4ATMA

Crystal structure of the bar domain of human amphiphysin, isoform 1 at 1.8 angstrom resolution featuring increased order at the n- terminus.
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
221
structure length
221
Chain Sequence
RAQEKVLQKLGKADETKDEQFEEYVQNFKRQEAEGTRLQRELRGYLAAIKGMQEASMKLTESLHEVYEPDWYGREDVKMVGEKCDVLWEDFHQKLVDESLLTLDTYLGQFPDIKNRIAKRSRKLVDYDSARHHLEALQSSKRKDESRISKAEEEFQKAQKVFEEFNVDLQEELPSLWSRRVGFYVNTFKNVSSLEAKFHKEIAVLCHKLYEVMTKLGDQHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AMPHIPHYSIN
publication title Crystal Structure of the Bar Domain of Human Amphiphysin, Isoform 1
rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 107
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2012-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03114 BAR BAR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 4atmA00
2ELBA 4H8SA 4BNEA 3QWEA 2RAIA 3HAHA 3QNIA 4FZSA 3ACOA 4AVMA 3OK8A 2Z0OA 2X3XA 2Q12A 3LLLA 3HAJA 2RAKA 1I49A 2Z0NA 1URUA 1ZWWA 2FICA 4WPEA 2X3VA 3SOGA 4NQIA 2V0OA 2YKTA 2D4CA 2X3WA 2EFKA 3ABHA 3G9GA 4AKVA 4ATMA 2Z0VA 4WPCA 4I1QA 1X04A 3CAZA 3I2WA 3SYVA 3Q84A 4DCNC 3M3WA 5C5BB 1I4TA 3PLTA 4NSWA 2Q13A 3Q0KA 1X03A 1I4LA 3HAIA 3QE6A 3DYTA 1I4DA 4DYLA 2RAJA 1Y2OA 2EFLA 1WDZA 2C08A 5C5BA 2D1LA
chains in the Genus database with same CATH superfamily
3BUDA 1U00A 2F1BA 3BUQA 2WINM 2QKWA 3VEBA 3D4YA 1E2UA 4AZ5A 3B51X 4EZTA 3BVVA 3DX3A 3Q84A 1SU8A 2O0I1 4NSWA 5TKYA 3BVWA 1TQVA 4R5GA 4AZIA 1SUFA 3OK8A 1PS3A 3HAJA 2YL8A 3I04A 2YL9A 2YLLA 4IM0A 3G9GA 2LM0A 3KDRA 4I1QA 4D8JA 4AZCA 3EJTA 2JNSA 3DDFA 5C5BA 2ELBA 3B53X 1DKXA 2F1AA 2GF4A 2V0OA 2YKTA 2YI9A 2OBMA 3DX0A 4JNFA 3VKHA 3CAZA 4PO2A 4DCNC 1UPXA 3CZNA 2EX3B 1LQ7A 2D1LA 2LXYA 2Z8YA 2PY6A 3UITA 2FYVA 3F7WA 4ATMA 4AZGA 4UDYX 4AZ6A 3O3OB 1DKZA 3PLTA 2F7RA 3QE6A 2RAJA 2OZNB 1WDZA 4EZXA 4FZSA 3ACOA 4HR1B 5E84A 4HYBA 3KAVA 2MI7A 3EJQA 2QFFA 4AZCB 3ABHA 3CZSA 4EZWA 1TQSA 5C5BB 2PMRA 4F00A 3RV0A 3BLBA 3DPOA 3LMFA 4EZYA 4AZBA 1R5EA 2JNKA 1O7DB 1QWNA 3O3MB 3D4ZA 2YLAA 3T49A 4AZ7A 2ND1A 2F7QA 4IWPA 1HTYA 1YWMA 3EJPA 3EJRA 2F7PA 4F01A 2YL6A 2YI8A 4EZRA 2YIBA 1E9VA 3I01A 2YL5A 3RV1A 1I4TA 1OA1A 1GN9A 3KAWA 1E1DA 4IM2A 3D50A 3ER8C 2F7OA 2GAFD 3QNJA 2Z0NA 1ZWWA 2D4CA 3OWGA 4EZSA 4JL9A 3O3NB 4FM3A 2F18A 3RPMA 2WYHA 1URUA 2FICA 3SOGA 4NPHA 2RT6A 4R5JA 4EZVA 3BUIA 3ERCC 1ZYLA 1SU7A 3M3WA 3Q0KA 1X03A 2ZXQA 1OAOA 3BVTA 3QWEA 2EWFA 4IWQA 2Q12A 1R34A 3VEAA 3D2FA 4JWEA 4EZPA 2X3VA 2OBLA 4KIKA 1SU6A 4JLCA 1X04A 2GA9D 4R5KA 3D2EA 1GNTA 5KBPA 1TQTA 2YIVX 3BVUA 2EFLA 4JWDA 3CV5A 1MJGA 2X3XA 1OA0A 2ALWA 2ND0A 4IW0A 1QX1A 3DX4A 4E81A 3BVXA 3HAIA 3DYTA 4EZQA 3L3OM 3C7NA 3FD9A 3B52X 3D51A 1HXKA 3BUBA 4E3CA 4JWCA 1W9MA 2NCZA 2EFKA 3T46A 1QWUA 3T47A 4WPCA 5FIGA 3GI7A 4B9QA 3DX2A 2C08A 4FZPA 4JN4A 3LLLA 4R5IA 2N3KA 4KIKB 3ZEDA 2OW7A 3QA8A 4H6HA 4NQIA 4HR1A 2X3WA 4G6QA 4AKVA 4AZHA 1DKYA 4EZZA 2QXLA 4EZOA 3T4AG 1I4LA 3LVTA 1TQUA 2WYIA 4FZOA 4DYLA 2RAIA 3CVRA 3DX1A 4H8SA 1TQWA 4UDXX 3L3PA 2X5CA 4EZNA 4HY9A 3D52A 3DPPA 4EZUA 4JNEA 2OW6A 4H6IA 3BUPA 3EJUA 3T48A 3QNIA 4AVMA 2Z0OA 3I39X 3ER9B 2RAKA 3EJSA 3DDGA 2OO2A 5FLEX 2Z0VA 3I2WA 3DPQA 4M0MA 2YIAA 1O7DC 1I4DA 4BNEA 1HWWA 3HAHA 4R5LA 3CKDA 3A98A 1I49A 4IM3A 4JWIA 1JQKA 2KHOA 4WPEA 4IWOA 1GNLA 3SYVA 3OHXM 2Q13A 1R33A 1Y2OA
chains in the Genus database with same CATH topology
2ELBA 4H8SA 4BNEA 3QWEA 2RAIA 3HAHA 3QNIA 4FZSA 3ACOA 4AVMA 3OK8A 2Z0OA 2X3XA 2Q12A 3LLLA 3HAJA 2RAKA 1I49A 2Z0NA 1URUA 1ZWWA 2FICA 4WPEA 2X3VA 3SOGA 4NQIA 2V0OA 2YKTA 2D4CA 2X3WA 2EFKA 3ABHA 3G9GA 4AKVA 4ATMA 2Z0VA 4WPCA 4I1QA 1X04A 3CAZA 3I2WA 3SYVA 3Q84A 4DCNC 3M3WA 5C5BB 1I4TA 3PLTA 4NSWA 2Q13A 3Q0KA 1X03A 1I4LA 3HAIA 3QE6A 3DYTA 1I4DA 4DYLA 2RAJA 1Y2OA 2EFLA 1WDZA 2C08A 5C5BA 2D1LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ELB A;  4H8S A;  4BNE A;  3QWE A;  2RAI A;  3HAH A;  3QNI A;  4FZS A;  3ACO A;  4AVM A;  3OK8 A;  2Z0O A;  2X3X A;  2Q12 A;  3LLL A;  3HAJ A;  2RAK A;  1I49 A;  2Z0N A;  1URU A;  1ZWW A;  2FIC A;  4WPE A;  2X3V A;  3SOG A;  4NQI A;  2V0O A;  2YKT A;  2D4C A;  2X3W A;  2EFK A;  3ABH A;  3G9G A;  4AKV A;  4ATM A;  2Z0V A;  4WPC A;  4I1Q A;  1X04 A;  3CAZ A;  3I2W A;  3SYV A;  3Q84 A;  4DCN C;  3M3W A;  5C5B B;  1I4T A;  3PLT A;  4NSW A;  2Q13 A;  3Q0K A;  1X03 A;  1I4L A;  3HAI A;  3QE6 A;  3DYT A;  1I4D A;  4DYL A;  2RAJ A;  1Y2O A;  2EFL A;  1WDZ A;  2C08 A;  5C5B A;  2D1L A; 
#chains in the Genus database with same CATH topology
 3BUD A;  1U00 A;  2F1B A;  3BUQ A;  2WIN M;  2QKW A;  3VEB A;  3D4Y A;  1E2U A;  4AZ5 A;  3B51 X;  4EZT A;  3BVV A;  3DX3 A;  3Q84 A;  1SU8 A;  2O0I 1;  4NSW A;  5TKY A;  3BVW A;  1TQV A;  4R5G A;  4AZI A;  1SUF A;  3OK8 A;  1PS3 A;  3HAJ A;  2YL8 A;  3I04 A;  2YL9 A;  2YLL A;  4IM0 A;  3G9G A;  2LM0 A;  3KDR A;  4I1Q A;  4D8J A;  4AZC A;  3EJT A;  2JNS A;  3DDF A;  5C5B A;  2ELB A;  3B53 X;  1DKX A;  2F1A A;  2GF4 A;  2V0O A;  2YKT A;  2YI9 A;  2OBM A;  3DX0 A;  4JNF A;  3VKH A;  3CAZ A;  4PO2 A;  4DCN C;  1UPX A;  3CZN A;  2EX3 B;  1LQ7 A;  2D1L A;  2LXY A;  2Z8Y A;  2PY6 A;  3UIT A;  2FYV A;  3F7W A;  4ATM A;  4AZG A;  4UDY X;  4AZ6 A;  3O3O B;  1DKZ A;  3PLT A;  2F7R A;  3QE6 A;  2RAJ A;  2OZN B;  1WDZ A;  4EZX A;  4FZS A;  3ACO A;  4HR1 B;  5E84 A;  4HYB A;  3KAV A;  2MI7 A;  3EJQ A;  2QFF A;  4AZC B;  3ABH A;  3CZS A;  4EZW A;  1TQS A;  5C5B B;  2PMR A;  4F00 A;  3RV0 A;  3BLB A;  3DPO A;  3LMF A;  4EZY A;  4AZB A;  1R5E A;  2JNK A;  1O7D B;  1QWN A;  3O3M B;  3D4Z A;  2YLA A;  3T49 A;  4AZ7 A;  2ND1 A;  2F7Q A;  4IWP A;  1HTY A;  1YWM A;  3EJP A;  3EJR A;  2F7P A;  4F01 A;  2YL6 A;  2YI8 A;  4EZR A;  2YIB A;  1E9V A;  3I01 A;  2YL5 A;  3RV1 A;  1I4T A;  1OA1 A;  1GN9 A;  3KAW A;  1E1D A;  4IM2 A;  3D50 A;  3ER8 C;  2F7O A;  2GAF D;  3QNJ A;  2Z0N A;  1ZWW A;  2D4C A;  3OWG A;  4EZS A;  4JL9 A;  3O3N B;  4FM3 A;  2F18 A;  3RPM A;  2WYH A;  1URU A;  2FIC A;  3SOG A;  4NPH A;  2RT6 A;  4R5J A;  4EZV A;  3BUI A;  3ERC C;  1ZYL A;  1SU7 A;  3M3W A;  3Q0K A;  1X03 A;  2ZXQ A;  1OAO A;  3BVT A;  3QWE A;  2EWF A;  4IWQ A;  2Q12 A;  1R34 A;  3VEA A;  3D2F A;  4JWE A;  4EZP A;  2X3V A;  2OBL A;  4KIK A;  1SU6 A;  4JLC A;  1X04 A;  2GA9 D;  4R5K A;  3D2E A;  1GNT A;  5KBP A;  1TQT A;  2YIV X;  3BVU A;  2EFL A;  4JWD A;  3CV5 A;  1MJG A;  2X3X A;  1OA0 A;  2ALW A;  2ND0 A;  4IW0 A;  1QX1 A;  3DX4 A;  4E81 A;  3BVX A;  3HAI A;  3DYT A;  4EZQ A;  3L3O M;  3C7N A;  3FD9 A;  3B52 X;  3D51 A;  1HXK A;  3BUB A;  4E3C A;  4JWC A;  1W9M A;  2NCZ A;  2EFK A;  3T46 A;  1QWU A;  3T47 A;  4WPC A;  5FIG A;  3GI7 A;  4B9Q A;  3DX2 A;  2C08 A;  4FZP A;  4JN4 A;  3LLL A;  4R5I A;  2N3K A;  4KIK B;  3ZED A;  2OW7 A;  3QA8 A;  4H6H A;  4NQI A;  4HR1 A;  2X3W A;  4G6Q A;  4AKV A;  4AZH A;  1DKY A;  4EZZ A;  2QXL A;  4EZO A;  3T4A G;  1I4L A;  3LVT A;  1TQU A;  2WYI A;  4FZO A;  4DYL A;  2RAI A;  3CVR A;  3DX1 A;  4H8S A;  1TQW A;  4UDX X;  3L3P A;  2X5C A;  4EZN A;  4HY9 A;  3D52 A;  3DPP A;  4EZU A;  4JNE A;  2OW6 A;  4H6I A;  3BUP A;  3EJU A;  3T48 A;  3QNI A;  4AVM A;  2Z0O A;  3I39 X;  3ER9 B;  2RAK A;  3EJS A;  3DDG A;  2OO2 A;  5FLE X;  2Z0V A;  3I2W A;  3DPQ A;  4M0M A;  2YIA A;  1O7D C;  1I4D A;  4BNE A;  1HWW A;  3HAH A;  4R5L A;  3CKD A;  3A98 A;  1I49 A;  4IM3 A;  4JWI A;  1JQK A;  2KHO A;  4WPE A;  4IWO A;  1GNL A;  3SYV A;  3OHX M;  2Q13 A;  1R33 A;  1Y2O A; 
#chains in the Genus database with same CATH homology
 2ELB A;  4H8S A;  4BNE A;  3QWE A;  2RAI A;  3HAH A;  3QNI A;  4FZS A;  3ACO A;  4AVM A;  3OK8 A;  2Z0O A;  2X3X A;  2Q12 A;  3LLL A;  3HAJ A;  2RAK A;  1I49 A;  2Z0N A;  1URU A;  1ZWW A;  2FIC A;  4WPE A;  2X3V A;  3SOG A;  4NQI A;  2V0O A;  2YKT A;  2D4C A;  2X3W A;  2EFK A;  3ABH A;  3G9G A;  4AKV A;  4ATM A;  2Z0V A;  4WPC A;  4I1Q A;  1X04 A;  3CAZ A;  3I2W A;  3SYV A;  3Q84 A;  4DCN C;  3M3W A;  5C5B B;  1I4T A;  3PLT A;  4NSW A;  2Q13 A;  3Q0K A;  1X03 A;  1I4L A;  3HAI A;  3QE6 A;  3DYT A;  1I4D A;  4DYL A;  2RAJ A;  1Y2O A;  2EFL A;  1WDZ A;  2C08 A;  5C5B A;  2D1L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...