3O3NB

(r)-2-hydroxyisocaproyl-coa dehydratase in complex with its substrate (r)-2-hydroxyisocaproyl-coa
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
374
structure length
374
Chain Sequence
MEAILSKMKEVVENPNAAVKKYKSETGKKAIGCFPVYCPEEIIHAAGMLPVGIWGGQTELDLAKQYFPAFACSIMQSCLEYGLKGAYDELSGVIIPGMCDTLICLGQNWKSAVPHIKYISLVHPQNRKLEAGVKYLISEYKGVKRELEEICGYEIEEAKIHESIEVYNEHRKTMRDFVEVAYKHSNTIKPSIRSLVIKSGFFMRKEEHTELVKDLIAKLNAMPEEVCSGKKVLLTGILADSKDILDILEDNNISVVADDLAQETRQFRTDVPAGDDALERLARQWSNIEGCSLAYDPKKKRGSLIVDEVKKKDIDGVIFCMMKFCDPEEYDYPLVRKDIEDSGIPTLYVEIDQQTQNNEQARTRIQTFAEMMSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Reductive Radical Formation and Electron Recycling in (R)-2-Hydroxyisocaproyl-CoA Dehydratase.
pubmed doi rcsb
source organism Clostridium difficile
molecule tags Lyase
molecule keywords alpha-subunit 2-hydroxyisocaproyl-CoA dehydratase
total genus 156
structure length 374
sequence length 374
chains with identical sequence D
ec nomenclature ec 4.2.1.157: (R)-2-hydroxyisocaproyl-CoA dehydratase.
pdb deposition date 2010-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06050 HGD-D 2-hydroxyglutaryl-CoA dehydratase, D-component
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.370 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3o3nB01
3.40.50.11890 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3o3nB02
3.40.50.11900 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3o3nB03
3O3OB 3O3NB 3O3MB
chains in the Genus database with same CATH superfamily
4ZT6A 1LGYA 1KNQA 1MJ5A 3ME5A 1GZUA 4PTZA 4EB8A 3M1AA 1EP1B 3UN1A 2Z98A 3ZJVA 1UXIA 5EMHA 4HK4A 3RS0A 4D8UA 1L7QA 1V0JA 1KE1A 4BNUA 3RV1A 3GPLA 1WIWA 2CYCA 1RKQA 4KYIB 5HCUA 2ORIA 1MB0A 1QMPA 2OFPA 4HAYA 4W82A 3ZWWA 4CVNA 4D4JA 4JWKA 3NHYA 5CFNA 1CLEA 2XUGA 2YS6A 3GLIB 2PHZA 3H9EO 4J0QA 3FCYA 2WFLA 3WG9A 4JLAA 2VEDA 4DWJA 5EZQA 6CHYA 3HCRA 4ZVMA 4ZI3A 1MO5A 1RRCA 4KODA 4I2NA 1FJ2A 2H48A 3F9CA 3JYNA 4W7SA 1A9YA 1J8QA 3T1YB 1XWWA 4ZVKA 3GBSA 1IPEA 2YV5A 1MAUA 4KLRA 2VJCA 4GMXA 5KJCA 4YI5A 3WK8A 4E7PA 1UXKA 2PQMA 4CKBA 3FD9A 2JJMA 2PZLA 3D81A 4F3NA 3VVBA 1TTTA 4IYJA 2WU3A 2YICA 3B13B 5EUQB 5EZYB 3ROMA 3PC8C 5EMMA 1QWSA 3MAAC 3WBJA 4BVJA 1C9EA 2W8BA 4HBGA 4R1UA 3U80A 3HY3A 1D2CA 3BL6A 1IY0A 1ZINA 2Q0SA 2GPSA 3FYUC 1KGSA 4JLCA 3G2OA 3IMCA 1VLZA 5D3MA 2PBLA 2E9SA 3IJRA 1KYTA 3NFYA 1PZHA 4Q3CA 3KDPA 3TX6A 2QUJA 1POXA 1E5XA 4HXYA 3VBCA 3NASA 1H8HD 3A36A 1ILEA 4Z8YA 2E37A 1JDNA 1P7PA 2SNIE 4JVOA 4PZYA 5A5EA 1A7AA 2WB2A 2VJMA 3LXMA 1GPAA 3TTYA 3V34A 4P4GA 5BNWA 1N2CB 5AI4A 1E2GA 3ZQ4A 4JV5B 5FFMA 3DLHA 5ICEA 1GUDA 2QTNA 2C58A 1USKA 1XZDA 4GKAA 1XG5A 4PBTA 4E5PA 3OE4A 4JUCA 4KO2S 3F7OA 4HEA1 3MW8A 2GD2A 2AFHE 3SJBA 2KW5A 3BWVA 3WICA 1CF4A 1R16A 2DFDA 1S1CA 3P2JA 3WOVA 5BSKA 3NBKA 3GAFA 3RSFA 5BSWA 2RG1A 1GFWA 2FETA 1ST3A 4BJ5A 4DQ0A 2CC2A 3VTFA 3JRNA 3O47A 3SF8B 1BEZA 4M87A 4R01A 4OXXA 4M8IA 4G5YA 1Y3CE 1DAHA 3O0DA 4NAVA 1XTRA 1MNAA 5B6JA 3QTLA 1JH9A 1NVVQ 2DR0A 2O1EA 3K7EA 3H99A 4XEUA 2ASEA 3PF9A 5D5PA 5JALA 3D6JA 2BMFA 3HA2A 1DQSA 1N2CE 1G8PA 4ZWNA 2HJ9A 4DILA 3R7WA 1XZBA 2PX2A 3IVMA 3D5TA 2OCDA 2GA9D 1P7CA 5G02A 3E9EA 2BTEA 2MDTA 1RE0A 4BLWA 1XXHB 1N5JA 5LR6A 1LDMA 2A86A 1IH8A 2X19A 1LV7A 3EMDA 3P52A 2HEGA 5EQJB 1LSJA 1PZEA 3DMFA 4L7QA 4QG7A 5AH0A 3SEZA 3C3EA 1R7RA 1K97A 1TFUA 1I4WA 1P33A 3ZKWB 1K88A 1LNZA 2O6LA 5CLGA 2H2DA 3LBNA 4GRDA 4DM4A 2ORED 1RHRA 1SQ0A 4HGRA 3F1KA 2EZ9A 3L1UA 4HOYA 3VC1A 4RBNA 1KPGA 4Q12A 4IXWA 4TYMA 1CUDA 1U04A 3A28A 4CJXA 2BEVA 1SN7A 1E6WA 1YZQA 1F2UA 4L3VA 1UIMA 4FDMA 1N7HA 4GPAA 2M1ZA 2RB5A 5CYGA 2R97A 4AJ4A 3EGWA 3S2SA 4AXBA 2CNOA 3FETA 1SCJA 4ARIA 2IYTA 4QYMA 4AIIA 2JIRA 2CJYA 3AUTA 3HDTA 5D2CA 5K1ZA 2ZRQA 4I5IA 2P91A 1P0FA 2JKYA 3AB8A 1Z5PA 5TLSA 1JQ5A 4RF4A 1QNLA 3P9ZA 4L4YA 5DHUA 2XWSA 2A9KA 1CEYA 1CRZA 1F51E 1SU8A 3BE6A 1JMYA 1KU0A 3ADKA 2VZ8A 3M4JA 1C7EA 1GHTA 1QQTA 1DXOA 3O1IC 4IV0A 4MW6A 1NF8A 3JSAA 3TDKA 3OEYA 5JSUA 2FUG1 3M5PA 4ENSA 4B32A 1FUYB 4JY7A 4TSKA 3R6LA 2NOAA 2AD5A 3JYOA 2WYHA 2JCXA 1V5EA 2LVBA 2OPBA 4IUYA 4D0RA 2EHJA 1AU9A 1CP2A 3QIVA 3HDGA 3K9GA 4YONB 2FP4B 3QPUA 1IUKA 2WEKA 5JAMA 1JLHA 4UFOA 5JTUA 2PM8A 2A14A 3U49A 2HA5A 1R2QA 3C3DA 4L9AA 4ZTZB 5CDFE 1U0EA 2PO7A 5BURA 3QPCA 5CXXA 1YCDA 3HBLA 3WLKX 1M6VB 2XMDA 4B3XA 2IU6A 1KC3A 3EWAA 3MOIA 5AIBA 3NTRA 3NO4A 1ELOA 1UCFA 3HVHA 4OH7A 4YMIA 1Q74A 5FNVA 3EJQA 2C9CA 3IBCA 4K88A 2B69A 4UEWA 2BEWB 1PKXA 3NANA 4ACBA 5IPFA 1RFGE 1SK9A 1OBFO 1T0PA 3FVVA 4DDKA 1C1DB 1ZIDA 2W6CX 2HO4A 2V03A 3ICCA 4MPPA 2A4KA 3E35A 4WRRA 2FX5A 3QEBZ 1NLUA 4PU0A 4GPTA 2JAQA 3VTZA 3W05A 2ODAA 4TM7A 1G21E 1KFKB 5ARBA 4DLKA 1X7XB 4RH1A 1HK7A 2VDKB 4RJLA 3BGWA 1NFRA 3LUFA 4DQKA 4TQUS 3WR5A 2R79A 5LFAA 4RQAA 2IWRA 4XD7A 2XLBA 3UJPA 3VTKA 5AK4A 4B3JA 5J5VA 4Z4QA 2IZOA 2VXOA 2X5XA 3L9XA 4PIVA 4FB5A 2DFPA 3DT6A 4OX9B 2OLEA 2Q8PA 2EW1A 3D6VA 2OMEA 1GPDG 4G1CA 4RTRA 3DX4A 3AI2A 3ITEA 4XD2A 3UQYS 1G20E 2Q1WA 4KPUB 2I55A 4L5BA 4U2CA 3WB2A 3MTEA 1UDCA 3HU1A 3FCCA 4XVCA 1L1RA 2ZRIA 1Z6XA 3RUPA 5I7VA 1GRRA 1F2VA 5G1NA 3TOVA 1YJBA 2BL4A 3QVLA 1V11B 1S3FA 2Q3FA 3JQGA 5FADA 5G3ZA 4P54A 3LQ1A 4XARA 3RAEC 2CBZA 4BLTA 1RW4A 1JIXA 3DEKA 2WLTA 3HKCB 5K8TA 4M6WA 2V0OA 2GAIA 1NJGA 3O2NA 4WLVA 4OK3A 5GM1A 3Q8KA 1RD4A 1KIMA 1I4LA 1GFIA 3L40A 4KXQA 1NBOA 4NHOA 2CHVA 4RFSB 1VKHA 4BGVA 2V1XA 4LJKA 2RGAA 4XWYA 3DO8A 1TQHA 4ZMSA 1DPFA 4P83A 1QYIA 4DBVO 1M2FA 2Q6TA 3I01M 4OQLA 4AZ3B 4BRSA 2GSWA 3W8DA 4GL2A 4KITB 2GKSA 2YWGA 3IUBA 3ZZUA 3QI2A 1N25A 2XRYA 3IDQA 1ZISA 3Q1KA 4FP9A 4KWIA 4B9EA 2NQ8A 2IKQA 1CE8B 1RQ7A 2VG8A 3OM0A 4L27A 1QCCA 3ED5A 3VDRA 3MPOA 3CLSD 3JQBA 4EMBA 3RT7A 1SKUA 1E59A 3DKVA 1HE3A 1R5BA 2C3OA 5AW7A 2IS2A 4Y1EA 1OXXK 2EQAA 1BKDR 1BA2A 3PGXA 3L4SO 4KO4S 4H9GA 4LSGA 1NMQA 2VAWA 2VTVA 4JU9A 2Q28A 4UHEA 3W8FA 2DEUA 3L7KA 1YS7A 3ICWA 2R6CA 1NYRA 3LYHA 4LJSA 3TQQA 3GRVA 5D3MB 4X24A 1D2RA 1KI4A 1X7YA 3DZKA 3LCVB 1JHZA 4K5QA 4KQ6A 5SYMA 5A04A 1U63A 3JQ6A 1J2JA 3WRYC 1QF6A 3GLHB 2J5KA 3B7PA 2OT3B 1TM2A 4GM1A 4HDNB 2G1AA 3ND6A 4R2IA 5ALUA 1DUSA 3T99A 1XMIA 3TJZA 2XGJA 2LV8A 4BJ6A 3H4TA 1MX5A 2DZDA 3OLVA 2VJNA 4KO8A 1XV5A 2YH2A 4P98A 4UOZA 3P9XA 4B4OA 4P0PB 1I30A 2GLXA 3Q7SA 4DA7A 2J5BA 3CVOA 5TY0A 1Q1EA 1U28A 2X8BA 3VR3A 3G2QA 1E9RA 4MVCA 5U1PA 1GQOA 1UZNA 2JAOA 2JFZA 2QD1A 2XTZA 4HJRA 4YVFA 5HPYB 2Q3DA 3FMPB 5E6RB 3DEYX 3ZI4A 4AJNA 1XIVA 2C03A 2VDOB 3QKSA 2IYXA 2WF5A 5FL3A 3UYLA 4BU1A 4ZJYA 1D07A 1F2DA 4IRXA 5CGZA 1D1SA 2JRCA 3E1SA 3PXGA 5JNWA 1PR4A 3KTAB 4JMLA 5EEHA 1JTEA 3HNPA 3W77A 1NDHA 2W8ZA 4I50A 2B8EA 3OT5A 3UT5A 1OIWA 3KT0A 1X7WB 3ET4A 1OLOA 5FPTA 4BEBA 2JCGA 4BASA 1DRVA 2NAFA 3DD5A 2R6AA 3NHRA 1QGDA 1E2FA 4ZANA 1O6FA 3T7CA 1MEOA 5JT1A 1JYEA 1II8B 2F7OA 1WMSA 1KBOA 3EWSA 4KQ9A 4BNNA 1K8QA 1KQOA 4UTXA 1XMOB 1OXKB 3OEHD 4ABTA 2DFNA 3X3HA 4FSHA 3UAYA 3QMMA 4GICA 5AHXA 3HABA 1JEEA 2W4IA 3WK9A 2MINB 4LYHA 1Y9EA 3ISJA 6PFKA 2VJKA 2ATEA 3DMRA 3TRJA 2UYHA 1U8YA 3BMCB 5JEDA 3GJTA 1C0PA 1EGQA 3PYMA 1XX6A 3JAMA 1KXZA 3FI9A 4O2AF 2P69A 3NAZA 1MCZA 1CRLA 2DSTA 1XXHE 4A7PA 4J7UA 5KREA 5CCDA 4D8WA 1FIUA 1OE0A 4LMBA 1AV6A 5EWMB 4RLQA 4MAAA 2HA6A 3BD8A 5DF1A 3VDNB 3FKQA 1MMFB 1XQ1A 2O8CB 3N3BC 3ZWNA 4E07A 3K16A 2A30A 4H60A 4ZVNA 4HNHA 4C4SA 1GTG1 1OQAA 3DD1A 3NUZA 4XLZA 2VHWA 4M83A 3ZBPA 2BT4A 2XE6A 4ESOA 2QXYA 4BV9A 3AM1A 4JH0A 4YRLA 1OILA 4RESA 3G1WA 3KVOA 3LC7O 4JODA 2PRZA 1Q1AA 1PEYA 4GI2A 1WZ2A 4B6RA 4ENQA 3BWCA 5BMVA 3DBOB 3CXRA 5IHXA 1QHXA 4D41A 3FCUB 4GZ5A 3TX2A 1VGVA 2FV8A 2GAOA 2X76A 3M4YA 1TAQA 3VNAA 4DCUA 3S1SA 3U7QB 3VVLA 3CXUA 5F2OA 4RHUA 4RTOA 3UA4A 4KRGA 4OB8A 1LV8A 1WHTB 1NQVA 1U94A 5D7NA 1GAXA 4Y0AA 2BGIA 1OYWA 1ZU4A 1F5SA 1UP4A 4LHYA 1PR6A 4QREA 5DLEA 1NBHA 3KDRA 1OAKA 3AR5A 4X84A 1ZGHA 1EFCA 1OJLA 2PWAA 3DTTA 4S2EA 4X54A 1HZJA 3G0BA 1AMUA 3WWZA 3I3SR 3ZHZA 2I6GA 3M6XA 2PQ0A 2ZTVA 4HADA 2O1XA 5K8LA 4I4TF 3W5VA 3LCRA 4YB8A 13PKA 2RHJA 1SEPA 2BKAA 1QGOA 2KLBA 2QYHA 2E4VA 3IHTA 2ZZNA 1OLSA 5LDHA 3RLFA 4E5DA 2XQJA 4Y1FA 1QDEA 1X1RA 3R8CA 4JL9A 1JWAB 1KRHA 1MO4A 1C9NA 2VYNA 4D43A 3QFRA 1XI2A 1UXHA 5LQJA 2P2NA 4RTMA 3REQB 2G76A 2H1VA 2RHBA 4Q39A 3WYDA 3CF4G 2OCLA 1HY3A 1ZZEA 1Z8DA 3EZYA 3O93A 1YNOA 4MR9B 1VJ5A 3UV3A 1VJ0A 3WWEA 1WUHS 1IY9A 1LLDA 1F0YA 4CKWB 1P5HA 4RL4A 4B9QA 1EEHA 4D3ZA 4LIPD 1DBVO 4RANA 4RK0A 1DJNA 1DC8A 3K4HA 5HDQA 2ZJ7A 1J0EA 5B3KA 5CLIA 5BSRA 1RAIA 4L0DA 4TRMA 3W2TA 1GG2A 3BCRA 3EOBI 2A9RA 1I49A 1UBMS 2HCBA 1MPTA 3TZBA 4MWEA 4AF8A 4BGIA 3K09A 4C01A 2EP5A 3P19A 2AZTA 2C5FA 1I3LA 3Q8XB 1DEKA 4PZ0A 2H5JA 2MSKA 4OSPA 2FHSA 4B6FA 3HSKA 2G04A 3SP1A 3MM4A 3IEVA 4ZEXA 2CXOA 4OM7A 3T47A 3G89A 1MD9A 3EFHA 5GAJA 4WERA 3GU3A 3RNOA 5BRNA 4ILKA 2I6XA 2HADA 2P2DA 1ODSA 5DGTA 4C0LA 1ZCAA 1HOTA 1L1FA 4JX8A 1OAOC 1ORRA 4N6NA 3I53A 1MG5A 3WNBA 1BE8A 1YKFA 4R1OA 1UAYA 4ZHQA 1ZCBA 2FMTA 5EOVA 1N77A 5B30A 3W6OA 3FZYA 1J0AA 1IZ0A 5EHXA 3TQOA 4IXMA 1VHTA 2ZBDA 3HVRA 1H1DA 4F01A 1N8NA 1OYOA 1U0LA 1VG8A 4P4LA 2A0YA 4FKBA 4RXUA 1R8XA 4Y2RA 3VPCA 4BGEA 2VPQA 3BMOA 2ZSIA 1T1EA 3DVRX 3K73O 5D6NA 3EVBA 1C41A 2UUOA 1JZQA 5CBPA 3AFMA 1NX9A 4UNQA 1RBZA 1CZHA 3T52A 5CB4A 4L57A 2O9JA 1CY1A 4FCTA 3BK1A 5H4GA 3B7WA 3BWMA 4TN1A 4BRZA 1BMFD 3PNOA 2AI3A 1SUBA 1J9ZA 3DVAB 3DFZA 1XZHA 4NWIA 4RS3A 3AIIA 4H1VA 3DMNA 2B7LA 1YU6A 2YCBA 1NN0A 4G2TA 3GI7A 4IHJF 3EDRA 3ZWAA 2A0XA 1ZHFA 3D1JA 4MP3A 4XASA 3K1AA 4AIRA 4Z9AA 5BR7A 4PXYA 3ZNOA 2JZOA 4AMVA 1BDJA 2PSEA 2CFCA 1W19A 2I8CA 3KR2A 5BO5A 1SR8A 1FFXA 4GU5A 1QRDA 4KRXA 1RWKA 1I6KA 3EVGA 5CMLA 4WCDA 2FYVA 4X9XA 2IU4A 5EYPB 3PXAA 3VJKA 4B6OA 1RI2A 4KN9S 3C6XA 3FF1A 3V1NA 4EJSA 4I81A 2ZKLA 2H4HA 3KZXA 1K06A 4B7AA 4FZSA 3LPAA 3NT4A 2IPLA 4IAOA 2JAWA 3W6PA 4EB0A 2GM9A 2X14A 4ZCMA 2DMRA 1QTNA 2GO1A 1CQZA 2IELA 2F43B 2VA9A 2ZDQA 2O23A 3OX3A 2V9CA 3LKDA 4IF6A 5CA0A 1Y63A 3PGA1 3O82A 4TS9A 4ZDWA 4B3TB 1DRWA 5DNWA 3HAJA 3KM0A 3L1VA 4XQ0A 5EPOA 2QTBA 5EESA 4TVSA 2CUTA 4GOJA 1V43A 1MLDA 2KMLA 5C52B 1VSBA 4JLKA 1CQWA 5E9AA 2VP3A 3O2QB 4IRUB 3C3PA 3WDLA 4MLPA 2EQBA 1UC8A 1P1BA 1UJNA 4F3YA 3QOFA 3EY4A 2H4JA 3JQGB 3A3KA 3PLNA 4LC9A 3P2IA 2QAIA 4PZPA 4YMGA 5A7FA 2Y4OA 5I9LA 1OR8A 1J0DA 1M2KA 3AF2A 4R2KA 3UJCA 1W4BA 5TX7A 2H17A 1YKGA 1Z7EA 3MSXA 3PNLA 2PAFA 3RU3A 4D56A 1XRNA 3OF3A 5BWCA 4QVIA 2JD1A 1N6IA 1ZOSA 4DSTA 4PO8A 4F93B 4CIVA 3BZWA 2RGXA 2WWYA 2AFVA 1X8LA 4TV9F 2Z83A 3OZWA 4BWFB 5DN6D 4Q1VA 3NNNA 3ONVA 3ZU2A 3TM5A 3HY6A 2IHZA 3SE0A 4KREA 4QXQA 4JS0A 3KR0A 2IW3A 2XMCA 5FH9A 4Y1RB 4PXAA 1JGTA 4YCMA 2XZOA 4ME6A 5E2AA 5ICGA 3AF5A 2XNHA 1B14A 4G0UA 2C2HA 3DDFA 3W5SA 2WYOA 1VJRA 3M9LA 1GPUA 1AZSC 1T9HA 3OHMA 4JB8A 5BW5A 1XNGA 4IOMA 4O4LB 4XAQA 1K6MA 3DXZA 3M9WA 3BMCA 5B37A 1O96A 1W4LA 2FEWB 4X20A 5J59A 121PA 2QN9A 2B9EA 4MUJA 3QF7A 4AJKA 2ZR8A 1PSDA 4G2NA 1GKUB 5FQOA 4XGNA 3RSLA 5CBPB 2J3JA 4MVJP 2RK3A 4I50B 1LBEA 2AXQA 2JVJA 4CMCA 3GGJA 1VLHA 4Y6GB 5JPDA 1CB7A 1KI1A 3GDOA 2OG2A 4ZQHA 3VO9A 5KNBD 4W5RA 4WECA 4EG4A 1RKXA 1RPZA 1S96A 2QV7A 1BX0A 3A11A 1B6TA 2G82A 1YR2A 3FTNA 3SJUA 5EERA 1IN8A 1AIPA 3C1OA 1DC3A 2CXXA 1A9TA 1Z3CA 2Z09A 4RFVA 4RIFA 5CHYA 4US2R 1UZAA 5DCLA 2A0FA 2XB4A 3T9EA 3NM4A 4YUZA 2ENUA 1WS6A 3PA8A 5E7MA 5BSEA 1JFLA 1BXRA 3I42A 2WY2D 4AKVA 1T2DA 4KVZA 1RAHA 4OQ4A 2IF0A 2G25A 5EJ2A 5F4BA 1UDBA 2C20A 2FPIA 2R7KA 3DW1X 3OLCX 1P8JA 1SWWA 5ELLA 1JPNA 3L7YA 1HL7A 3MINB 4MW7A 4AZ0A 3ZIDA 2J3HA 3E23A 4P9NA 2FUKA 4X66B 5I9MA 1QOPB 3COPA 3CVYA 1CZOA 1O3YA 5HDBB 1SURA 1SVOA 4QXOA 1B8PA 2HFKA 2JGRA 3O8DA 3RRFA 5LQDA 4YIKA 4EVSA 3DNPA 1W36B 1RC8A 5H80A 2OGWA 1R1DA 3PITA 4XSGA 2MSNA 3U9LA 2P27A 2E6UX 3CRW1 2JI9A 4IIYA 3OZDA 3SQXA 1PCXA 3LUKA 4BP9A 3F96A 2PKQO 4X3CA 5ALQA 3VR0A 4BFXA 4JUIA 2XCOA 4INAA 1G8YA 2P67A 1Z06A 2B0JA 3LQ4A 3RUCA 4PSUA 3MELA 3ABHA 4Q4HB 1TA9A 2Y0PA 1ZOLA 2Q5QA 4R5MA 5J43A 4YGYA 1OPXA 1JEJA 1Z25A 3FN4A 3JRXA 1DCFA 5DTEA 2VNHA 3EN0A 2PGAA 5GOZA 5GWXA 3ROXA 4B40A 4BNHA 2GETA 4PVDA 4QELA 4HNTA 1JLSA 1U11A 4KGZA 3UOAB 2DERA 2QTVB 2C5LA 3ANMA 4X8OA 4AP9A 4AJHA 2RHTA 3Q5GA 3ROTA 4LZWA 2XB6A 2YVQA 4RD6A 4W7IA 3S70A 3VISA 2FPRA 2ECFA 4L02A 1BS9A 1IXRC 2RKOA 4RHXA 4C3ZA 4YCCA 4G0WA 3FCXA 4YJFB 2C4KA 2RONA 3KU1A 1Z0IA 4IJ5A 4IM7A 5C8ZA 4DSUA 1JDJA 1JH8A 1KHHA 4O5OA 3X44A 5HIAA 2AI1A 1AG9A 4C87A 2NP6A 2CMHA 4WLOA 4Q7LA 4YRMA 3RRXA 2GZ2A 4MX8A 1CK4A 2EW8A 1KRWA 5TQJA 4TQ9A 4DB4A 2GYVA 2CUNA 2GM3A 4PZAA 1U3GA 2D5IA 2ORWA 2XOKA 4DXAA 3SHOA 1BA3A 1FVFA 4DG8A 2RHMA 3MF4A 3VZDA 4AY2A 1H94A 1NIPA 1PJ8A 1CR2A 2P11A 5BQOA 4B81A 3GMSA 3ZD9A 5I7UA 3SVTA 3RVPA 3WWPA 1NQTA 3S1AA 2AG6A 2JAHA 3KVRA 4RGQA 2CLOB 1H8HA 1A9ZA 2AYXA 3O38A 4C6TA 2PUVA 5CBKA 2Y0BA 3OHPA 2XA2A 2ZAIA 4QQKA 1USIA 1W73A 1G19A 1GKLA 1ZK0A 2EVWX 3N2EA 4L4RA 1AUOA 4RX1A 4B71A 2ZUFA 5CK4A 5DM2A 3WZ2A 1GG9A 2ZS8A 4CTOA 2BFFA 1QUFA 1R4AA 1C50A 1ZH4A 2H7XA 2RG7A 4Z4CA 5CLJA 1VCIA 4X95A 4XQCA 2Q07A 3KWMA 4LE0A 4MIOA 1CQJB 1V7ZA 3GNLA 4N7BA 4OF4A 4BY9E 1LB1B 3R77A 3IPLA 2GFHA 1RKVA 3F6CA 5ESXA 4W5TA 2JFPA 2O1SA 3LH5A 4R2MA 2QMQA 4ZOEA 3PLAE 4Q9JA 3OJXA 4OQPA 1V8FA 3T3IA 5KPJA 3EIHA 2Q12A 1ZO8A 4J4BA 4P2GA 1W30A 1O94A 1W5BA 2IS1A 2HBQA 1G3UA 1QSGA 3LIIA 4PYKA 4XWAA 3WO0A 3C5CA 4YRPA 4YCLA 1XTJA 3L0CA 3K0FB 4JYAB 1XCJA 1IHDA 3F3KA 1QMGA 3FWZA 3T9BA 3O4FA 4QGBA 1XHLA 2D5CA 2YYYA 5I9IA 3LZDA 1GGEA 2O0KA 3THOA 3RUIA 5JD4A 6NULA 4D4IA 3EE6A 3ONEA 2IGBA 3HZHA 1PR0A 1OOEA 3COJA 3I39X 3MTAA 1M6YA 5JUWA 4ZHSA 5ALMA 1O95A 5E1BA 1M6WA 2IXBA 1Y1QA 2IUTA 4GUDA 4DG5A 1GZSA 4F21A 4JJ4A 1E2MA 5HF8A 4J9VA 2YLAA 5CJPA 4JUDX 2WHYA 3IQWA 4QUKA 3HADA 1XPRA 3AO0B 1O87A 1IUOA 1RWWA 1WF3A 1VPWA 1NV8A 2RKBA 2W7TA 3C15C 3H1FA 4HX9A 4MCJA 4ZV7A 5TMBA 2DBVO 2YVAA 3T95A 2DBQA 1UOEA 5A05A 3DHNA 2PX8A 2QAGB 2RFLA 5FI1B 1ZOOA 3N76A 5LVAA 2QAGC 2FMIA 3D43A 4NAUA 3T3GA 1E9AA 1BD3A 1UKVY 2QW0X 2XQGA 1XYVA 2PFKA 1YO6A 3STUA 4PHCA 3LHDA 3OM8A 1T24A 4XRRA 3LDGA 2MI7A 3T5GA 1Z0JA 3ZE0B 4W5OA 4LXTA 3JWIA 4IZOA 1NWCA 1KJWA 1YJ5A 3CRVA 2I2CA 2AKYA 1GL7A 3MQ2A 4QUAA 4Y2TA 3UFBA 3LUHA 4CQMB 5EIEA 1PI3A 4NCIA 2NAPA 2XIQA 2K2QB 3WFZA 4F6CA 4E03A 4HLQB 3LIPA 3FPFA 2Q4EA 3PDIA 1PD0A 4XPIB 1GTSA 4RPLA 4W5QA 1V3VA 1KEVA 2PPVA 1AA9A 1M2VA 1AUXA 1UAGA 5AUQA 1FP1D 1R88A 3MRXA 4LRTB 1T0IA 1NLZA 2GEKA 5E0OA 2WPDA 1CE8A 5FV7A 4H6HA 4G0VA 1KI8A 2C29D 2WQ6A 1U6IA 3R74A 1QYRA 3OD5A 3LKBA 1VFPA 3VHLB 3PQ5A 1TA0A 1CIVA 3EXG1 1XXLA 5FPHA 2BFWA 1ONSA 3UOGA 1QDLB 2FX2A 1N2OA 1AZTA 5L7YA 4ZAGA 4B6GA 3VV2A 3T3NA 2WSMA 3STYA 2WVGA 4Z1OA 4P3YA 4QLOA 4LOKA 3CT4A 1AQYA 1ZI9A 4RYDA 4YMLA 1WQ4A 1RTKA 4P80A 1FPMA 2QTTA 4PHTA 1L7OA 2O2DA 4OI1A 3PQ3A 1CQIB 1DRKA 3H83A 4NMWA 1DBWA 2YMQA 4ZVOA 3U5TA 2R8BA 2QX4A 3TVDA 4YREA 3ZZNA 2GO7A 1XAHA 1KDOA 1M6EX 5JBIA 2NU7A 4DCCA 1EIWA 5IU6A 3RHSA 4HAWA 3VKFA 4OI4A 3D02A 1YI0A 4R2LA 3IVRA 1EVEA 3D2FA 5KHAA 5HIMA 4AZTA 4ALMA 3BXEA 1J8FA 2XT0A 4UATA 3F3SA 3UVEA 3OZBA 4JT4A 3H11A 2L0XA 4JQSA 3UA3A 4GSKA 1FDOA 1H2RS 2PWYA 2WABA 2PVSA 4JCCA 5F2KA 3IP6A 3OUZA 3ZXYA 3FAZA 2VRCA 4HT3B 1OC2A 2F3TA 4YP1A 5F77A 4ZDKA 1Q7TA 4U0KA 3SVZA 3VA7A 3AEZA 1LLQA 2NIPA 2D62A 3KLBA 4QBFA 4N5NA 3HJUA 4DNFA 3NWEA 4QPNA 1FQWA 3UJ9A 4OSEA 1JB9A 1PLJA 4G07A 2BH2A 5ILGA 2QR2A 2TMYA 1OD6A 4YXFA 4Q4HA 4L5YA 5MDHA 2GKGA 2FP3A 1PJRA 4L9WA 5EJAA 1CJMA 3PVSA 3QMWA 2RJ3A 5GVSA 4BE9A 2OP1A 3TI7A 4IDOA 4F96A 1DO0A 5DNUA 2AMJA 2OKGA 3I2KA 1RYDA 3FYDA 4HYBA 1NU8A 3DGFC 2TSYB 3F1LA 3OA0A 1KMHA 4NENB 4A5OA 4EO9A 1P19A 2AR0A 1W47A 3CRQA 2J0EA 2XECA 3C3BA 3JQQA 3AEUA 5AOAA 2DHRA 3HCCA 1MH1A 3OT1A 5DX0A 2IZZA 1N9ZA 3HB7A 5TEWA 4YC7A 4BUZA 1ZM4A 1C7QA 2RGNA 3MYYA 4NECA 1GOTA 4R1QA 3F9IA 5TNXA 3CH7A 2FSGA 3DZDA 2WT4A 3OY2A 2XNDA 4ZAYA 2IIVA 2V4MA 5KNCA 1NL3A 5AHOA 4YI3A 1U2DA 3GJZA 1MENA 1TZJA 3A31A 1V5FA 4AAYA 1Y6RA 2HHHB 4FCCA 3HB1A 4FFVA 1WP4A 3IALA 2QX6A 3WHKA 3O2SB 1AQJA 2PG3A 2VDUE 3IMGA 4TMWA 3EVZA 4MJ7A 2OVFA 1NBIA 1ARZA 1SIOA 1U0RA 4UAGA 1RNLA 2GYWA 3UF0A 5ES4B 2D13A 1V37A 3GJ0A 3HYNA 3GLIA 1JHVA 4DJTA 3SIXA 5F21A 3AHCA 4FGJA 4X91A 2HC9A 4Q6WA 3A6EA 2W6ZA 4L5AA 2WKPA 5JROA 1JE0A 5EP1A 4M1TA 4DDUA 5IYZF 1PYOA 4A8HA 1QGYA 4FFPA 3IQHX 4TMYA 2E4YA 4LF5B 1T5OA 3R5HA 5BN5B 3BS4A 3WJ1A 2Z56A 1HDGO 4MGIR 3D8SA 3M89A 2CXUA 3RRZA 1QK5A 4WLEA 5KJEA 1QP0A 1FFWA 2BFFB 2O0I1 1DBSA 2I03A 4G6ZA 1E20A 2JFBA 4FLEA 3OOWA 5BV7A 5JR3A 2HHCA 3H2HA 1K4KA 5KO2A 1WETA 3ECAA 1U2PA 1Z0DA 4WNYA 4EKEA 4LHXA 3ZKWA 1WPXA 2OMKA 3G2PA 2BEKA 1CX9B 5DULA 4RDXA 4FEGA 1KI2A 2F7PA 4J0JA 4PYIA 3AHHA 1T8YA 3TFOA 1PVOA 3TAHA 4QT0A 1RE1A 2AC2A 2RGWA 4YJ3B 5JWHA 1NE7A 2JLXA 1EAMA 3PPWA 4F5ZA 1E7YA 1UBEA 4Z7QB 4M9CA 4RK7A 4U0JA 1NHWA 2AH5A 1VLJA 2J6CA 2JKVA 4C7MA 2O7RA 1ZW6A 3VDMA 1QRSA 2F8MA 2C0QA 2O2CA 2D1RA 4EHNA 4MVJA 4QICA 4U9HS 1ZJYA 3MJ4A 1YL7A 2PQ2A 3MC1A 1P44A 2HU2A 4P7GA 5HBGA 1MW9X 1A8IA 4NVRA 2F18A 4F5DA 4I6JA 4RZ2A 5BVGA 4DCGA 3ZV5A 2QKYA 1FS4A 2FEOA 4HNSA 1C30A 5EMKA 3NBAA 2HPVA 3MRTA 3ON5A 3ZK8A 1D6SA 4P33A 5KKNB 3ADCA 3ZHSA 1B3RA 2H5EA 2QTVA 2Y6VA 5ALEA 4CN9A 1A7JA 4G1EB 2AVDA 4RY2A 3ZWXA 3AUXA 1YRAA 4RGVA 3PDCA 1CULC 2Q29A 4LVOA 5IBRA 1X9HA 2ZYHA 1EBUA 3LECA 2QRQA 2JFNA 1NN3A 3Q9SA 5I7HA 2W2KB 3ITDA 3ZEAA 5EJ6A 1P9OA 3HCWA 4QPJC 1R6VA 3DDNA 1FXWA 4ON9A 3D9QX 1Z7YA 5JVDB 3U7HB 1EYZA 1G5HA 4TSFD 4HB3A 2ZEJA 4Q3KA 2WHQA 3BMNB 3M2PA 3MJRA 2Y9MB 4Z8XA 5LB4A 4EAAA 1DIAA 4JYZA 3VBEA 4WBNA 2VP9A 4Q0MA 2EC5A 2YWFA 2AFHA 2O0MA 1G8SA 2IXDA 2PGIA 1F1JA 2YQ5A 4C0JA 3RVKA 1WBBA 4NCJA 4PPNA 5LUAA 3TOXA 2HF8A 2PMWB 1CWUA 3PDUA 4ALKA 2BUCA 4LJ5A 1BFDA 4Y6SA 1CIJA 3MLBA 4XTRA 5KIAA 2V4UA 2KBEA 3ENZA 5AUOB 4H31A 2N3KA 1E89A 2OTCA 1AGNA 4E5SA 3RYFA 5C53B 3BFPA 4PO9A 1OX6A 2G1UA 2HSWA 2JHCA 2WTUA 1TQUA 2IL1A 1LU9A 3PG5A 2JGNA 1U9JA 4XCVA 2VJQA 2QAGA 3AR3A 2YHSA 4D96A 3NJRA 5JOQA 3K8YA 1VQ1A 2BMAA 2JBAA 2JFGA 1QIIA 2VNSA 4PGMA 3W3ZB 2PYZA 3M0EA 3KQNA 5THQA 2YXBA 2WWVD 3SVLA 2F64A 4KYVA 3ZNQA 3PJGA 5I51A 4DXHA 1SVWA 4RIIA 1N5MA 5IJAA 3EB9A 4G3XA 4HPXB 4N7JA 1X0XA 5A3VA 3QE3A 3L6EA 3OTOB 4K9MA 3Q1LA 1Q0UA 2RI1A 3AI7A 4IM2A 4GOND 1CERA 2WU4A 3PFBA 5CURA 2YDYA 1C9KA 3KZMA 1QZXA 3S8EA 4IIEA 4US0R 1H5NA 4YRZA 1U65A 1XTBA 2XCLA 3TTTA 3UG6A 1HE4A 2BKLA 5AVRA 1KSFX 4FCVA 5JNRA 1B7GO 1J00A 2OENG 3ZCSA 1UDAA 2BISA 2I76A 4AF7A 1S4MA 2LKCA 3IOBA 1H93A 1AF7A 1E1RD 4U7GA 3QKRA 1IHYA 3N0RA 5JQGF 2R48A 2P9TA 3AV3A 3LRXA 1JSRA 3I2GA 3M70A 4KQEA 2ERYA 4JI5B 3SU8A 1HG1A 5B2EA 1GZ7A 2P62A 3H7IA 5BXQC 4LNAA 2O5VA 1RXWA 3PRHA 2X40A 3B1XA 3DUFA 3WIDA 4ARVA 1IQ0A 4WJKB 5JJCA 3M4NA 2CVPA 4IOLA 1JR4A 4TRNA 5CAEB 2VBIA 1WG8A 3VR4A 1KK2A 1R4MB 1TMKA 1QB7A 2YLLA 1ZZGA 2XXJA 3TVTA 1LUAA 3QLTA 1Z45A 4P4SB 4TXJA 5DLQC 4D8VA 1HE8B 3I28A 3C97A 4RVDA 1KR2A 1A3CA 1ABEA 1YUBA 1ZJ4A 3HEAA 4DN6A 4F56A 4BNEA 2Q1SA 2WFZA 4FQ8A 2P1ZA 2BHTA 3I73A 2HA7A 2OHVA 4A6XA 4B3FX 2YVUA 4EGJA 2P4EA 1BGVA 4FSDA 3DZ8A 3DOIA 4I1RA 1RU3A 1JRLA 3TIXB 3ENKA 3N8NA 1VB3A 1TZKA 4QQFA 1T13A 1U4NA 1DI0A 2AJDA 1E99A 1FNBA 2YC4C 3K0CA 1FFAA 3DXYA 3KJFA 4OGWA 2ZVDA 4OOFA 1E1NA 1I2CA 3L4KA 3G2MA 1FYEA 3EEBA 2OZLB 1P4AA 1FMJA 2HLDA 4WGFA 2FU5C 1YIAA 3GJYA 2H2GA 1HRDA 2OGSA 4IGKA 2CHGA 2R6FA 4G86A 4OKIA 3CPSA 1Q3KA 4EWLA 2B5VA 2OESA 2FPSA 2NO5A 2YJZA 3LLMA 4GKJB 4CU2A 2EFCB 2M6KA 4ZQEA 5JSQA 3ENQA 3LGAA 4KI0A 1VJCA 2WV9A 1T5IA 4EUKA 4LQLA 4KRYA 4LY9A 3OSZA 1EFPB 4DRYA 1RYBA 2QKWA 2FN9A 5C5BB 3W2FA 5INTA 2QW8A 4EZOA 1GZ3A 3OCZA 4FYKA 4EY7A 5LDDC 3BCHA 3NBXX 3QXCA 5DGXA 5J2TA 2HSEA 2QPAA 2AGVA 2ZYAA 2AMYA 5JNTA 4FFOA 3C6ZA 4M0KA 3K92A 3PNQA 1ZL2A 2HR1A 1W88B 3LXRA 3ODGA 2FZEA 3SQMA 3TLKA 3A3YA 3TKLA 4KBFA 3UHJA 2WINI 4EZZA 3B7GA 4QWMA 2ZSHA 3GCZA 2M6SA 1C9JA 2NSYA 4C6TB 5A6SB 1I2DA 2HK9A 5E3JA 4KIUA 1QZ3A 4GMFA 4UZEA 3NT2A 4OB7A 3L4JA 1CUUA 1KY3A 5BORA 1BDBA 2PT5A 1YMVA 5JCJA 1UJ4A 1QZZA 2GF0A 4H1UA 2LDBA 2JDID 4ER7A 3GZ4A 2G0NA 3JWPA 5BSUA 3D6NB 1Q1GA 2R68A 2AW3A 4IEEA 1PEAA 3NHKA 4HWOA 3H2SA 5ENVA 2QX7A 1BNCA 2OCPA 3Q3HA 4NZPA 5HYVA 5FR2A 2EX1A 1ORTA 4MO2A 1A27A 4UHFA 4WE3A 4V0NA 5HVNA 6Q21A 4FDLA 1X42A 2F67A 3JAKB 4OXYA 4NJMA 3TEMA 5ALKA 5JCPA 1URPA 5A7HA 1AK1A 1ZVMA 5DGHA 5IC4A 4GYYA 3WTBA 4TPKA 3MEQA 4NQIA 2WTBA 4M38A 4QOIA 9MHTA 1DX4A 2QLBA 1Z47A 4DG9A 5C8XA 1M1UA 4A8JB 1KFBB 2R3SA 4PPGA 3UM9A 2JJQA 3PT9A 1NYTA 3QX9A 1MUUA 3V9AA 4RGBA 3HZRA 2WKQA 5KYWB 4O2AA 3U3RA 1HDRA 2RHLA 2EBHX 4M0MA 1Y33E 3RAJA 3TPZA 1OGJA 1OI4A 4MKIA 5FUWA 1HYGA 1YQGA 3CZ4A 3G6KA 1AHPA 4YO8A 2R4QA 4OX9Y 1AB5A 2A84A 3MJCA 1LRLA 1ZR4A 1LVHA 4X8MA 3WBKA 3TZHA 4WBNF 3GJ7A 4DVGA 3AF3A 3UGQA 1HT0A 1RHJA 2FUNB 3SLGA 2R47A 2MR6A 2J3KA 2VZEA 2P5YA 2NUTA 5JLAA 2UXCB 1VHWA 2E4UA 3DYIA 5HFJA 2OYRA 2FI1A 1WM1A 3HLTA 5DBIA 3DOOA 2ILVA 4HDNA 2PZJA 3GEGA 3QVVA 4QOGA 1RCTE 2K2WA 1V9SA 3KT3A 1TAHA 4L95C 1E6UA 2V7PA 4CKZA 3BZBA 1MGOA 2WV7A 5GJCA 2R8RA 5K3FB 4YP0A 1YKSA 3SS8A 2BRUC 4FWIB 5KZMB 5F33A 5FP0A 1DEAA 3GK3A 1WMAA 1RLMA 4EENA 1Y5MA 3R6GA 3EYAA 3MMNA 3H5LA 3UMJA 4M9XA 4DMLA 2DQ4A 3KT8A 1JDBB 1QP4A 4LF4B 4RZSA 1VBFA 2HA3A 1AF4A 4LXIA 4P58A 5LZ4A 1MB3A 1MG0A 3HSSA 4YK7A 5D84A 5JMPA 3TTVA 3UJHA 1LLCA 3AGQA 4A0HA 5C7LO 4JI8B 3FCOA 1ZVKA 1THZA 3QWFA 4KXYA 1J2YA 1E6KA 4X6LA 5K3AA 2CSUA 3TW8B 3ZX5A 1J6UA 1WB9A 1RIFA 4ATNA 3VR5D 1XTKA 1X1TA 2ZU6A 1CR1A 3OJEA 4EKDA 4NG4A 4H6VA 4IXNA 1T4CB 3ESXA 4F97A 4C4TA 5BWOA 4IV8A 3REFA 3ZCVA 5KOYA 2WF9A 4KTTE 1ZD8A 1QC5A 4PNPA 3UBMA 4QYWA 3VO2A 1EUDB 3O8OB 4AP5A 5BWNA 1JDBC 3M1LA 5D5HA 5CW1A 5TMEA 3PLRA 2XA1A 3T61A 1X39A 4FHEA 4EO7A 4UTVA 1TGVA 2ZWOA 1ABFA 2VKQA 4DIUA 5LP6F 1F06A 3DBLA 3DTVD 4LXHA 1DAEA 3OF5A 4NMXB 4PCAA 1QK4A 4GEGA 3WAKA 1MXFA 3ZXXA 3LY7A 3ABRB 4EDHA 2WZBA 1UXJA 2XNKA 3U4CA 4Q7QA 1E7SA 5FPKA 2WAYA 3W5AA 2CFSA 4ZV9A 1X03A 1R6TA 1CUBA 3A26A 4OFWA 3L07A 5BMVB 4MV8A 3CF4A 4MUHA 2VSFA 4LQCA 4TVBA 2V8OA 3FRIA 2QOEA 2E82A 1J39A 1SIBE 2Q5EA 3HB5X 2H63A 3F2IA 3PFGA 4JENA 2UZIR 1UPBA 3DVLA 3LW8A 4RH3A 2FTKE 4IIHA 5DGIA 3RQIA 4JXXA 2DX7A 2B34A 4MRMA 4ZXFA 5BSHA 1U0GA 2WJYA 2OZLA 5JY6A 1P31A 2IPOA 4HP8A 4A26A 4AZ6A 2E4WA 1ACMA 3AX6A 1IZ9A 5IVDA 5LLSA 5M04A 2QJFA 3B6JA 2X9GA 1G2PA 3AY3A 1QH9A 2OP0A 3LL7A 2VYVA 4ZC1A 3Q3VA 1DEHA 5FYDA 1AB6A 3ZWYA 4HLNA 5B2ZA 5E3HA 4YX9A 1I4DA 3V5NA 1W75A 1GDDA 2PMEA 5IYZB 1X94A 5BOSB 3RBZA 1U1FA 4XI9A 3UK2A 1IDOA 4AJIA 3ORSA 3N70A 3RTCA 5IAJA 3EHEA 2W4QA 2IS6A 2YJ3A 3A1NA 4CFSA 1HSZA 5DYIA 4B82A 3FLMA 1UMBB 2BF7A 5FI0B 4TZ6A 2YRFA 3N58A 5CEJA 1UBOS 1GAWA 3M1IA 4UKDA 4P92A 4I1VA 5CYPA 2R6DA 3DKKA 3JQDA 3KQMA 4Q4AA 3VMMA 3WKDA 3QKSB 4G0NA 1S9DA 4TL9A 4KR2A 2ZRNA 2R60A 3AILA 3CLRD 4LDJA 4WY2A 5BP7A 1X8XA 3ZHVA 2I80A 1K6IA 1K92A 5ADWA 1FUEA 3MSCA 4EB6B 1SZDA 2GLUA 2CJWA 5AICA 3UB2A 1IRIA 3F3MA 2X13A 3TJRA 4LHSA 2OHOA 4BJ1A 2R6HA 1ZGBA 3HXQA 2J6HA 4H15A 1JBQA 3TLAA 2JASA 4PZDA 4DAOA 2QT0A 1R9NA 2C96A 1Z6TA 1OHHA 1H0KA 5FL7A 4CCYA 4QFMA 4CIWA 4ND6A 4KSYA 2FOIA 3ID6C 1P4GA 5ALTA 3MIIA 2NTNA 3GPCA 4CHTA 5FL7D 4PG5A 5U9CA 3FFAA 3DMPA 1YCGA 3URKA 3G8DA 4NI5A 4U1RA 1U0BB 1YSCA 3RADC 4EZTA 2QM0A 4BLRA 1JHYA 2YOGA 3I83A 2X7HA 3P0EA 4BTEA 4ER3A 1BGWA 1K4YA 5BW4A 1DKNA 1XLVA 4RZIA 1QUEA 3KCQA 2WWRA 2QUHA 4PFJA 3RT1A 1Y4UA 3PLTA 1POWA 2R6ZA 1JUDA 1WOMA 1O57A 3VR2D 3O0TA 2PUEA 7ABPA 1G63A 3DLBA 3F5QA 2BEVB 3SIWA 1H5QA 4TV8A 4C4YA 3OEWA 1Z68A 4JQOA 2Z8XA 4OKNA 1V9CA 4WEQA 3K96A 3CNOA 1PDOA 1U7OA 2EZ4A 1Z0KA 1DAKA 1KJ9A 2CDNA 1RHMA 1ADFA 2YX1A 3NU1A 5AQEA 3T54A 3DEZA 1KE2A 1M2NA 1P2UA 5DRYA 2FJUA 2XB9A 3L3BA 2IYPA 4K1LA 3CCBA 5KYUB 3H4MA 4DUGD 2PL3A 5AI5A 2ZJAA 2YXDA 1DJQA 1Q0ZA 2GPYA 3HCPA 3UHAA 1P61B 4BP8A 3EJPA 1G291 2NGRA 3HKBB 1AQLA 1D0VA 1PZGA 2CLDX 4L4SA 6AT1A 5KQSA 1B8UA 4QASA 2WU1A 3U9SA 1X2BA 2EGHA 4JIGA 4IJUA 4GKKB 1FRZA 2ZXFA 2XMBA 3WLHA 3C8ZA 2OCIA 2X5NA 3ZIUA 3FJ1A 1KQGA 4AN0A 4C89A 4OFBA 2FWRA 4ZEOA 3DL7A 1W76A 3U7GA 1XTTA 4EW3A 3E0XA 5CT8A 3EQ6A 4FR2A 2NWQA 4JFAA 4C3UA 1HNWB 4MWZA 5CDUA 2QN7A 1K63A 2I4LA 2PX4A 5KOJB 2RC6A 1YQDA 4NP6A 2CDRA 3QFTA 4QOSA 5B55A 1DKPA 2UYOA 4E2ZA 1LQ2A 1VIDA 2C4VA 3DS8A 3RUFA 3K6JA 4N7MA 2HBRA 3BK7A 3ZUPA 4AYWA 3DTVA 5H4HA 1WU8A 2WUDA 2EWMA 3MT7A 1GUBA 3IQXA 3NPMA 4OHXA 5CH5A 1G2OA 2ZQYA 3RC7A 3PQ2A 4ITRC 1JJVA 3EUWA 1WRBA 3A6HA 3JATB 1EA7A 1MW8X 4R51A 4V03A 3IUEA 3A9VA 4Y2PA 1A4IA 3L0PA 2C2ZA 1UKAA 1KKLA 4NDZA 3RC2A 5BR8B 2J09A 4IKOA 4O3MA 2ECOA 2RJOA 3CVVA 1V41E 2F55A 1RWXA 2HJWA 1N2CA 3GRUA 3M6WA 2Q7DA 3P9RA 2C3MA 2ZUTA 3RTGA 3WLJA 4EELA 2CMFA 1WAMA 1URUA 2VWGA 3F5SA 1SCNE 4MCIA 4BNLA 2UV8A 3AFNA 5AW0A 3H16A 4CM1A 1GWNA 1KKUA 4KO1S 4UULA 1JN0A 3S99A 4ABYA 5BV8A 1P9WA 2OPHA 3T1OA 5CITA 3BA1A 2RBEA 5EGNA 5LP1A 4NBTA 5J2UB 1VSVA 3RD5A 1WVIA 3BM5A 3KHSA 3EZ9A 3KL2A 3LDFA 3OCWA 1CF9A 3TRFA 3G0OA 3ZC3A 2J9GA 1MOPA 1UJ6A 2CNDA 1BG6A 2R8PA 2QGZA 4KV7A 4G6QA 3PDJA 5FNZA 4PGAA 4RZHA 3AZQA 3LOUA 4KH1A 3OHXM 1PTJA 2JK1A 3HJCA 5ELMA 2MYUA 5TQVA 3U6BA 1T9BA 1ID8A 3KXKA 4QGSA 4S04A 3NNSA 2YL5A 3O1LA 3EGEA 4OUDB 2F90A 1TM4E 1ZRHA 4WZAB 2FAXA 4JNFA 4CMIB 1P62B 2AG8A 4K7JA 4MV1A 4EMTA 3DTYA 4AECA 5A3RA 3KTFA 3WL5A 3DV0B 3L7DA 4CFZA 5ETJA 2N1MA 3F5MA 1L4FA 3CWQA 3OZ7A 5GOTA 3WIBA 3JASA 1N7JA 2LXNA 5B1SA 4O4LF 3S5JA 1BMQA 1WXDA 2OAP1 1TECE 1V5IA 5J23A 1SQ5A 2W98A 5JNSA 1DOZA 1E9BA 3I6YA 1W87A 4NS1A 1OGYA 3EC2A 2CDCA 3HXTA 3NZEA 1EZZA 4Z53A 4I9GA 1NSYA 1UC9A 2P2SA 4UVHA 5AW9A 2AN1A 3ZEDA 1EH5A 1PU2A 3W1VA 2ZWVA 5A0FA 2AFIB 1JQKA 2R2GA 4NZMA 4Q4CA 2Z43A 3AFIA 4WXRA 4ALLA 5KU7A 1WD7A 3KKQA 3A1CA 3QMPA 3ZPXA 4KJZA 3SYNA 4R9SA 4KXWA 4KQFA 1U3FA 1J97A 4XKJA 4YLGA 1A76A 3DV2A 4LZPA 5F7ZA 2R66A 5TJHA 3ZHQA 5JFOA 2JBWA 1PFVA 3JYQA 2P3LA 4NJEA 4PYOA 1AN9A 3NI2A 3QXJA 1ZAKA 1G8GA 1KXJA 3GD5A 4JP3A 1OFHA 3RVMA 3SXJA 5HJEA 5ALIA 4YRGA 1YGPA 5D5QA 1M83A 5FUMA 5BSTA 2AK3A 1C0KA 4R9VA 4AJEA 4LBWA 1QQ7A 3WGGA 3PQCA 4CTNA 4F3RA 4BQIA 1FP6A 2Q2OA 1XNRB 1MV5A 2HXSA 1W29A 3PIIA 2ROQA 2PRSA 4DLAA 4KPFC 1H2YA 4AJPA 3HTXA 3CF2A 3RABA 4AFNA 4R98A 1XF1A 1AE1A 2Y77A 4RY0A 5G40A 1A9XA 5JS6A 3QLUA 2JIBA 1CDDA 1QQ5A 1W9MA 2NXEA 2NYVA 3W90A 3PYLA 4HLUA 4ONEA 4DMCA 2I4TA 3CH5A 3DKIA 3Q8WA 4LSWA 1ZHHA 3FF4A 1GCGA 3BVTA 1KYYA 4IEIA 1G4HA 2XEXA 3IDFA 4PO1A 3WMGA 4WK0B 1NJ5A 1YCHA 2HV9A 1FVXA 1EE2A 1FX1A 2DHEA 5HFNA 3AEQB 2O5CA 3PXCX 1A0OA 5TGTA 3EZ7A 2Q8NA 2XI4A 5F1OA 1W25A 2C82A 1ADJA 1FFCA 4KI7A 2AEEA 4P31A 3CV3A 1ZN2A 4IYRA 4RMIA 1JQDA 3OO1A 5K4GA 4YJFA 5ISMA 3V4RA 4YS6A 2C3YA 3D7RA 3IIIA 4OJMX 4R8SA 4WOJA 5K0EA 1KP9A 2C4TA 4U2FA 2ONJA 2PX3A 5EHQA 5DT9A 2NYRA 2NPIA 2Q13A 1SB8A 2EFDB 3KKPA 4E2FA 5CDGA 4CT0A 3NG1A 1ODCA 1IB6A 2L2QA 2GXSA 1Z8HA 3OZVA 4BWVA 1EUQA 1Y6GA 1VKJA 1QHGA 4RADA 4EITA 3HBNA 3OZTA 4EFDA 1TJNA 4LJ6A 2X8WA 1QJCA 1TM5E 3TSZA 3SS9X 4DLLA 1YBAA 2CL5A 5L3ZA 4H7FA 2X9QA 4D79A 4CG1A 4GZ6A 4QXPA 3WL8A 1QHIA 1TW2A 3CLKA 4UHKA 1D5CA 1SK8A 1XCPA 3NRBA 1BMDA 4NOJA 5AK0A 5A62A 2DUWA 5JHHB 1IN1A 1KZ9A 1XEWY 2YRWA 4MZDA 4BZPA 1PKEA 1UDRA 1M1ZA 1X80B 3LX4A 3QE0A 3D5EA 4H4CA 1O5OA 1L5GB 4C4XA 3G7SA 3DSRA 1S7GA 1VSTA 4Q9NA 3SPXA 3TL3A 5IF9A 4L5CA 2HCTA 5TC4A 3OFSA 2VF8A 1NONA 2V7UA 1Y2OA 2UZ1A 3GZNA 3OKAA 1N32B 3ND5A 5EC8A 2H3EA 4HKTA 2Q1XA 1FP4A 1RBMA 1U2EA 2W8BB 4HR1B 3RROA 2VYQA 3ZZMA 1RZUA 1GT6A 1ZIOA 2Y0EA 3D6UA 3L7JA 4JLVA 4PLWA 5ADHA 3I1FA 2JFFA 4JGGA 4M9QA 3OU6A 4QA9A 4JI0B 1JT2A 1RMYA 2WYVA 4J0FA 4PHHA 1WE2A 5H02A 1Z5VA 3I9V6 4AT1A 1N78A 2DCMA 2IIQA 2ZIVB 4MWCA 3GFPA 1QWOA 1JJFA 4QUJA 2PUDA 4TROA 1SA0B 3GLHE 3RWMB 4DJEC 3TQRA 2IV2X 2JLAA 1OH5A 2Q2NA 2ZUSA 1U0FA 5J4HA 1JR3E 3I9MA 4ED9A 4BTLA 4X65B 2I7VA 5BNIA 3T7SA 4UZFA 3WMEA 2VHYA 1NVKA 1DKUA 5FIUA 4ZCTA 3F78A 1E1RA 1G6HA 2Z1DA 4DZZA 1FC0A 5B1YA 4JC4A 1PFGA 3GXBA 1QB8A 1KC1A 3GYGA 3GEPA 3Q11A 2FSHA 2IEZA 5LXTB 2J9ZB 2NYUA 3UGTA 1Z22A 2GCNA 2MIIA 4YN3A 4LV5B 4H8SA 3E61A 4TLAA 1OVGA 1YU9A 3EVFA 4X20B 2E21A 2QY9A 1JJIA 1JW9B 1LA2A 1GIAA 1YL5A 3R5FA 3TB4A 4P4UA 5B57C 1Z5UA 1GRQA 4NEQA 1G7SA 1WUTA 1V8ZA 2WM8A 4Q1DA 1AKWA 3IA2A 1DLIA 1H1TA 1T5TA 2ZAGA 3AKZA 1T91A 2VBFA 2XWJI 1L4GA 3UB3A 1UEXC 3THWB 1E3TA 3IKMB 1OKKA 3KV1A 5DT2A 3S2UA 4E4RA 4KYTA 2AKEA 1HQCA 1H23A 2RHRA 4UD2A 4JLUA 4LY6A 3H5IA 5CYOA 5FORA 4BOYA 2FDCA 1YRQA 3AEKA 4L16A 3DBRB 3FW1A 3HU5A 3B6KA 3ND7A 3PIDA 3I9LA 4FFDA 4INJA 1NAIA 4JJAA 1VE7A 2PD4A 1T5LA 4ML3A 4XYMA 2XCUA 4YJ2B 3SX4A 5AVZA 2JGFA 4ARCA 1CUHA 1W4CA 1XCOA 1RAGA 1UQTA 1L0BA 1PT9A 4FBMA 1GGNA 1DZIA 3DTVB 2CMDA 1ZESA 3ZZTA 2J87A 2NU7B 4IWXA 5ALVA 3LPMA 4HJXA 5HQTA 4OP2A 2P2ZA 1QHEA 5TB5A 2WVJA 3JQAD 3QQPA 4W1SA 4F8EA 3VNUA 2ILTA 4CUZA 1I6LA 3SICE 3N87A 4P7KA 3H2BA 5TIIA 1NJSA 4FNGA 4NBNA 3NONA 5JW6A 3BD7A 3D6MA 3FBTA 3IJEB 2A8YA 3NGLA 4JZYA 3UICA 3QEMB 1TPYA 4F12A 2DH5A 5L9AA 2WFAA 2I65A 3VAAA 2HWXA 3QPDA 1Y8RA 3UV7A 5AVOA 3MTQA 4TQAA 4FJ2A 4H0NA 5JPIA 5TKYA 1RPAA 3VNQA 5I4KA 4PR0A 1TXGA 2ZDHA 1E98A 1MVLA 1SCAA 3FSEA 1R5NA 1U0SY 2J7PA 4GM4A 3D54D 4PTLA 4WXYB 3SBXA 5BYJA 1JAIA 3VHQA 1VJGA 3UH1A 1FYXA 1BXZA 3LT4A 5CDSA 2O07A 3SAJA 1IY2A 4I9UA 5J9FA 1M2VB 3USCS 1EHYA 1NSTA 2BHSA 3QV1A 4ETMA 4Y6OA 3O9ZA 4XPIA 3WLSA 3RG2A 4AM8A 2OYSA 1ZM7A 2H1SA 1EE9A 1F17A 4TKZA 4LOHA 3LU1A 1LSOA 5T3YA 3EMBA 4M1YA 5BV0A 5LJIA 2PUGA 2QQGA 3JZAA 5TQ0B 4D0NA 1KYXA 1XA3A 1YB2A 2Y1OA 4WT7A 2XB8A 3V8NA 2Z2ZA 4Y2UA 3RTDA 3EJTA 1YJ8A 5ADUS 2XKKA 4QAJA 3K1ZA 3T3MB 4Y30A 4ZI7A 3T94A 1NNI1 4DNPA 1F8XA 2UUCB 1J8DA 3QYPA 2F3QA 1DPGA 2XBMA 4QGAA 1FNDA 2H2WA 4IMIB 4JP2A 5FB3A 1U2SA 3PD7A 3PDHA 2XUFA 3RGWS 5GPBA 4MKGA 1RAFA 3EAFA 2QP4A 4PQGA 1W2WB 3OFJA 4MB2A 1JZSA 1T5SA 4LUCA 2Y0CA 2NUAA 3I5XA 3F5FA 4Q19A 3OPYI 3V1MA 2DOKA 2G9UA 4ZI5A 1NJ2A 3B3JA 2VJAA 2XOXA 4Q5IA 1AK2A 1P6QA 3WRWA 1YC5A 3DF7A 4CG2A 3THYA 2X41A 4JT9A 1HT3A 2UAGA 1EWTA 2YR0A 3RJ5A 3CPEA 4UPEA 2HU8A 1RJWA 3B52X 3I9JA 3BDVA 2JI6A 3QXSA 3E7XA 1VP9A 4MQ5A 1GQQA 2NXWA 2ETVA 2VYFA 4P2BA 1GR1A 3C8DA 1L5WA 3ABSB 2NO1A 4HQ0A 3UTCA 3VSEA 4CETA 5KJ1A 3WGIA 4KQGA 1UBGA 3EXFB 3O8NA 1WR8A 2V7TA 3QEAZ 1ULZA 1M34B 3DOUA 2F1IA 4BIIA 3IERA 1BH6A 4O33A 1FB5A 5EP4A 5AVVA 4CV2A 2GJ8A 4YAWA 4ZQBA 5JS8A 2WAOA 1BVUA 4N3NA 1HG0A 4LRYA 4R7GA 3OZAA 5T4BA 4QUEA 4BMYA 1Y82A 3WTCA 2XEDA 1V8DA 5DXAA 1O6GA 3GELA 3N9IA 4IH4A 3IIEA 3GQBA 2ONZA 4WGGA 4C5AA 4CKWA 4Q34A 5KNCD 2UUAB 2QVCA 4PRLA 3INRA 3JQ9A 2AEJA 1FTWA 2PUWA 4G1UC 3BYZA 4N5DA 5KWSA 4QM7A 1W35A 2ZSJA 4PLYA 2IUSA 2HMVA 3V1UA 4NCNA 1XROA 2ZLBA 3SYMA 2RHDA 1FA9A 2B35A 1DOAA 1GG5A 3BDIA 1D6MA 4GAEA 4IHJA 3HKDA 3P20A 3MRSA 4N0PA 4RO0A 5LQSA 5T4FA 2W0SA 3ES9A 3HRKA 4Y6PA 3Q2OA 3QSYA 2W2TA 2AOUB 2PA3A 1O0SA 3E7WA 3HL4A 4MS3A 3VO8A 2ZITA 1SZPA 3KVNA 1WKVA 3Q7TA 3VU3A 4RENA 3K1JA 3H4VA 2QT9A 1U9ZA 2B1GA 3ZE2B 5EE5B 5GQSA 3BGDA 5ELXA 3KUUA 2DWCA 3ZZ0A 2FWMX 3L18A 1JHUA 4JHLA 3LUAA 5FULA 4DY4A 2AQKA 1KMCA 2ZSBA 3VHRA 4E14A 3GNQA 5HOQA 4ZEVA 2DECA 4OP3A 4RVSA 1XN4A 2QYSA 1Y5LA 4FJ1A 3RC3A 3DB1A 3U7QA 1T8WA 1D6NA 2KE5A 1VLMA 3SZLA 3PEVA 1XRRA 3K05A 3VUFA 3IP5A 4WN9A 4L3WA 3I62A 1AT1A 3DV0A 4A8PA 2CCJA 2FXIA 1I0ZA 4LDPA 2FQWA 4HDKA 3HUUA 4XJTA 2Z30A 3IE2A 4MV7A 2E3JA 2OCAA 3P45A 3CN9A 4LN1A 5WRFA 2QL9A 3WRXC 3L8CA 3K0AB 4ZU1X 2PH7A 3EPPA 3IMKA 4Q03A 1CQXA 1NMEA 5IVIA 1ZVVA 3ONDA 4K05A 2F43A 1YBFA 1XTSA 3ZHOA 2P79A 1DC4A 4D9NA 3O84A 2X7XA 4MVYA 1QKKA 3LQQA 3QKIA 1FRFS 4PPQA 2BFEB 3V8EA 3IRUA 1KJJA 4J0EA 1ECPA 1WXHA 4L8GA 4D9CA 5B3LA 3JQAB 4C20A 1E3WA 1EB8A 2IYSA 2HWKA 2EJWA 2XXBA 3ISTA 1Y3AA 2JIOA 1A1VA 1M0EA 2NU8A 4JVLA 1BW9A 3CLVA 4AJ1A 1AURA 1P1RA 4RIGA 1NJFA 1PGPA 4I4TA 3RF6A 4B8ZA 3PEYA 2IYFA 1PO7A 1GSAA 6GPBA 1FE8A 1C1XA 3EG9B 2WIDA 1U7PA 5LQCA 3ZWOA 5IXSA 2YI9A 4ZAWA 4E94A 5ALHA 3KPYA 4QARA 4YMTA 3AW9A 5IABA 1PG0A 2GZDA 2PQ6A 2GEVA 3V8PA 4D02A 3L8YA 3AVYA 3GAMA 3PEEA 4HWPA 1P73A 4IIDA 4YFYA 4F9FA 3T7JA 4NJOA 4HWRA 3WYCA 4CM9D 5FHQA 3QBVA 2P2CA 2B2NA 3A1DA 1DSSG 5TMPA 3VKGA 1XU9A 3KEOA 2GHIA 4AS3A 4XVQA 4QNMA 3BJIC 1IMJA 4S1TA 4ZQFA 4BFSA 4C2BA 4YAKA 4KXXA 1ISMA 5DI3A 3ZGXA 1MJNA 1KJ8A 2IF2A 1MGPA 4PWYA 2XCIA 2WC1A 4KACA 2W4MA 1QHHA 4BNGA 1W48A 4RU1A 1E0AA 1IWOA 4RDIA 1E77A 1S01A 3COVA 4MVXA 4Z9YA 3V8VA 2WILA 4OQXA 5D01A 3KWLA 3D3JA 4S12A 5TQ2A 5LN1A 3D2CA 3BKWA 1ZL0A 1VM6A 5AVWA 4YIHA 3RT9A 3NCTA 1UBTS 2E4AA 4ALNA 1IEXA 4WCFC 2FW6A 2YWXA 1E79D 1MV8A 2VDVE 3ZV4A 1MFZA 4MZXA 1NOIA 4IIXA 4NNOA 3REGA 5JNVA 2P9BA 4LMPA 1HEIA 1QR6A 4MPRA 5ICFA 5J5AA 2IT1A 1YAJA 3UWPA 5LKAA 4WZBE 3E5RA 1P2VA 4D9FA 3TIGA 3V1TC 3EXHB 3UPUA 1C3VA 1A04A 3ASYA 3IVGA 4E08A 1P91A 3L7BA 4UNPA 4B45A 5J3JA 2NP7A 5JH7F 4J3FA 4WUVA 4C2UA 1IZ7A 5BN3B 4Q01A 3I72A 1PDWA 3UPDA 4KHPB 3EC7A 3OMXA 2OZPA 1L5HB 2QN6A 2DBYA 1Y6QA 4Q37A 3MPUA 1YWGO 2P3OA 1XDUA 3I92A 3OQ6A 4LJ4A 4M36A 4HYYA 2GWRA 3AH8A 4R1MA 4FMPA 4F5YA 1HO3A 1CFZA 1GU7A 2VLIA 1ES9A 1YS4A 2V9PA 2GJAA 3F7MA 3RLIA 1HEUA 3FNQA 1O94D 3GG9A 4KXUA 3T15A 5C32A 4QZVA 5HM6A 1OLSB 1XELA 4KNWA 4JOSA 3D1VA 1S3SA 5JMOA 2OO7A 2MSEB 1SBTA 1YUMA 4QU9A 4WN3A 3AF1A 3KR1A 4IZ6A 1RQRA 2JGJA 3SIPA 3X2FA 4AG3A 4WK6A 5HRAA 4RJ2A 3X1MA 1PDVA 2HWYA 4LOLA 1OI7A 2OXCA 4Y9UA 4DLPA 1OX4B 2ZTLA 2CV1A 4TS3A 3IBSA 2C94A 1JR6A 2Q50A 1SHZA 3C98A 2J31A 3SEAA 3VPHA 3LE8A 4W5JA 5LD2B 2OO3A 4MI1A 5JD3A 3NBZC 3SSNA 2A35A 1RJDA 3OCXA 1IQRA 1YDWA 4ESEA 1X1QA 2I4RA 2YCLA 2D5BA 2PGJA 5AJZA 4LA4A 3B51X 3RRNA 1ECFA 3PNSA 1QWUA 3BILA 4OHYA 2BUAA 2WOJA 4IQ4A 2AQHA 3O4GA 1M7BA 2VC2B 1HLGA 2AI2A 4OK5A 5P8WA 1H3EA 3WK7A 5DYWA 3ZCPA 1B6SA 1QE0A 2G6BA 2I2DA 2R751 1SZJG 5L6MB 1PZXA 2DJIA 5BT9A 5BXYA 4TYYA 2B3DA 3KYCB 5ED0A 4WDQA 3ORYA 2Q62A 2DKFA 2QX8A 3KTOA 3IV9A 4U3JA 4W99A 4F72A 5JSHA 2H1FA 3OC0A 4ND8B 1WPQA 1UMKA 3BUIA 3BZUA 3EGOA 1F7VA 3TFWA 2O3RA 4F6LA 2EV9A 2QLLA 2O2EA 3ANXA 3D3EA 4Z3DA 5J4VA 1RZ3A 1TLTA 2ONYA 3U2QA 1ZNQO 1KKMA 2H0RA 3GWZA 4C5CA 3VEAA 5HJ7A 3BVVA 2QROA 4HMPA 5JBNA 5K3BA 1UXOA 1NNSA 3C5HA 5U4QA 2D8MA 2IIPA 4L5JA 4OHCA 3RS4A 3I52A 3VSDA 4YALA 4XDHA 1H2EA 1RMQA 1UQRA 3BWEA 3RUAA 1PX2A 2Y1WA 1V2HE 2BHLA 3RVDA 3EJ6A 1K5DA 5KX5A 1W5TA 1XP5A 1U9CA 2GDJA 3KSRA 3OIDA 3QYAA 4KK4A 4DARA 5ECGC 2FW0A 1TIPA 1NVEA 2D3WA 2DPYA 4X85A 5LQMA 1W94A 1ESDA 1YOVA 4G5SA 4AROA 1GN8A 1M6HA 2W83A 3C7TA 5CNMA 3ZTTA 2EGGA 2ZRDA 3D6FA 2KLHA 1P9RA 3HA5A 1E3LA 4ZPXA 1NNLA 1V26A 3LDUA 5FTKA 1PNTA 2XMPA 1HV8A 1EFVB 3ESQA 3F98A 3LHKA 2ADOA 3H3FA 3K31A 3MCWA 3KUDA 4CM8B 3SHTA 3JQAA 3QKRB 4NH0A 1P9LA 3UTDA 2EP8A 3D4PA 1X7ZB 2ZIAA 3PFHA 4R0VA 4Z7NB 4ZZ0A 4YRBA 3WGOA 4ROTA 1MZPA 2HCRA 1WA5A 1I2BA 2OXRA 3FKSD 3Q3EA 5CPBA 1ILWA 3MOSA 5FOWA 3FG9A 1M66A 4EW2A 5CJ2A 4E2WA 2P9ZA 5GV8A 4Z3OA 1XRSB 1P4HA 4W7HA 2DRIA 1D4FA 3M34A 4W9MC 1DO2A 1JQBA 1QRAA 2IPMA 4INOA 4ICIA 5HE9A 1NI4A 2SCUB 3O3CA 1QC5B 4IGIA 4YMSA 1E7MA 8MHTA 1KMQA 2P8JA 4P3PA 2Q5IA 1M5TA 3N86A 4WOPA 1UANA 2J46A 1X86B 2JZCA 2PZKA 3JXEA 3L93A 3SOPA 3VKWA 1ZGZA 4ARSA 2BGGA 4Q48A 4G0MA 1QH0A 1YHNA 3MT0A 4KMRA 1KOFA 3UCEA 5K8CA 1XZLA 1W96A 4BBJA 3V1KA 2P6OA 3ESZA 4EG3A 3WLOA 2NNLD 3AVPA 1OAAA 2MYTA 2QSZA 1DX9A 5EMLA 4GPEA 1EQAA 1DIHA 1KOLA 4BEJA 3QF4B 4EG6A 3SQWA 1XQXA 2IDJA 3F6RA 3P9KA 5K20A 4NXMB 1CV2A 1UJMA 2L42A 5FUXA 4AK9A 1TRKA 3EGXA 4LDRA 1AN0A 1CRQA 5IM4A 3L46A 4Q4JA 3WYBA 1DIBA 3B1WA 3KG2A 4GMKA 4EG0A 1GGVA 2HT1A 2O52A 4RHYA 1DE0A 1XDDA 1O7JA 3KCNA 4YT5A 4C05A 4HAOA 4WBNB 4RPCA 1Z08A 3SS7X 3HR7A 3BH6A 5B58C 2HQOA 2X2OA 2HDHA 3RVBA 1J8YF 1KYQA 4Q9DA 5DK4A 1YAHA 2X2PA 2QD3A 3QEJA 5EIWA 3S2IA 4B8WA 1X6VA 3OQHA 3UJNA 2GJ9A 2P40A 3DMDA 2DR3A 2W6PA 1N0IA 4OYRA 4J07A 2O0LA 5J1TB 2GFIA 4U2KA 4M22A 4XSVA 3GB9A 5CU7A 3WGNA 4PSVA 1IPHA 2CFOA 3CLUD 1L7NA 2EJUA 2YDXA 2NUTB 2QXUA 5KWIA 1RZVA 2D1QA 3WB1A 3VKHA 1P45A 1UBSB 5HQ3B 2ERCA 2JI8A 1TM1E 2QUIA 4HBZA 2G70A 4BNFA 4OBEA 3AERA 1MVNA 3IDAA 1MX9A 3DXXA 1Q7EA 2V7VA 3DCNA 4H2DA 3IP9A 4JFRA 1DFIA 3D59A 4TTJA 2LW7A 1Z2NX 1BHO1 2SKEA 2Q3JA 3B1YA 2PCLA 5C7OO 3E9QA 1I5EA 5KYXB 1UC4B 4CEJB 2F8SA 4ZT7A 3PUYA 1JPVA 3GEIA 3WKCA 1M10A 5DZSA 1CY2A 3IKVA 3WZMA 2G6TA 2GD6A 3FFWA 2YXEA 5DM1A 3HWRA 5DLDA 3BAFA 3KSMA 4ERXA 1LI4A 5C5IA 2GEFA 1L8AA 3TOCA 2GLTA 2SKDA 2UZ4A 1Y6ZA 2HK6A 1CJCA 2RDMA 3FNIA 3THYB 2IHYA 3N75A 3U62A 5ANRB 5CIWA 1I94B 1JG3A 4C7XA 2W6OA 3T1QA 2FPKA 4Z7OB 2B0CA 1TQ6A 2E4ZA 4R6XA 1OXUA 4OTZA 3QFHA 4Q7MB 2BJVA 1MHTA 3F90A 4IIJA 4Y2QA 4F46A 4ZV4A 1WX1A 4FHCA 4G09A 1ATZA 3EGDB 3NBQA 4J2HA 3D2AA 3URMA 3F73A 3WIEA 1F0NA 1DTWB 1X77A 4IG9A 4PX5A 4QT4A 3P94A 1W4RA 2XWQA 3KZVA 2V98A 2AZMA 3H1PA 5TGZA 5IC6A 1KYVA 1KEPA 1Y80A 3FJOA 2NZWA 1O7DB 2CZCA 2O3TA 1MAAA 2BKUA 3PUVA 3VPGA 1RRGA 1ANKA 3ER9B 2FZ4A 3JD3A 3KKZA 3KHUA 1YR1A 3Q0EA 4JL5A 3G9XA 3SQLA 4C08A 4G4SO 4UOQA 2D1YA 5GJWC 1WCIB 4RE5A 1DWOA 1AGYA 3D50A 1K6EA 2G36A 3H9GA 1V6SA 3B3QA 3R24A 3JYPA 3RG8A 3SYTA 4GNRA 5DSTA 5JZVA 1M2OB 2VL7A 3H8VA 3QVKA 4QL3A 4CLXA 3L7IA 2GPJA 2Z5FA 3LVTA 4FHZA 8GPBA 5K0JA 4NCBA 2XXAA 1R9JA 5TPWA 3I5UA 2WDZA 5IHPA 2VOJA 3Q6IA 1BMFA 4Q3BA 1WB4A 3IR7A 1R8YA 7MHTA 2QI9F 2V96A 3LYUA 4TTQA 3S2FA 1FUIA 3DOJA 2I7XA 1QIKA 1X9GA 4XWGA 1BX1A 4H6WA 5TGDA 3KYBA 5IVKA 4WZ6A 2D0IA 1LWOA 4DV0B 4U7JA 4RLSA 2H8GA 1PJ4A 2YRXA 5AKGA 5JI3E 2G06A 4DCNA 3SMQA 3WK5A 3ZLVA 4EGFA 1SXQA 1T6XA 1QS0B 2FNAA 3U48A 5K2OA 4BP1A 2GZRA 2N42A 3DFFA 3KIPA 4U7HA 4EATA 2K6GA 5LQRA 3ASZA 1MNQA 2O2YA 1J8VA 2QVXX 3E1KA 1PP4A 4JN6B 1EXMA 3U37A 3FPHA 1J8MF 2P3QA 4GRAA 2WJHA 4ZCSA 4A6DA 5JC1A 4L4ZA 3DH0A 2AMVA 1CFJA 2JLUA 1LZKA 3GGOA 2CKMA 3B8EA 3U4IA 3OQBA 1N57A 1JHAA 1I3NA 1CUJA 2YWRA 1PT6A 4UAVA 5FWXA 2YXLA 3S44A 4B2PA 3KL4A 5EUMA 4E4YA 3WNQA 1K08A 2EXXA 3CPJB 3BQ9A 3QX3A 3EXHC 4K03A 4FB4A 4JT8A 5AXDA 1OWPA 4KVAA 3QXXA 2WK1A 4YRAA 3UMYA 1ZDMA 4JLDA 3L84A 1RQ2A 1PJLA 2HB6A 3Q8MA 4FI3C 1X1SA 1SKQA 2RGBA 2X0JA 3HU2A 1W4ZA 4YP9A 2ZRCA 3A6FA 2VUUA 1L5OA 2PFGA 3BGSA 2G9RA 3LK6A 4XUEA 3UHPA 1EFLA 1YTUA 4S1NA 3EA0A 1F3OA 5EVJA 1FQJA 3T0FA 3ZGLA 1YB1A 2JIZA 2VYND 2FPXA 4EAQA 1NI5A 2JHAA 3TBHA 5G0SA 2ZUDA 3AUJB 4K6CA 3IUYA 2X0NA 1TF2A 1D4AA 3OO0A 4Y0NA 5CLQA 1N2JA 3SHWA 5CFOA 2VYCA 2Q2VA 2OKCA 1K2VN 2CF6A 2PS1A 1HEYA 2QP3A 1ETUA 4GOOD 3BF7A 3CV5A 1A9RA 2LIVA 3L8DA 5COQA 5JAZA 3O3MB 1E5TA 4W9NC 3FNGA 4GS5A 1VSUA 4QXAA 3OLQA 1XTIA 3CR3C 1EAYA 1WB5A 1YJXA 4JJEA 4QFDA 4YASA 2WA2A 4Z0HO 4HRXA 1J5XA 3PNVA 3P2YA 5TARA 1KEKA 2EDAA 3PQ7A 4YLEA 3EBOA 3L6DA 4JK3A 4MXDA 1G1MA 4MV9A 4Z51A 5IC5A 2QBYA 3SWWA 3V55A 2AZXA 2J85A 1CZKA 4DLWA 4QWWA 4AKSA 3KU4A 3SSOA 2YJ4A 5HKKD 1FTNA 3LA6A 3VVCA 5H1YA 3UUGA 3L7CA 3OCCA 2XAUA 1DOHA 4KX3A 4OKSA 2CV0A 2BMWA 4JT2A 1LJUA 4X1YA 2K5UA 4EABA 3BD6A 1K5GA 1T2AA 1KBQA 5EWJA 4IKPA 4M9SA 5I9TA 3WS7A 5K6AC 4HH3C 5CVEA 1AKUA 2OFFA 5K5EA 2A5JA 4RHEA 3OZSA 3DO6A 4NZYA 4UNRA 5M34A 4E81A 1KO7A 1BFUA 1D4ZA 3FMGA 4B3MB 3GMTA 2CWDA 3BBPA 4BLSA 3KHTA 3F6SA 2JCVA 3KWJA 4RSMA 4AL4A 4PAWA 3W9BA 3BG5A 1DIRA 1DQYA 3ETCA 4A8TA 2DHQA 1RXCA 3ZDCA 3IQGX 5F76A 3RRYA 1UPAA 1WCWA 1X70A 4NOLA 4TS1A 4D3DA 2BSQA 3LLUA 1S2GA 1A2BA 3E22B 4J9UE 3ESYA 4ND3A 4URXR 2A3RA 3AP3A 3MHPA 3MQFA 4RABA 5EZYA 4BX2A 4EL5A 3DAHA 4O6VA 5FUVA 5BMVF 3DBHB 1OIXA 2C4HA 1F8UA 3K0EA 3OWXA 4HWTA 5AOVA 4OIFA 4NATA 2X0KA 3GMDA 3NJ8A 3J7AC 1O6ZA 2C9YA 2F3PA 2FFBA 2PLWA 3KPVA 2JKZA 1I51A 1BCRB 1RBYA 2X6QA 3OEHA 3CRZA 4OL9A 1QLHA 2BPOA 3HCNA 2GCGA 3K9WA 3KAWA 3MMXA 2QL6A 3ZCRA 1XQ9A 3RS5A 5E9QA 4YWJA 1JHOA 2J07A 2NV2B 3UT6A 4AKIA 3P32A 3CSDA 4DRZA 2EKZA 3UMMA 4DCNC 2WFLB 1EVLA 2GSDA 2GAFD 2Z9BA 3A2MA 1SC3A 3L6RA 1I1NA 2AG0A 4YT4A 3IAEA 3WQQA 4UARA 4AZ7A 3ZHRA 2DT5A 3USES 4MO9A 4GRIA 1J5EB 1RAEA 2PAAA 1JIKA 1P18A 3A25A 5LP6C 1KZ4A 2Q5FA 2XGGA 3IVCA 1XQYA 1QLJA 3AXTA 5K6TA 2AWNA 2VSOA 3WNDA 5LWQA 1XTPA 2C5EA 2H59A 2G5CA 4GH5A 3KDAA 3GBPA 3SKVA 2FEMA 1Y5IA 1T5BA 1TM7E 4JYPA 3K2QA 1ITZA 1WZEA 4S2UA 4UM9B 1CZNA 1D7OA 4DA0A 4CIYA 1ZGAA 5BWMA 3IQIX 2MSDB 5IW8A 2R2AA 1PAUA 2CL6X 5IF3A 2HU5A 3NDIA 2I2AA 4D82A 3I6IA 4WKOA 4KBGA 2WWWA 1V71A 5ALJA 1FSFA 4BVEA 2QRKA 1Z2PX 2A1TS 2F9FA 2OAQ1 2YV4A 4I1OA 3G59A 5K45A 3QH4A 3UAOA 2VSQA 3OQ1A 1HX7A 3EYWA 4O8CA 4BEWA 3JQPA 1ISGA 4RSGA 1E0JA 2EG9A 4LZZA 1DBPA 1EINA 1AS3A 2IHJA 1Y89A 1X1AA 1G42A 1KZ7B 1TUBB 5JXWA 3LX6A 1OHHD 1P74A 1E0DA 2XGOA 3F71A 3LWNA 4QJBA 4WQMA 3K0HA 4AKEA 5KVVA 5AKLA 1JA1A 1DP4A 3LY8A 2ZTSA 4AN1A 1KI6A 3KP1A 3PGLA 5F51A 5JS7A 5MN4A 1YVRA 5CT4A 3FR7A 1E3SA 2PLRA 4DSAA 2EF1A 2IY9A 3CE9A 3S68A 1IBLB 4HD8A 4HH4A 2NZJA 4CV0A 2ZUCA 1YQEA 3O74A 4MR8B 4O08A 3KQUA 2NSDA 3IUPA 3L41A 4RQUA 4JWIA 4B34A 3KE8A 4QBTA 1XLTA 4N0MA 1KDVA 2QM8A 3H6HA 5KDDA 2D5LA 1XQ6A 1DKLA 4OOEA 1JIQA 1BROA 3SEFA 2VR1A 4TTPA 4DSNA 8ADHA 1U9IA 4G36A 2ZIFA 4BNYA 5TEVA 4C3OB 2Z0OA 3FRJA 3NW9A 2BBTA 1N92A 1X74A 3M3DA 3B3AA 2O1WA 1PR5A 4MGEA 4L5IA 3WJ2A 4EA6A 2KHOA 4NOMA 1HC7A 5I7WA 1A95A 5IJ0A 3G23A 2B8JA 3MJHA 3U56A 2CHUA 2FB9A 2O6HA 1ZH6A 1F4PA 3E4DA 3GAAA 4TS4A 3TLMA 3H8JA 4D6YA 1I4DD 1VE5A 4P82A 4CMIA 4KKVA 1Z2AA 5T8KA 4L8YA 1MC4A 3LUGA 5H59A 3IMFA 2W6MA 1R12A 2HNAA 3GRFA 2UZ1B 3LOQA 4KEAA 4I3HA 1RWNA 2BUBA 3LHIA 3GY0A 3U3KA 5AW2A 3JD4A 4AN4A 1N33B 1P17A 1H2AS 3GJ8A 1NRIA 3R0IA 3SZRA 4EKIA 4QAQA 4V1CI 4GQAA 1N5RA 3VC2A 5EP2A 4CNBA 5K99A 1IULA 2YZMA 1HH4A 2AIRA 4U6QA 2YZGA 3KZNA 5EPEA 5FTLA 2ZBFA 5I7EA 1J7KA 1UP6A 4PQFA 4AVMA 4EZUA 4BYGA 1WULS 4G4GA 1M2JA 5DBGA 4ZYZA 3U4AA 1UMCB 3T7EA 3MGAA 3RUDA 1MTZA 5GGYA 5HKBA 4P0QB 1PFUA 4WESB 3G2KA 1CC1S 4MWOA 1JMVA 1ZH0A 3DZJA 4JB3A 1NUHA 2E85A 5JSFA 1V96A 2SHKA 3OJWA 3R5KA 4N8SA 4U6NA 2WF7A 3LHSA 4K26A 2REQB 1GZ4A 2W2XA 5FA6A 1EUZA 3DLCA 1KJNA 1G9SA 1KYWA 3OCUA 3WYGA 2GZ3A 5BW6B 3L49A 1JAZA 1UM8A 3ELWA 4DHWA 4DGSA 3S28A 4HDAA 1JNXX 2JFYA 4AY3A 3OE5A 4F6RA 2OCGA 4U02A 2ZUEA 3JZIA 4PC6A 4KW7A 3AI1A 3GLGE 1U8XX 1ZN8A 2OO5C 1E4EB 2JGLA 1NPTO 4K9OA 4KL8S 1E5DA 4FIZA 3TL6A 3UK1A 4D9GA 4ZI7F 1Y8RB 1TD9A 1HDIA 1DG9A 3VR5A 4N12A 2GEUA 4QRHA 2VHQA 4ZO6A 5EA2A 1FMCA 5DWQA 1TVMA 5FWNA 2CV2A 4DA8A 3CFYA 4RV5A 1QIGA 1Z4OA 3RGGA 4KGVA 1NVGA 3O94A 3CUUA 2M1XA 3RVJA 5IT9A 1IJEA 3OLXA 4EA9A 3L6BA 1CS4C 5C80A 4MA0A 1MOZA 4XIIA 2FCRA 2QZ9A 4HF7A 5EJIA 4YRSA 5L95A 2ZIGA 1KJZA 1ZM2A 3HDVA 4HH1A 4UUOA 3TG2A 1BD4A 1Q6YA 1PE0A 2YVKA 2X1LA 2X5KO 3NLLA 4BUJA 2G8LA 4MGKR 4N39A 4NEGA 3ZQUA 1PJAA 3AHEA 4H3HB 3HYTA 2BGJA 5EN4A 2A0UA 2ELBA 5CDFA 4YUAA 1G5IA 1UXGA 4DCJA 2RH8A 1UPUA 2QAJA 5GZ6A 4KQIA 1FP7A 1