4ATMA

Crystal structure of the bar domain of human amphiphysin, isoform 1 at 1.8 angstrom resolution featuring increased order at the n- terminus.
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
221
structure length
221
Chain Sequence
RAQEKVLQKLGKADETKDEQFEEYVQNFKRQEAEGTRLQRELRGYLAAIKGMQEASMKLTESLHEVYEPDWYGREDVKMVGEKCDVLWEDFHQKLVDESLLTLDTYLGQFPDIKNRIAKRSRKLVDYDSARHHLEALQSSKRKDESRISKAEEEFQKAQKVFEEFNVDLQEELPSLWSRRVGFYVNTFKNVSSLEAKFHKEIAVLCHKLYEVMTKLGDQHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords AMPHIPHYSIN
publication title Crystal Structure of the Bar Domain of Human Amphiphysin, Isoform 1
rcsb
source organism Homo sapiens
total genus 107
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2012-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03114 BAR BAR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 4atmA00
3HAIA 3HAHA 2C08A 1Y2OA 2Z0VA 4AKVA 2Z0NA 3OK8A 3SYVA 4DYLA 3SOGA 2X3WA 1X04A 4DCNC 4WPCA 4NQIA 2ELBA 4NSWA 1URUA 2RAIA 2D4CA 4I1QA 2X3XA 3LLLA 2Z0OA 3Q0KA 2EFLA 4FZSA 1I4DA 4H8SA 3M3WA 2D1LA 1I4LA 1I49A 5C5BB 4AVMA 2V0OA 3PLTA 4BNEA 2EFKA 2FICA 3Q84A 3G9GA 3CAZA 4ATMA 2Q13A 2X3VA 3ABHA 2YKTA 3QNIA 1WDZA 4WPEA 3HAJA 3I2WA 2RAKA 1ZWWA 1I4TA 2RAJA 3QWEA 3QE6A 5C5BA 1X03A 2Q12A 3ACOA 3DYTA
chains in the Genus database with same CATH superfamily
2EX3B 2ALWA 4DYLA 2F7RA 1X04A 3CZNA 1O7DB 3BVVA 2Z0OA 1W9MA 2EFLA 4EZXA 1I4LA 3BUBA 4IM0A 4UDXX 3D50A 3L3PA 3LVTA 1LQ7A 2YL8A 1E9VA 1E2UA 4H8SA 1SU6A 2NCZA 4EZPA 2YIAA 3OK8A 2JNSA 4AZ6A 3BUPA 2D1LA 2YKTA 2GA9D 1I4TA 3KDRA 2RAJA 3DX3A 4AZCB 1R34A 2Z0VA 3QNJA 1HWWA 3BVUA 4NSWA 3EJSA 1GNLA 4EZVA 4JNEA 2YIBA 4R5GA 3Q84A 2Q13A 1WDZA 2ZXQA 4IM3A 3BVTA 2OBLA 4EZRA 4JN4A 4M0MA 1OA1A 3LMFA 5FIGA 3T49A 4H6HA 4IWOA 1TQUA 1TQWA 3UITA 1U00A 4E3CA 3A98A 2WINM 3I2WA 1ZWWA 1E1DA 4JWCA 4HR1A 2OO2A 2PY6A 2F1BA 3RV0A 3EJPA 4PO2A 2ELBA 4E81A 2X3XA 2F1AA 4G6QA 1I49A 5C5BB 2V0OA 1OAOA 3DX4A 2FICA 3OHXM 2YL5A 3KAWA 5TKYA 4JWIA 2Q12A 4KIKB 2YIVX 3D2EA 2OW7A 3F7WA 1TQSA 3B53X 5KBPA 4ATMA 3D4YA 2RAKA 3OWGA 4AZ5A 4EZYA 1DKYA 3VEAA 3T46A 4JWDA 4D8JA 4JL9A 2YL6A 1SUFA 1QWNA 4WPCA 1URUA 2F7OA 1UPXA 2MI7A 3CZSA 4AZCA 2WYIA 2WYHA 1OA0A 2OZNB 2F7PA 3O3NB 3HAHA 1GNTA 1TQVA 1MJGA 2C08A 1Y2OA 2Z0NA 4EZNA 2ND0A 4F00A 3Q0KA 3VEBA 4FZSA 4NPHA 3O3OB 2YLAA 4JLCA 4AZBA 3ER8C 3D2FA 4R5LA 3RPMA 3QA8A 4EZTA 3ER9B 4AZ7A 2QXLA 4FZPA 4FM3A 4AKVA 2OBMA 2X3WA 3LLLA 3BVWA 1I4DA 2GAFD 2LM0A 4AVMA 2X5CA 3G9GA 3RV1A 3GI7A 2YL9A 2JNKA 3QWEA 5C5BA 2Z8YA 1DKZA 4EZUA 4R5IA 4I1QA 2D4CA 4KIKA 2QKWA 3EJQA 5FLEX 4EZOA 3PLTA 1JQKA 1SU8A 2YLLA 3DPPA 4EZQA 4IW0A 4JNFA 2O0I1 3BUQA 5E84A 3EJRA 3CV5A 3KAVA 4HY9A 2EWFA 1HXKA 3I39X 4NQIA 2GF4A 3B52X 2LXYA 2N3KA 3DPQA 4R5KA 2EFKA 4JWEA 3HAJA 1DKXA 1QX1A 3C7NA 3DYTA 4IM2A 4B9QA 4HYBA 4IWPA 4DCNC 1GN9A 3BVXA 3FD9A 4AZHA 3L3OM 3ABHA 3DDGA 3B51X 3ZEDA 1ZYLA 3D52A 3HAIA 4UDYX 4H6IA 1TQTA 3T47A 4EZWA 2KHOA 2RAIA 1SU7A 3M3WA 4BNEA 3I01A 2F7QA 4FZOA 3DPOA 3ACOA 2FYVA 4EZZA 3O3MB 4AZIA 2RT6A 2YI8A 3EJTA 2PMRA 1YWMA 1R5EA 1HTYA 3BUIA 1QWUA 3CAZA 3QNIA 3BUDA 1X03A 3DX0A 3VKHA 4EZSA 3SOGA 2OW6A 1O7DC 2QFFA 4F01A 4R5JA 3CKDA 3T4AG 4WPEA 2ND1A 1R33A 2F18A 3QE6A 4AZGA 2X3VA 3ERCC 3D4ZA 3SYVA 2YI9A 3DDFA 3EJUA 3DX2A 3D51A 4IWQA 3I04A 3DX1A 1PS3A 3BLBA 4HR1B 3CVRA 3T48A
chains in the Genus database with same CATH topology
3HAIA 3HAHA 2C08A 1Y2OA 2Z0VA 4AKVA 2Z0NA 3OK8A 3SYVA 4DYLA 3SOGA 2X3WA 1X04A 4DCNC 4WPCA 4NQIA 2ELBA 4NSWA 1URUA 2RAIA 2D4CA 4I1QA 2X3XA 3LLLA 2Z0OA 3Q0KA 2EFLA 4FZSA 1I4DA 4H8SA 3M3WA 2D1LA 1I4LA 1I49A 5C5BB 4AVMA 2V0OA 3PLTA 4BNEA 2EFKA 2FICA 3Q84A 3G9GA 3CAZA 4ATMA 2Q13A 2X3VA 3ABHA 2YKTA 3QNIA 1WDZA 4WPEA 3HAJA 3I2WA 2RAKA 1ZWWA 1I4TA 2RAJA 3QWEA 3QE6A 5C5BA 1X03A 2Q12A 3ACOA 3DYTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HAI A;  3HAH A;  2C08 A;  1Y2O A;  2Z0V A;  4AKV A;  2Z0N A;  3OK8 A;  3SYV A;  4DYL A;  3SOG A;  2X3W A;  1X04 A;  4DCN C;  4WPC A;  4NQI A;  2ELB A;  4NSW A;  1URU A;  2RAI A;  2D4C A;  4I1Q A;  2X3X A;  3LLL A;  2Z0O A;  3Q0K A;  2EFL A;  4FZS A;  1I4D A;  4H8S A;  3M3W A;  2D1L A;  1I4L A;  1I49 A;  5C5B B;  4AVM A;  2V0O A;  3PLT A;  4BNE A;  2EFK A;  2FIC A;  3Q84 A;  3G9G A;  3CAZ A;  4ATM A;  2Q13 A;  2X3V A;  3ABH A;  2YKT A;  3QNI A;  1WDZ A;  4WPE A;  3HAJ A;  3I2W A;  2RAK A;  1ZWW A;  1I4T A;  2RAJ A;  3QWE A;  3QE6 A;  5C5B A;  1X03 A;  2Q12 A;  3ACO A;  3DYT A; 
#chains in the Genus database with same CATH topology
 2EX3 B;  2ALW A;  4DYL A;  2F7R A;  1X04 A;  3CZN A;  1O7D B;  3BVV A;  2Z0O A;  1W9M A;  2EFL A;  4EZX A;  1I4L A;  3BUB A;  4IM0 A;  4UDX X;  3D50 A;  3L3P A;  3LVT A;  1LQ7 A;  2YL8 A;  1E9V A;  1E2U A;  4H8S A;  1SU6 A;  2NCZ A;  4EZP A;  2YIA A;  3OK8 A;  2JNS A;  4AZ6 A;  3BUP A;  2D1L A;  2YKT A;  2GA9 D;  1I4T A;  3KDR A;  2RAJ A;  3DX3 A;  4AZC B;  1R34 A;  2Z0V A;  3QNJ A;  1HWW A;  3BVU A;  4NSW A;  3EJS A;  1GNL A;  4EZV A;  4JNE A;  2YIB A;  4R5G A;  3Q84 A;  2Q13 A;  1WDZ A;  2ZXQ A;  4IM3 A;  3BVT A;  2OBL A;  4EZR A;  4JN4 A;  4M0M A;  1OA1 A;  3LMF A;  5FIG A;  3T49 A;  4H6H A;  4IWO A;  1TQU A;  1TQW A;  3UIT A;  1U00 A;  4E3C A;  3A98 A;  2WIN M;  3I2W A;  1ZWW A;  1E1D A;  4JWC A;  4HR1 A;  2OO2 A;  2PY6 A;  2F1B A;  3RV0 A;  3EJP A;  4PO2 A;  2ELB A;  4E81 A;  2X3X A;  2F1A A;  4G6Q A;  1I49 A;  5C5B B;  2V0O A;  1OAO A;  3DX4 A;  2FIC A;  3OHX M;  2YL5 A;  3KAW A;  5TKY A;  4JWI A;  2Q12 A;  4KIK B;  2YIV X;  3D2E A;  2OW7 A;  3F7W A;  1TQS A;  3B53 X;  5KBP A;  4ATM A;  3D4Y A;  2RAK A;  3OWG A;  4AZ5 A;  4EZY A;  1DKY A;  3VEA A;  3T46 A;  4JWD A;  4D8J A;  4JL9 A;  2YL6 A;  1SUF A;  1QWN A;  4WPC A;  1URU A;  2F7O A;  1UPX A;  2MI7 A;  3CZS A;  4AZC A;  2WYI A;  2WYH A;  1OA0 A;  2OZN B;  2F7P A;  3O3N B;  3HAH A;  1GNT A;  1TQV A;  1MJG A;  2C08 A;  1Y2O A;  2Z0N A;  4EZN A;  2ND0 A;  4F00 A;  3Q0K A;  3VEB A;  4FZS A;  4NPH A;  3O3O B;  2YLA A;  4JLC A;  4AZB A;  3ER8 C;  3D2F A;  4R5L A;  3RPM A;  3QA8 A;  4EZT A;  3ER9 B;  4AZ7 A;  2QXL A;  4FZP A;  4FM3 A;  4AKV A;  2OBM A;  2X3W A;  3LLL A;  3BVW A;  1I4D A;  2GAF D;  2LM0 A;  4AVM A;  2X5C A;  3G9G A;  3RV1 A;  3GI7 A;  2YL9 A;  2JNK A;  3QWE A;  5C5B A;  2Z8Y A;  1DKZ A;  4EZU A;  4R5I A;  4I1Q A;  2D4C A;  4KIK A;  2QKW A;  3EJQ A;  5FLE X;  4EZO A;  3PLT A;  1JQK A;  1SU8 A;  2YLL A;  3DPP A;  4EZQ A;  4IW0 A;  4JNF A;  2O0I 1;  3BUQ A;  5E84 A;  3EJR A;  3CV5 A;  3KAV A;  4HY9 A;  2EWF A;  1HXK A;  3I39 X;  4NQI A;  2GF4 A;  3B52 X;  2LXY A;  2N3K A;  3DPQ A;  4R5K A;  2EFK A;  4JWE A;  3HAJ A;  1DKX A;  1QX1 A;  3C7N A;  3DYT A;  4IM2 A;  4B9Q A;  4HYB A;  4IWP A;  4DCN C;  1GN9 A;  3BVX A;  3FD9 A;  4AZH A;  3L3O M;  3ABH A;  3DDG A;  3B51 X;  3ZED A;  1ZYL A;  3D52 A;  3HAI A;  4UDY X;  4H6I A;  1TQT A;  3T47 A;  4EZW A;  2KHO A;  2RAI A;  1SU7 A;  3M3W A;  4BNE A;  3I01 A;  2F7Q A;  4FZO A;  3DPO A;  3ACO A;  2FYV A;  4EZZ A;  3O3M B;  4AZI A;  2RT6 A;  2YI8 A;  3EJT A;  2PMR A;  1YWM A;  1R5E A;  1HTY A;  3BUI A;  1QWU A;  3CAZ A;  3QNI A;  3BUD A;  1X03 A;  3DX0 A;  3VKH A;  4EZS A;  3SOG A;  2OW6 A;  1O7D C;  2QFF A;  4F01 A;  4R5J A;  3CKD A;  3T4A G;  4WPE A;  2ND1 A;  1R33 A;  2F18 A;  3QE6 A;  4AZG A;  2X3V A;  3ERC C;  3D4Z A;  3SYV A;  2YI9 A;  3DDF A;  3EJU A;  3DX2 A;  3D51 A;  4IWQ A;  3I04 A;  3DX1 A;  1PS3 A;  3BLB A;  4HR1 B;  3CVR A;  3T48 A; 
#chains in the Genus database with same CATH homology
 3HAI A;  3HAH A;  2C08 A;  1Y2O A;  2Z0V A;  4AKV A;  2Z0N A;  3OK8 A;  3SYV A;  4DYL A;  3SOG A;  2X3W A;  1X04 A;  4DCN C;  4WPC A;  4NQI A;  2ELB A;  4NSW A;  1URU A;  2RAI A;  2D4C A;  4I1Q A;  2X3X A;  3LLL A;  2Z0O A;  3Q0K A;  2EFL A;  4FZS A;  1I4D A;  4H8S A;  3M3W A;  2D1L A;  1I4L A;  1I49 A;  5C5B B;  4AVM A;  2V0O A;  3PLT A;  4BNE A;  2EFK A;  2FIC A;  3Q84 A;  3G9G A;  3CAZ A;  4ATM A;  2Q13 A;  2X3V A;  3ABH A;  2YKT A;  3QNI A;  1WDZ A;  4WPE A;  3HAJ A;  3I2W A;  2RAK A;  1ZWW A;  1I4T A;  2RAJ A;  3QWE A;  3QE6 A;  5C5B A;  1X03 A;  2Q12 A;  3ACO A;  3DYT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...