1URUA 1O7DC 1OAOA 3EJUA 3DDFA 2RAJA 1QWUA 4FZPA 2Z0NA 2C08A 4DCNC 4G6QA 3EJPA 4AKVA 4AZ7A 2RAKA 2Z0OA 3CZNA 4EZWA 4EZYA 2QKWA 1MJGA 2YI9A 3ER8C 3BUPA 1SU6A 1HTYA 1HXKA 4DYLA 2OBMA 2QFFA 5E84A 2GA9D 1E2UA 4HR1B 3GI7A 4H6HA 4EZRA 4JWCA 3O3MB 2F7QA 3A98A 1LQ7A 4D8JA 3Q84A 4JLCA 3DPQA 4JL9A 2WYHA 4EZUA 2JNKA 4R5KA 3I01A 4BNEA 3DPOA 1X03A 2D4CA 4NQIA 3QA8A 1DKYA 2LM0A 1GN9A 3ER9B 2GF4A
chains in the Genus database with same CATH topology
1UPXA 3T49A 1SUFA 3L3OM 4UDYX 1GNTA 4F01A 3F7WA 2X5CA 1E1DA 4H6IA 4R5LA 2ND0A 4UDXX 4M0MA 4F00A 3KAWA 3O3NB 4E3CA 3RV1A 2EWFA 4JNFA 3FD9A 4EZOA 4HY9A 4EZXA 4JWIA 3T47A 1OAOA 4IWQA 1DKXA 3VKHA 2YIBA 4KIKB 2ND1A 3OWGA 4G6QA 3C7NA 3T4AG 4EZPA 3KDRA 4IWPA 5FLEX 4JNEA 1DKZA 1JQKA 3T46A 4NPHA 3DPPA 2GAFD 5FIGA 4EZWA 4EZYA 3RV0A 4IM2A 2OBLA 2RT6A 3D2EA 3I39X 4FM3A 1MJGA 2YI9A 4EZTA 1SU7A 2YIVX 3ER8C 1SU6A 4IW0A 5TKYA 1ZYLA 4E81A 4EZNA 4B9QA 2QXLA 4KIKA 2Z8YA 3O3OB 3QNJA 4JWDA 3VEBA 2OBMA 3B51X 4EZVA 4EZSA 2QFFA 5E84A 4R5IA 2GA9D 1E2UA 2NCZA 4HYBA 4HR1B 4IM0A 3GI7A 4EZQA 1U00A 1W9MA 4H6HA 4EZRA 3D2FA 3UITA 4JWCA 3O3MB 2WINM 3A98A 1SU8A 4D8JA 4JN4A 1GNLA 3OHXM 1E9VA 4EZZA 4JLCA 3DPQA 4PO2A 4R5GA 4JL9A 4EZUA 2YI8A 4R5KA 2YIAA 3I01A 3I04A 4R5JA 2KHOA 1OA1A 3KAVA 4IM3A 3DPOA 3ZEDA 4HR1A 3B53X 4IWOA 3QA8A 1DKYA 2LM0A 1GN9A 3ER9B 3ERCC 4JWEA 3T48A 3B52X 2N3KA 2EX3B 3VEAA 1OA0A 3LMFA 2PY6A 2JNSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X5C A; 
#chains in the Genus database with same CATH topology
 1TQS A;  2O0I 1;  4F01 A;  2X5C A;  4AVM A;  1QX1 A;  1HWW A;  2YLL A;  3KAW A;  4FZO A;  2YKT A;  4E3C A;  3CAZ A;  2FIC A;  4EZO A;  4AZG A;  4EZX A;  4JWI A;  2YL5 A;  2YIB A;  2LXY A;  2OW6 A;  3QNI A;  4EZP A;  4IWP A;  4JNE A;  3T46 A;  1JQK A;  1O7D B;  3DPP A;  3RV0 A;  3D2E A;  2YL8 A;  3CV5 A;  2X3W A;  3BVW A;  1ZYL A;  4EZN A;  2QXL A;  2Z8Y A;  3SOG A;  4AZ5 A;  3B51 X;  3BVX A;  3EJS A;  1TQV A;  2YL6 A;  3D2F A;  3UIT A;  1PS3 A;  2WIN M;  1GNL A;  3OHX M;  1WDZ A;  3D4Z A;  5C5B A;  1E9V A;  2EFK A;  2YIA A;  3I04 A;  2KHO A;  3QE6 A;  1OA1 A;  2Q13 A;  4HR1 A;  4WPC A;  3ERC C;  4JWE A;  3T48 A;  2F1B A;  2EX3 B;  2PY6 A;  4WPE A;  3L3O M;  4UDY X;  1GNT A;  4AZI A;  4H8S A;  2WYI A;  3DYT A;  3M3W A;  4R5L A;  3G9G A;  1I49 A;  1Y2O A;  2V0O A;  1R33 A;  3ACO A;  2FYV A;  2RAI A;  2EWF A;  1R34 A;  3T47 A;  4IWQ A;  3VKH A;  1I4D A;  1I4T A;  3DX4 A;  4KIK B;  3OWG A;  1QWN A;  1X04 A;  2PMR A;  3QWE A;  4AZC B;  3T4A G;  1ZWW A;  2YL9 A;  3KDR A;  5FLE X;  2Z0V A;  4NPH A;  4AZB A;  2GAF D;  3D4Y A;  4IM2 A;  1YWM A;  4NSW A;  2YIV X;  2F7O A;  4IW0 A;  5TKY A;  2OW7 A;  1I4L A;  4AZ6 A;  3BUD A;  4B9Q A;  3O3O B;  3QNJ A;  3EJR A;  4JWD A;  4EZV A;  4EZS A;  4R5I A;  2NCZ A;  4IM0 A;  1W9M A;  4FZS A;  1TQT A;  1SU8 A;  4JN4 A;  3CVR A;  4EZZ A;  2OO2 A;  4PO2 A;  4R5G A;  2F7R A;  4AZH A;  2Q12 A;  4IM3 A;  2F1A A;  3D51 A;  1TQW A;  3B52 X;  3LVT A;  3VEA A;  1R5E A;  1OA0 A;  3LMF A;  1TQU A;  3ZED A;  1SUF A;  3D50 A;  2JNS A;  3D52 A;  1E1D A;  4H6I A;  2ND0 A;  3DX3 A;  4M0M A;  3BVT A;  2X3V A;  4F00 A;  3LLL A;  3HAH A;  3RV1 A;  3BUB A;  4JNF A;  3FD9 A;  4HY9 A;  2F7P A;  5C5B B;  1DKX A;  2ND1 A;  3SYV A;  3BVV A;  3C7N A;  5KBP A;  2ZXQ A;  1DKZ A;  3DX0 A;  5FIG A;  3RPM A;  2OBL A;  2RT6 A;  3I39 X;  4FM3 A;  4EZT A;  3L3P A;  1SU7 A;  3EJT A;  2MI7 A;  4I1Q A;  4E81 A;  3PLT A;  3HAI A;  4KIK A;  3VEB A;  4AZC A;  3HAJ A;  2X3X A;  2F18 A;  4HYB A;  4EZQ A;  2EFL A;  1U00 A;  3DX1 A;  3Q0K A;  3DDG A;  3BUI A;  2YI8 A;  2D1L A;  4R5J A;  3KAV A;  2OZN B;  3B53 X;  4IWO A;  2ELB A;  2N3K A;  1UPX A;  3T49 A;  3CZS A;  3BLB A;  3F7W A;  3I2W A;  3OK8 A;  2YLA A;  3BUQ A;  3BVU A;  4UDX X;  2ALW A;  3DX2 A;  4ATM A;  3CKD A;  3EJQ A;  3O3N B;  3ABH A;  1URU A;  1O7D C;  1OAO A;  3EJU A;  3DDF A;  2RAJ A;  1QWU A;  4FZP A;  2Z0N A;  2C08 A;  4DCN C;  4G6Q A;  3EJP A;  4AKV A;  4AZ7 A;  2RAK A;  2Z0O A;  3CZN A;  4EZW A;  4EZY A;  2QKW A;  1MJG A;  2YI9 A;  3ER8 C;  3BUP A;  1SU6 A;  1HTY A;  1HXK A;  4DYL A;  2OBM A;  2QFF A;  5E84 A;  2GA9 D;  1E2U A;  4HR1 B;  3GI7 A;  4H6H A;  4EZR A;  4JWC A;  3O3M B;  2F7Q A;  3A98 A;  1LQ7 A;  4D8J A;  3Q84 A;  4JLC A;  3DPQ A;  4JL9 A;  2WYH A;  4EZU A;  2JNK A;  4R5K A;  3I01 A;  4BNE A;  3DPO A;  1X03 A;  2D4C A;  4NQI A;  3QA8 A;  1DKY A;  2LM0 A;  1GN9 A;  3ER9 B;  2GF4 A; 
#chains in the Genus database with same CATH homology
 1UPX A;  3T49 A;  1SUF A;  3L3O M;  4UDY X;  1GNT A;  4F01 A;  3F7W A;  2X5C A;  1E1D A;  4H6I A;  4R5L A;  2ND0 A;  4UDX X;  4M0M A;  4F00 A;  3KAW A;  3O3N B;  4E3C A;  3RV1 A;  2EWF A;  4JNF A;  3FD9 A;  4EZO A;  4HY9 A;  4EZX A;  4JWI A;  3T47 A;  1OAO A;  4IWQ A;  1DKX A;  3VKH A;  2YIB A;  4KIK B;  2ND1 A;  3OWG A;  4G6Q A;  3C7N A;  3T4A G;  4EZP A;  3KDR A;  4IWP A;  5FLE X;  4JNE A;  1DKZ A;  1JQK A;  3T46 A;  4NPH A;  3DPP A;  2GAF D;  5FIG A;  4EZW A;  4EZY A;  3RV0 A;  4IM2 A;  2OBL A;  2RT6 A;  3D2E A;  3I39 X;  4FM3 A;  1MJG A;  2YI9 A;  4EZT A;  1SU7 A;  2YIV X;  3ER8 C;  1SU6 A;  4IW0 A;  5TKY A;  1ZYL A;  4E81 A;  4EZN A;  4B9Q A;  2QXL A;  4KIK A;  2Z8Y A;  3O3O B;  3QNJ A;  4JWD A;  3VEB A;  2OBM A;  3B51 X;  4EZV A;  4EZS A;  2QFF A;  5E84 A;  4R5I A;  2GA9 D;  1E2U A;  2NCZ A;  4HYB A;  4HR1 B;  4IM0 A;  3GI7 A;  4EZQ A;  1U00 A;  1W9M A;  4H6H A;  4EZR A;  3D2F A;  3UIT A;  4JWC A;  3O3M B;  2WIN M;  3A98 A;  1SU8 A;  4D8J A;  4JN4 A;  1GNL A;  3OHX M;  1E9V A;  4EZZ A;  4JLC A;  3DPQ A;  4PO2 A;  4R5G A;  4JL9 A;  4EZU A;  2YI8 A;  4R5K A;  2YIA A;  3I01 A;  3I04 A;  4R5J A;  2KHO A;  1OA1 A;  3KAV A;  4IM3 A;  3DPO A;  3ZED A;  4HR1 A;  3B53 X;  4IWO A;  3QA8 A;  1DKY A;  2LM0 A;  1GN9 A;  3ER9 B;  3ERC C;  4JWE A;  3T48 A;  3B52 X;  2N3K A;  2EX3 B;  3VEA A;  1OA0 A;  3LMF A;  2PY6 A;  2JNS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...