3O3NB

(r)-2-hydroxyisocaproyl-coa dehydratase in complex with its substrate (r)-2-hydroxyisocaproyl-coa
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
374
structure length
374
Chain Sequence
b'MEAILSKMKEVVENPNAAVKKYKSETGKKAIGCFPVYCPEEIIHAAGMLPVGIWGGQTELDLAKQYFPAFACSIMQSCLEYGLKGAYDELSGVIIPGMCDTLICLGQNWKSAVPHIKYISLVHPQNRKLEAGVKYLISEYKGVKRELEEICGYEIEEAKIHESIEVYNEHRKTMRDFVEVAYKHSNTIKPSIRSLVIKSGFFMRKEEHTELVKDLIAKLNAMPEEVCSGKKVLLTGILADSKDILDILEDNNISVVADDLAQETRQFRTDVPAGDDALERLARQWSNIEGCSLAYDPKKKRGSLIVDEVKKKDIDGVIFCMMKFCDPEEYDYPLVRKDIEDSGIPTLYVEIDQQTQNNEQARTRIQTFAEMMSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alpha-subunit 2-hydroxyisocaproyl-CoA dehydratase
molecule tags Lyase
source organism Clostridium difficile
publication title Structural Basis for Reductive Radical Formation and Electron Recycling in (R)-2-Hydroxyisocaproyl-CoA Dehydratase.
pubmed doi rcsb
total genus 156
structure length 374
sequence length 374
chains with identical sequence D
ec nomenclature ec 4.2.1.157: (R)-2-hydroxyisocaproyl-CoA dehydratase.
pdb deposition date 2010-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06050 HGD-D 2-hydroxyglutaryl-CoA dehydratase, D-component
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.370 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3o3nB01
3.40.50.11890 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3o3nB02
3.40.50.11900 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3o3nB03
3O3MB 3O3NB 3O3OB
chains in the Genus database with same CATH superfamily
4Q16A 2D2EA 4M0CA 2JFNA 4UCFA 1YI0A 3WQBA 1TVMA 1Y5LA 1KI7A 2OO3A 4HAOA 4K6OA 4LEIA 3UFXA 3R0QA 3WNBA 1Q1AA 3N5CA 2FZ5A 4AF8A 3OQPA 4TZKA 4GD3Q 4E11A 3EG9A 1XLUA 2GBIA 4I4NA 5G41A 4FMCB 4NONA 3A6JA 1O1YA 4C2BA 3OQVA 1MNQA 4ZT7A 1V5FA 4IFIA 4Z5XA 1D09A 1WXQA 1Y33E 1U2EA 1YO6A 2UUPA 1AMOA 1E8NA 3N2GA 4I66A 3E2IA 5CFZA 3H4VA 3BN3A 1JR3A 1IZ0A 3QOXA 3K53A 1QX3A 2ZYWX 2BI7A 1PGOA 2V55B 1SWWA 1D2HA 2V65A 2OCGA 2HF7A 5BW6B 4F45A 4EHHA 3CCCA 4IYRA 4M54A 4QD3A 1J07A 5LL6P 1D07A 4RH1A 2JFOA 2JFWA 2PX0A 2GPTA 4P3PA 4PAOA 2PT7A 3DD5A 4EG4A 4RA9A 2VTBA 2C7RA 2I3AA 1E96A 4WNYA 4Z9FA 4LDJA 3VPSA 3P8ZA 4ZICA 1TZ2A 4HLCA 3DL2A 4BGIA 2FZVA 3A9UA 3O0DA 1FUUA 2CMDA 3GBSA 1CQJA 1BHO1 3HDGA 3SVTA 5KNLA 2VZEA 3QEMA 2BGGA 4OL0A 2ZRAA 4IDEA 4ZI7B 2ECQA 2IUYA 4BBAA 2VHJA 2FW8A 4UHCA 2UYYA 3DXFA 1W0KA 2O1XA 3CJQA 4DUGD 1R3UA 3IKMB 1YCHA 3DKPA 4MYCA 4JEIA 2XY4A 4AMVA 4UPEA 1SVNA 1CLEA 5BSEA 3MUEA 4I08A 3VR2A 1LBEA 5F7JA 5E7MA 1Y8QB 4LNUA 5GZ3A 5JATA 4DAEA 1KYQA 1DGQA 1H2FA 3V4FA 3T34A 1PF7E 3DM5A 2FP4A 2QDKA 3NVAA 4X7PA 4C6HA 3HM2A 4BCDA 3B7WA 2OBYA 4OFWA 1I80A 1EQ2A 1HE5A 2Z0MA 3PEUA 3W2EA 4XWKA 3G2KA 1OLSA 4FONA 3TW6A 2BONA 3W5BA 1DTSA 4M88A 5CFLA 1KMMA 1R15A 4IMIB 2O8FB 1P7CA 1CNEA 3I92A 4M55A 2HUPA 2ZBEA 4G25A 4EMTA 2VSFA 4M60A 1JJFA 1NVKA 2P62A 2QZPA 1IN6A 4DDKA 1Z2PX 5CXXA 3Q5EA 3H16A 2VZ8A 3AU8A 1E4EB 1W36B 5AKLA 2UYOA 4DHEA 4KJZA 1URUA 5DWDA 3LIIA 3DEHA 3KEOA 1Z39A 4RVUA 2WAMA 1F9AA 5BVGA 1V35A 4ZOLA 2F7OA 1A2OA 4GM4A 2ACVA 2A1UA 2CVQA 3RU3A 3U7IA 4CQLA 2E5LB 4INPA 4ZANA 5H02A 5KTRA 3L5KA 1ISGA 5JJ5A 4QU8A 4I19A 4RMIA 2JLZA 3V4OA 1N3LA 5AM1A 4G1VA 2SKEA 1Z06A 5IHPA 4EBFA 2JFFA 4OSPA 3HCWA 3BREA 1TT5B 2IHZA 2GN1A 4F2PA 2O23A 2PANA 2CUZA 3LU1A 3PHLA 4NE9A 1QFSA 1UDAA 5P21A 2ZJ3A 4DILA 2QVLA 2CL6X 3KOMA 4QXPA 1GFSA 2LCQA 1JB1A 4MZDA 4V1CB 2B98A 1HQDA 4J3JA 4IS2A 4P7BA 4CR7A 2VJOA 1CQXA 2RGWA 1YMQA 3QFRA 1HG1A 3D6UA 1E7WA 1JV2B 4HB0A 3PXGA 5LQKA 1W5BA 1R9MA 4E70A 4WX2B 1M1YA 3OG9A 5GM2A 4HTFB 4XUDA 3K5PA 2GB4A 3GJ3A 1KFKB 3I2JA 3K3PA 4OQYA 3T52A 5L4NA 3W34A 4RF3A 5CVTA 1FA9A 1N5DA 5KMGB 1RWQA 2OZEA 3U3RA 1B8PA 2O7QA 4EQ6A 3V4RA 1CY2A 1BMQA 2XUJA 3OH8A 4UM7A 3MRVA 2I8CA 2X13A 4D9IA 3EZYA 2RSLA 3DDUA 5EUBA 2CBZA 3EDMA 1HDRA 3B2QA 2I4RA 4FYIA 1ZPDA 4R05A 5CLLA 5HKLA 4IXNA 3CVVA 3QA8A 4QRDA 3MM4A 2RI1A 5IVHA 3O3MB 1DQPA 1XZLA 2WU1A 3I9JA 4XOUA 3TSZA 3ZVNA 4P22A 4K6FA 2FE1A 4GXRA 4H2DA 3IOCA 4HGOA 4LJ4A 1V41E 3DPUA 2Y4OA 1KAHA 1U5CA 1WB4A 2XRMA 3DJYA 3M4XA 3UXMA 1XK7A 5F2OA 3OTWA 1QRRA 3LUAA 4XDZA 1IOWA 4ENSA 4KNYA 3NDIA 4BFWA 2ACEA 3X2FA 1YZYA 2ST1A 3UKDA 2BN4A 3L7NA 3HBFA 1E63A 2IODA 3HUTA 4PIPA 1U7TA 1IIBA 4KNVA 5KYKA 4F7WA 3MFYA 4I6JA 4LFBB 4UFNA 3ZTTA 4HGRA 2XTNA 3MTBA 3PA8A 4JJ8A 4OHOA 2ZPUA 1T0PA 2L69A 4O2AF 4DNXA 4ZCTA 1UXGA 3H4MA 4AZ0B 4C5AA 2RMKA 1ZGJA 3ZE1B 5HZMA 1M5UA 2ZSBA 1JEJA 5KTMA 1ANKA 5ARDA 2Q3BA 5A1TA 1M1ZA 1FFWA 2KMLA 2XNHA 3G2HA 1O77A 3AR8A 1LPAB 2FJ0A 1T8RA 3HJNA 4N9WA 3VV2A 2ALJA 1DX4A 1N6PA 2Z3ZA 1M54A 3RFCA 4IOMA 4J9UE 5IYZA 5KOYA 1U00A 1DWPA 1MG5A 5DNEA 3WP0A 4CU5A 3UN1A 2WWGA 3W8FA 5IXJA 4JC4A 4AB1A 4GBGA 3TNDA 4U7FA 4Q3BA 2OLJA 4B34A 4EG3A 4REOA 2EYQA 1P9RA 3SFZA 1Z4QA 2VI5A 1H1DA 4LK2A 1SCQA 2RKWA 4FFOA 4TQ9A 5JMPA 5HM6A 2Z6AA 5CYOA 2HIAA 1QK3A 2ZUSA 1XWFA 2CXXA 2F90A 2Q4BA 3IT0A 4X92A 4QUHA 3WQHA 2G07A 3SFTA 4YCLA 1E4EA 3Q9UA 2I7TA 2ZI3A 3LG2A 1LPOA 4JOCA 2ERYA 4AJOA 3ZCQA 1G3MA 2IUTA 4MR7A 4B84A 4L27A 4RK1A 1B1CA 2ZETA 5DGDA 2C08A 4CUKA 2NVUA 3QITA 1C9EA 1KBQA 1FXWF 4M9UA 4MYTA 3RAEC 2F9FA 1SKYB 1IQUA 1G19A 2GTPA 3H11B 1DAIA 3JRNA 3QM1A 3R3YA 1HT3A 1GUFA 3D4BA 4YGYA 1NC3A 1ZUIA 4UQPA 2JD1A 4PLZA 3PX2A 5K8LA 1SG0A 3GIDA 4M7WA 3COJA 2N3KA 1BGVA 1W1UA 4MICA 4YAEA 6NULA 2H2HA 1OCEA 1ZHFA 3LGXA 4HQ6A 1DQSA 2NTJA 1EVZA 4Y2RA 4ETNA 2I80A 1JGTA 4JP1A 4YUZA 3OZBA 1DXOA 3MS2A 1WR8A 3NM5A 4DVJA 1D5WA 5GVSA 1IPEA 2EJTA 5JDIC 1NVVQ 1ONPA 2FEXA 3OFJA 5CW1A 4EYQA 3GUCA 2PLRA 1GPYA 2HKIA 1B1AA 4LQLA 5J3JA 4WIAA 2C58A 3WGYA 1TVKA 4FDLA 1J5PA 5EWMB 1YD7A 2CDRA 2WHYA 4BATA 3CONA 2EW1A 3K9LA 3RUAA 3QEMB 3A6ZA 3MTIA 1FVFA 4K26A 3E22B 2OXFA 1CVRA 5KSPA 2B8JA 2G1UA 1JI0A 3JQBC 4G09A 1E69A 1TW3A 1VL5A 2P1ZA 2PKXA 1PJCA 4G0NA 4N6GA 4UEWA 5FOQA 1HNZB 4KSBA 1WD5A 2ZRIA 4X44A 3PZBA 3SSOA 3DHEA 1BQ4A 2HI0A 1F0PA 1C9MA 4YK7A 3FRJA 3CHYA 5T4HA 3OAAD 4NPHA 5KOIA 3MSXA 4GMHA 3ZOZA 3HK2A 1SA0B 1Z2AA 3COVA 4ZO9A 4CQMA 3AUTA 5CB4F 1GM5A 1UPTA 2FUKA 3RUHA 4ASUA 4F7DA 1LDEA 4W5TA 2ISQA 2Q2OA 2R48A 3VR3D 1RMYA 4ZIRA 3N6RA 2NZYA 4ZZ3A 3EEYA 3PWTA 1TU3A 1NRXA 3PX3A 3W3ZB 1DFHA 1PEKE 3NH6A 4M7PA 4LRUA 5D01A 1WIWA 2HK9A 3IV9A 4WE3A 3ILYA 3I01M 1P1FA 3KKPA 3KQVA 4DY6A 3E8MA 4CCYB 1UZUA 1SK9A 3DSRA 2OILA 3DMPA 4P3KA 5CFMA 3X1KA 4LXUA 4C3UA 4JX9A 4Y2VA 1ZOOA 4YXWA 2F3PA 4IIYA 3W4KA 3LT0A 2OPBA 2Z4SA 2ZCVA 3TZQA 2P69A 1QTIA 5DCLA 5L7YA 1SRQA 1C0KA 4GGMX 2Q4RA 2VCEA 2CNOA 3SQXA 4MUEA 3KDSE 3L7BA 1OWNA 1SKBA 4XH9B 3DTNA 4RSMA 1EE1A 2KYRA 3EPKA 2UXBB 4K7JA 4WKOA 3CE6A 1NU6A 1TM3E 4BWFB 4EPXA 1B2LA 4AZ5A 4MRPA 4EZVA 2BP7B 3C48A 4BN0A 4PYRA 3AR6A 4U2BA 5CFOA 3MT9A 2GPYA 2AN5A 2EOAA 1RZUA 3I4LA 4IWNA 2GHRA 4XM0A 4CF3A 1M7HA 1LWNA 2GK4A 2W2PA 4PLYA 4A8PA 5H83A 1LBSA 3DAFA 5BV8A 5ALSA 3KWLA 2F9LA 4Q9DA 1EBUA 3COWA 4J3FA 5CVEA 4PN3A 1ZM7A 3NW9A 3PNVA 1UKCA 3C7KA 1ZYLA 1Y0BA 1GO2A 2PL9A 1BAPA 1PJ4A 3OZEA 2WINM 1M6YA 5FWYB 3LKVA 2ASVA 2DH6A 3C7NA 2XYVA 1XO1A 2FSPA 3ESCA 2H7CA 3OMXA 1RWXA 4PC6A 1MC4A 8AT1A 5K8CA 3SLRA 2VYFA 3D2FA 1Z2OX 1IZZA 2WKQA 2JA2A 3SBXA 3SKVA 3O8OB 1PDOA 4JROA 2VRWA 3ET5A 1WXGA 2XVXA 5JG7A 2VKTA 1CEYA 1WDZA 2XYQA 2EX3B 2I4OA 3EIFA 3MJTA 4RDCA 3MIZA 4ENQA 3U9SA 1GUYA 1E9FA 3JPWA 3PRKE 3EPHA 5JQGF 3T9AA 3OI7A 1AGYA 4M89A 3FFTA 4Q15A 3ZBUA 5CXUA 1OX4B 2J9YB 2R84A 2GF0A 3MOGA 4WEOA 4JL6A 3QEAZ 1QGED 2ZRHA 4IM2A 1NWHA 3HP7A 4OAQA 2WAOA 3ETEA 2XA2A 2A1TR 2ZP1A 4L8GA 1UXHA 1PBTA 2EF1A 4KLNA 2O1SA 2PS1A 3RUIA 1J24A 3A2MA 4JODA 1E1MA 1WUKS 4G4SP 3SICE 2Z57A 2IFTA 5AQEA 1R12A 1NUAA 2KW5A 3H0EA 4JX8A 1SGWA 3F3KA 5KMGA 3T9BA 3DE2X 4K81B 3FB4A 4NNJA 4RTLA 4KUGA 2C8LA 1SD1A 1V1RA 1DHRA 3GMTA 2IITA 5CVCA 2JI6A 1JTFA 2I7CA 3TE6A 2EIXA 3VNAA 3SK0A 4JXXA 2P9CA 2O7SA 4FEGA 5GV8A 2QAGB 2RDMA 1J9ZA 3DP9A 5J59A 5BWCA 3GBVA 1R34A 1MVLA 1TTHA 1HYHA 4U7PB 4NBLA 1XZDA 2R7NA 1NBMD 4WXYB 1LXCA 2JIDA 4UUNA 5BUCA 3K05A 3QLEA 4Z3OA 2ZTSA 4ZTZB 1EK5A 1KC1A 4PBRA 4M36A 2WW8A 3H9BA 1R27A 2GGSA 2EBHX 1IONA 2HA0A 1RT9A 3VU3A 3SM9A 1XLTA 4HN2A 1ABEA 4RPIA 1PFQA 2NUPA 2WJJA 3D4LA 4NS4A 4TV9F 5C1IA 1P4RA 3KRTA 1IBCA 3KSRA 5AM0A 5AOBA 2ZUFA 8OHMA 4XIFA 1N3BA 4DB4A 4R98A 2W58A 3NG1A 5CR9A 4F4IA 5DO9A 2GFQA 1DOAA 2ZGVA 5ADWA 1N0HA 3AI2A 4GKKB 2XNCA 1B26A 4WFIA 5K0GA 4DTCA 1ADJA 2QD1A 5TNXA 3PWZA 5HKKA 4KQWA 4N7RA 1O9BA 1VDMA 2XNDA 2CV2A 5EP2A 1GNQA 4CODB 3H75A 2NYRA 3OUTA 5HHTA 4S0XA 1PR0A 1MO6A 1ZRSA 1PFKA 1EQAA 4BN5A 4QDZA 1H4VB 1M8PA 1OFVA 1VC2A 1XTJA 3G59A 3KT6A 4V38A 2AG6A 4D8YA 1V7CA 1UJ2A 2PGLA 3B9RA 1RHKA 3DMTA 2HJHA 3KOOA 4MOWA 3RBXA 4IXWA 4BO0A 5LQNA 4TT8A 4LRSB 1FMCA 4MDYA 1O9HA 2FP3A 1A97A 4CM8A 3QTTA 2QN9A 4D8JA 3QMVA 3R8CA 5EZQA 1XWWA 4HEHA 2UUAB 5HKAA 2ZB4A 4GSKA 4L4YA 3S2UA 3WLSA 1YHNA 3X1WA 3PR3A 2E2WA 5M5BA 3LY9A 3HWX1 3P0IA 5DMXA 1O08A 4LHSA 1E1NA 2LTAA 5JPIA 4C0QC 5E4FA 1G16A 1UFVA 2H11A 2GFHA 2HK8A 3GGCA 5NLLA 1U0OC 2IE0A 1N6RA 3AEQA 4ZZ2A 1A1VA 5A06A 5L4LA 4FLMA 1DQNA 3ABRB 2P0EA 2JVJA 2H92A 3QIAA 3L1VA 1O6GA 2AG8A 5EZYA 3PXUA 5I47A 3INGA 4IKEA 4NBKA 3H0KA 5FFMA 1GZ5A 4BNUA 4GIBA 2OR3A 1GDDA 2ECOA 4PS1A 3T12A 1EWRA 1M5TA 1SXIA 1VMDA 1QVWA 3ISTA 4WACA 3KQKA 3TMAA 4TMXA 3ER8C 1I13A 1I1NA 5CG2A 4Q4HA 3RSSA 4O2BB 1RZVA 1TDJA 3ER9A 1H23A 3ELDA 1HEUA 4FMDB 2WYIA 2AEFA 1E1CB 2NVOA 2WZQA 3H8VA 1DQZA 2WJZB 1PDWA 4DCSA 3RYIB 2AXEA 5T4BA 1Z4LA 5DNCA 2DR0A 3C6MA 3GCZA 1IMOA 4YVFA 5H70A 4E5VA 2YHIA 2NT3A 4YMWA 2EC5A 1MB0A 2PKYX 1PUIA 3H87A 3UYLA 1IOLA 5A03A 4GDFA 1R6AA 3QF4A 4MHSA 5TF4A 3QNIA 3HACA 2XT0A 3ZWMA 3HY4A 5DYWA 5G4KB 3JPYA 4IH1A 2C3YA 3UBMA 3EIEA 4AXXA 3PGMA 1ZGHA 3QPCA 3MFQA 1YRYE 3G85A 3V3KA 4BX8A 4DYHA 4DMGA 5HZHA 2ZB8A 1EXDA 2I9KA 3N70A 4WZ6A 3QWFA 3P2KA 3MJDA 3LUCA 2E6UX 3NHAA 3IILA 3D4ZA 2C5AA 1UAGA 4TUYF 2V5VA 3Q9LA 3EDQA 1YK1A 3K72B 1KOJA 4PZ0A 1OAKA 4IZ6A 1KK0A 3ROGA 2UYGA 5SZJA 2VHYA 3JQGA 3QE4A 4Q3KA 4R1LA 3CO5A 3VBEA 4KR6A 4FYJA 1IAQA 3HUUA 3EEIA 3ZU3A 3AP1A 2UYCA 2Q5OA 3MMPA 3UMCA 1BRTA 2G06A 5EHZA 1NVXQ 1H42A 3RV0A 4RA9B 2VTBB 4B82A 2QTCA 1NV8A 4G0OA 5EIXA 2AF3C 1KQOA 3QLUA 1UINA 3TQOA 1HY3A 1AJEA 5IRCD 4IIJF 2B6NA 1P0QA 1R5JA 3A9WA 5DV9A 4MV0A 1FQWA 4JR0A 4L5JA 2BV3A 2OBBA 3UW3A 1NMYA 3D4IA 4XD2A 1G5FA 1OGJA 1P73A 2X7JA 3LX6A 1R8QA 1TJPB 2CMGA 3DV0B 1I4OA 5EQJB 3PEYA 1E2UA 1JHRA 1KP3A 3OOYA 1M76A 2WM9B 2CHGA 2GTIA 4D5EA 1CRZA 1FMJA 4FW8A 4N5HX 1AA9A 3ZWVA 2V7QD 1UBEA 1EM8A 2A4KA 2DG2A 2UZ1B 2MSEB 4JL8A 4RPHA 4TLLB 4O2LA 4YROA 3V8QA 2J30A 3KZKA 3OZIA 4Y0AA 4AKEA 2SBTA 2JCBA 2PR7A 3JD0A 3T1QA 2OP0A 4BOYA 4F21A 1DAFA 5A7FA 1BW9B 1LPPA 1N4DA 1QHHA 1UXKA 2A8YA 2B8EA 3MD9A 3EARA 1H6CA 1Z82A 2YASA 3IPRA 2AFHB 4Q1AA 1D0VA 5C80A 3TGPA 4GI5A 1NTOA 3LPDA 5H9WA 1JHOA 2FH5B 3IEXA 1CG6A 2AI3A 1ES9A 4WLVA 2E37A 5KC8A 3ZLJA 1IJFA 4IFTA 2WHQA 3AG5A 5CGZA 3AEZA 3ZKWB 3FOWA 3K6JA 4NJEA 1UDXA 1RABA 2QRQA 2F8LA 1E1KA 1OFTA 1T0BA 1U28A 2G76A 2I76A 3FPJA 2HTEA 4XQ9A 4KLAA 3WKAA 4TN5A 1YBVA 4YRJA 3UHFA 9GPBA 2ZIWB 3DQQA 3P5SA 3Q2IA 3C5VA 1TYCA 5EA2A 3WYCA 4C4OA 3TPFA 2EVWX 2ZB7A 4BP9A 1U0FA 3FDZB 1HFEL 3D5EA 3U62A 1FUEA 1OV4A 5AD1A 5EJFA 1L7AA 4ZAZA 1R9NA 1XRQA 3BJIC 5L8VA 1CDEA 1VBMA 3PJGA 4RD4A 4FEYA 1T0IA 3UOWA 3ZWPA 4EYKA 3E1GA 1OW3B 3LM8A 2B4AA 1TM4E 2VWQA 1W94A 1I24A 2VDWA 2Z0NA 3I76A 4AW9A 4ZV4A 2BFCB 1E79D 4RVCA 5FBHA 3TAHA 1NOKA 1JNXX 3TL6A 1BE0A 1Q2XA 1MVNA 3CNBA 3K71B 3SC2B 3Q8MA 3UIEA 5B7PA 4GYJA 5A6SB 1FFDA 2YUTA 2PG3A 3AETB 3DWGA 2L2QA 1LJ8A 1QYCA 5BWLA 4RTNA 5JSZA 4NECA 3VC1A 1N6LA 4IGKA 2E82A 1N2OA 4IG4A 1N5RA 1C4WA 4Y3UA 3BTUA 3VM6A 4CPDA 3TGWA 4EARA 4C07A 5BORA 2HLNA 4KUHA 5JS7A 4LTMA 1GLNA 3HWRA 5D00A 4ZCLA 4QJ3A 1G21E 2AWOA 3IP3A 3N74A 5DPMA 2DULA 4TS1A 1CRWG 1NSYA 1OBFO 1DX6A 1KMNA 1M0TA 5FI0B 5H82A 4BNDB 3SYMA 4PLGA 2R00A 2ODAA 1RQ7A 3L6DA 2JFHA 3UTCA 3CWQA 3R9XB 1VMIA 2O2ZA 1M1UA 5JRDS 3CLRD 1G6HA 3WISA 3ZCSA 1BYIA 1QVAA 6PFKA 2PT5A 2W42A 4P4UA 1BXGB 4RENA 3LXXA 1M6VA 1LBQA 2JIRA 3GDGA 4ZMRA 5K03A 1SULA 1M1NA 2EZ4A 2FGKA 2HDWA 1JFVA 1DCMA 4ZT2A 2IH5A 3LO8A 2W70A 4HNQA 3BQMB 3CJRA 4BV3A 3HEMA 2Z8YA 3P5BA 1QIEA 3AU9A 3GGDA 1MO4A 2DT5A 1D1TA 1XL1A 3L8FA 2HF9A 1US8B 4Z8XA 4Q7EA 2GA8A 2OBXA 4HFJA 2IXAA 3MELA 4R5HA 1N6OA 1QWUA 1D9XA 2EDAA 1A2KC 3WL8A 5J4VA 3W5AA 5DNVA 4RJLA 4X20B 1ZD2P 2FK8A 2A9VA 1D2NA 4DIUA 4Y2QA 5K0EA 4MQUA 3UJCA 4HNAA 3VJRA 4NDZA 3WWPA 2ZZKA 5BW5A 3DP7A 3NBKA 2CNBA 2ONKA 3NWBA 4DLYA 4BO1A 5J2UB 2PAAA 1Y8AA 5JWRA 2HIGA 5AUOB 1WY7A 2RGYA 3JS5A 4DQUA 4ZHQA 3BD9A 3FRIA 3TAXA 2B8WA 3RSHA 3GLUA 1LKZA 2BGMA 1XYVA 2WOJA 4BFVA 4YECA 5TC4A 4XM1A 2IW3A 4DR5B 1FNMA 1PQPA 2UYQA 3L92A 2XR1A 4HAZA 4EHAA 4OA5A 3EBOA 3NGMA 4JQCA 3PZRA 5H81A 1E9SA 4WKGA 4N39A 4DCPA 3MJSA 3BWYA 4NPAA 1FQKA 4H7PA 5I9NA 3GJ6A 5TMPA 2WT8A 3LZ6A 2CCKA 1U0JA 3GQBA 2DF8A 1ZJYA 3DAPA 2OHXA 1UBSB 2OMKA 3LDAA 1DMRA 3ONWA 3QLJA 5EKTA 5A5FA 1GGNA 5C53B 2BYTA 1WABA 4I1UA 1T8SA 3CFYA 4MH0R 3OPYB 4RANA 4XKJA 4FNOA 4R8SA 3BXHA 3L49A 3G1UA 4RHFA 1TO2E 1KMHB 1V71A 4HYQA 1GAEO 3H84A 5CH8A 2PXXA 2WZBA 1UMDA 2NO6A 1CU1A 1NI4B 1XP5A 2C5GA 3H1AA 4G86A 4I5DA 3UJDA 2ZAOA 2FEPA 4HR1A 2I6XA 2Y1FA 4A4DA 1WJGA 2OO7A 1G5HA 4BLTA 2NOAA 1KYXA 1RPAA 3KD2A 3P4XA 4JITA 4TS9A 3SX4A 3TOVA 3PXBA 3DCYA 5JHHB 4JUIA 3HCNA 1E61A 1UBFA 1S2DA 3DKIA 4B5LA 3JQAD 3HHPA 3HJGA 5BQ3A 3THYA 4MARA 2YNMC 1P19A 1V39A 1H2XA 5G0UA 1O96A 2ZB2A 4XFKA 3ZH2A 1A0OA 1SVSA 5TQVA 2HA5A 3B2NA 1MUUA 5FNZA 2EP7A 5JRJA 1D3AA 2HRQA 1WG8A 1X6VA 3GVIA 2YZKA 3DTVB 4HWRA 1BD4A 4CDNA 1TOAA 1H8HD 1D8AA 2P6OA 3VNRA 4OJQA 2PGNA 5TV2A 4YP5A 4XQ0A 1AT1A 3A7DA 4M46A 4GI1A 4OI4A 4PX5A 3NVDA 4ZZ1A 4FEEA 4JFRA 3W78A 4CEHA 4KO1S 3LX8A 2Q0HA 1XZAA 1RQPA 1H5NA 5L53A 4L4SA 5FD8A 5EWLB 1XVTA 1XJ0A 1V0JA 3OCWA 5KHLB 4C2TA 1YQQA 4J7CA 2ZTMA 1H05A 2OCDA 5ALDA 5JS8A 4DZRA 2J0EA 3GLGB 2Q1YA 1KYWA 3CKMA 3PDHA 5FPPA 3WK6A 3ZDBA 1QS0A 3RVNA 1U1IA 3RS8A 1XWIA 1SU8A 3AFGA 3NRCA 4CYMA 3L7IA 5AQ1A 1QMGA 4LY6A 1E9BA 4JCOA 1KIAA 1C3XA 3OLWA 1MABA 4JT2A 4R2IA 2C5FA 5G0WA 2RJ3A 2JB9A 5JCJD 5JZVA 3WDLA 4E1BA 5CIYA 1EG7A 1YZKA 2OHVA 3MT8A 5E6RB 4AROA 4F9EA 4J0CA 2VTEA 4OK6A 1A4UA 3HMQA 4BIMA 1F38A 3ZHYA 1HFWA 3BL6A 4H7KA 4MLZA 1Z6PA 3GVCA 1TO6A 4BY9E 1ZMXA 2I78A 1NQOA 3BJMA 3OKAA 3PWSA 4LOIA 1A96A 4F1JA 2WWFA 3PC3A 5ENVA 5CB8A 1U9CA 2F1OA 3A6KA 5CK4A 3UJ8A 4JNEA 1J2YA 4QX6A 3LUJA 5A9TA 1WSDA 3FAZA 3KXLA 3LKBA 3OPYA 4FYHA 4HH3C 5EE3A 1CEEA 1EIWA 4MUXA 1BA3A 5HA5A 3PITA 2XQIA 2I7XA 2FCRA 3H1EA 4JLNA 3NT2A 2AKAB 4MAFA 3ZHOA 1TTTA 5H8WA 5GMOA 2H52A 4TKUA 1XAHA 4WBSA 4UUMA 3UF0A 4ARUA 1TF7A 4MA4A 4B3BA 4TMKA 1OBCA 3ZU6A 2GN9A 2DWPA 5KSWB 2I55A 3Q15C 4AECA 5L4SA 4JLOA 4O8ZA 2AS0A 5B64A 4FDUA 3JVVA 5GY7A 1I51A 3C3CA 3DCIA 2O2CA 5A4AA 1C8KA 4YT5A 1L9KA 3DL0A 1Y7HA 3PQ7A 1GUDA 4N82A 4L72A 1QHXA 2FPSA 2B5OA 1Q2UA 2WFMA 2XGOA 4ZAVA 4L8YA 4A8HA 1XTZA 2MSLA 2Q8QA 5I4CA 2C7OA 1JLKA 3IMGA 3TUZC 3OMWA 5KOHA 2ID7A 4MKZA 1ZNWA 3GUHA 1ZA2A 3SAJA 3C97A 4ZJYA 5BWBA 4ETWA 5M29A 1YRLA 4RSRA 3I3SR 4PHTA 2PO7A 3EPPA 4MEJA 3P2YA 2C0PA 5CJ2A 2GTHA 3G9XA 2A5DA 3F6EX 5DNWA 2I91A 1UBGA 1JECA 3IFSA 1IN7A 1R5OA 5GGXA 3RVJA 1TPZA 3M4ZA 2YNMA 1KJJA 3NFYA 4K9DA 1SC9A 2ATXA 5DCYA 4ZD6A 4B3TB 1X7XB 1E98A 2WF9A 1IUNA 1XD9A 4D8VA 4WINA 4BVLA 5FADA 3C98A 1YCDA 1N2HA 4DR1B 1MW8X 3V1YA 4Z51A 2RD2A 3PKIA 4Q12A 1AKQA 3N0XA 4YV0A 4ZA2A 2HRRA 1H4SA 4CF5A 4FHCA 2RHTA 4TTPA 3VOAA 4JLWA 4QGFA 2J08A 2FPMA 2BEWB 3IQIX 4CKWA 4IQGA 2WP0A 3NDBB 3JYNA 1U0LA 2MSDB 1T9AA 3PPYA 4I9NA 4RWEA 5E1DA 1W2GA 1IG0A 2QYHA 1VHJA 3KWJA 5E1OA 5HBRA 3T7RA 4DR6B 1M1XB 2AUNA 2KQUA 1USVA 2P4HX 4I14A 5AKHA 4BQOA 3QBVA 3BOSA 3ZNNA 4JOSA 3RRMA 1U3TA 2MWMA 5ITVA 4J0IA 3WWYA 3VR0A 3TTVA 4DBVO 4EAQA 4KIWA 3AL0C 2IT1A 1HSZA 3TL3A 1FF9A 5B7NA 4C01A 5LQJA 3CLHA 1XVIA 4EQ6B 3DUFB 5JXWA 4CF7A 3E0XA 4WCVA 2X0DA 3V7FA 3G2LA 5C35A 1DELA 1RU3A 4JJIA 4PNHA 2D0DA 1JJ7A 1N2CE 2LZ0A 2XI4A 3O4RA 4JIGA 2VQ3A 4B6PA 4FGKA 3AF6A 5BWOA 3TLJA 1GTL1 2Y0PA 2J5RA 5CJPA 4OJTA 1CX9B 2HJWA 4E5YA 4AZHA 1FNCA 4G37A 4R83A 2IP4A 2P9EA 1M83A 2BFWA 2H2AA 1QVZA 2GZDA 2Z9BA 3NDPA 3S2EA 5KO2A 4BJHB 2LDXA 4WNAB 1L8AA 1WLSA 1THGA 2Q0SA 4V0SA 5JMWA 3H9JA 1VA4A 4GW3A 1L7OA 3HBMA 1PQYA 1S0UA 4Q3CA 3ESXA 4B17A 2P5TB 3NT5A 3QUQA 2QQ0A 3PFIA 3IAEA 4S1WA 3QNWA 1ZJJA 1EGAA 5DLYA 4URXR 1T5BA 2VYQA 4BE9A 1KAGA 4FW9A 1NXSA 1MKYA 4L8LA 5B1YA 5EOVA 1SJ9A 1U63A 2POCA 4IJKA 4JYAB 4BJ6A 1J6UA 4TZTA 2IEIA 2BRUC 3AF0A 1NGSA 2ZYTX 3JAKA 3Q7IA 4FT2A 5K6AC 3QVGB 4M53A 4RE5A 4FYMA 5JOQA 2CHFA 4KOEC 1SXJC 1NRWA 5BOSB 4Q9IA 1J0CA 2WBLC 2BMEA 3OJOA 1RQRA 1SCIA 3K0HA 3WFJA 4URUR 1MR3F 2XMZA 3BRCA 4JCCA 4HDOB 4LJSA 4FXOA 2E9SA 2J3LA 4R3WA 1QLHA 2CFRA 2FZGA 3GJ4A 3H3XA 3VH3A 1E9EA 4ENWA 3PDIA 5MDHA 2IEAA 5LPNA 4B09A 4R5LA 2VF5X 4EKNB 3II6X 3TE7A 3OHXM 3DZBA 4A1OA 2RHHA 2QP9X 2DQSA 5I3CA 4D74A 1KDPA 5KNDD 2OECA 1AURA 1K7FB 2O2XA 4FIZA 1KKMA 1OXMA 2QXLA 4X5OA 3WAKA 4E21A 2XWSA 5DBIA 1G7TA 1EAYA 4Z49A 4MRRA 4LYGA 5IDQA 1RM3A 3GRCA 2V54A 2Y6UA 3ZIAA 1FDTA 2VDNB 2XVZA 4JGGA 5LZ8A 1VRCA 1J7JA 3I52A 5D7NA 1QPGA 1X14A 1YSCA 1OIVA 4IF6A 5AW7A 5KJCA 4K8OA 3RS7A 4O4IA 3OX3A 2OG1A 2FQQA 3ILHA 3PNPA 1CQZA 3HYSA 2REQB 2WJHA 1KRXA 4C3ZA 1V3TA 2DUNA 3IQWA 4OD0A 4GMFA 3G23A 4F93B 4K6GA 3SXPA 2XAAA 1H1LB 2R6AA 1IB0A 1S4MA 3F0TA 3PHHA 6REQA 5TIIA 4IEFB 2HGZA 2FPPB 2OAP1 4I8XA 4IAOA 3EG5A 3G7NA 4EEZA 3FTFA 1G8HA 1W85B 3LQFA 3N0TA 4IF4A 1NATA 1QQ5A 1AQ6A 1BZYA 1TCAA 3PQFA 4I6EA 4M0FA 4OKNA 3VHRA 5KNBD 1UJMA 2B7CA 2ABWA 3SS8A 2YI8A 3BVWA 2XUGA 3EODA 3HZZA 3MGKA 4HBZA 2FPIA 5DM4A 3RJ9A 4YUVA 1GG2A 1O9GA 2VK4A 3QVKA 4HXFB 1N7JA 5ICEA 5JS1A 5AM4A 4B6GA 1VB5A 1OF1A 4GPZA 4DV5B 3EOAI 3HA7A 3H2GA 3ABOB 3EXFA 1A88A 4OUDB 4YRDA 3SDZA 4C3OB 3K6SB 1FYFA 1X1CA 4PIMA 1Q74A 2B20A 2RHRA 1Z68A 1BDBA 1NA5A 2CZQA 4UBJA 5AVZA 1DJPA 4FD2A 3WV5A 3CF6R 1BFUA 4NYIQ 2WNSA 1UFRA 5JD4A 5FPQA 1Y5MA 2VJDA 2ZVQX 4RO0A 1WQ3A 4X24A 3QYPA 3LK6A 1E5QA 2Q3JA 4Q4CA 4JHLA 3DEIA 4G5GA 4KPUA 2ZDHA 3K8QA 3CN9A 5ECDA 3LPMA 1WVMA 2A9PA 1HLGA 5IKOA 2Q3LA 4PHFA 2L19A 1EDBA 5LA6F 4D43A 2VF7A 4OHCA 5HYVA 3ZWKA 1W48A 3RYTC 2QI9F 3O6VA 4FDMA 2A4MA 5E9AA 3VR1A 3WGLA 1HTBA 2JL1A 2V6GA 3HP4A 4MS4A 5CT6A 4BNDA 1JIUA 2DHCA 4UXJA 4WVFA 2OGTA 1DKOA 1I3CA 3D9QX 3BTVA 2WD8A 3TNLA 1PZFA 2HLHA 1SUAA 5AKYA 2E5FA 3FD9A 5NULA 3ZZ1A 2NCZA 2X5NA 4GX0A 1BHJA 3PQEA 1L9XA 2ZQZA 3HKBA 1J70A 2OORA 3HR4A 2CLDX 2X9NA 1S2NA 3FTNA 4D3ZA 5FR1A 1DCFA 2BSQA 821PA 3VPDA 5AJWA 4UNQA 4HO1X 1JU3A 3RRBA 5DM0A 2I71A 1FDVA 2FZWA 2ZJOA 3C3MA 4GWKA 4Y2YA 2YHBA 1AZLA 2DXIA 1ZLXA 3AI7A 3LBAA 2XJ4A 5COBA 5E6SA 1EI9A 3STYA 5JAMA 2YWHA 5FULA 1QB7A 1WZ2A 2VQSA 5ALWA 2O0MA 3KHKA 4YJDA 2IEZA 3E35A 1Z74A 4HR1B 1EVYA 2WRZA 4RZXA 2VPPA 4P2BA 4ZQBA 5I7RA 1JE0A 3OOWA 1K1EA 3JQ8B 3TIXB 1SY7A 2R68A 3CB2A 3WYDA 2EWVA 1LLUA 3FNRA 4O1IA 3DMHA 4W5QA 4BYMA 1KRWA 1KOGA 3NZEA 4P31A 3LGSA 4C7XA 3WL3A 2OSBA 4QYSA 3EXAA 1WHSA 2GYYA 4YJGA 1G21A 1EFKA 4YRBA 1HDYA 2Q3MA 1DC4A 1JF8A 1WV1A 4G0QA 4E81A 4DLXA 2IZ6A 4FX2A 1TADA 1MX3A 2WWHA 1JL3A 2WTMA 4Q3EA 3TZBA 2HT1A 5GONF 5B58C 4YJ2A 4R9NA 1N5IA 4X8OA 2HCRA 3GRPA 3DNMA 4BC0A 4Z7NB 4UUBA 1E59A 3AR4A 1RYHA 1N57A 3WGIA 2I65A 3R75A 2OBMA 3UMYA 1CR2A 3RIEA 1M34E 2VNIA 5DKFA 5TRTA 1P2TA 1S5PA 1DSSG 1KSJA 2CKDA 2OMEA 4X6LA 3O8RA 4WBXC 1B7GO 5LYJB 5I7OA 5A71A 4E31A 4GSLA 1H2HA 2VAVA 4IVPA 5ALLA 1X15A 3K8YA 1FVXA 1QDLB 4J03A 5GJCA 3R3SA 4EZSA 3JZMA 5UKDA 2AE1A 2EL9A 2FW0A 5CVDA 1A9XA 4M6WB 2B61A 2QU8A 3CV5A 3Q84A 3ZCPA 1SG9A 5K8UA 1A5AB 3OY7A 4C76A 2DWCA 4XWAA 1I4DA 2QG9A 1EUYA 3WIBA 1PSZA 5JS2A 3GELA 3FOZA 1VYHA 4PPNA 2C77A 3OIFA 1EE2A 2DWUA 1JDBC 1KC3A 4ATNA 2GNOA 4EI2A 4MK4A 1IC6A 3OLVA 3RYHA 4BB6A 4L5YA 4NIMA 1SM4A 3JQFA 3EC2A 4K9RA 1XFDA 4ZRDA 5C1DA 1JQKA 1O6BA 1BCRA 1KYZA 1QFZA 4KBYA 5FH9A 4XPZA 1CP2A 4DMMA 1FX1A 4YP0A 1RJ9B 4OLJA 121PA 3NOQA 5GONA 3SMVA 1TTPB 4WGGA 2ZCJA 4GPTA 4DLPA 4KGXA 2EBFX 4LISA 2JAQA 1R88A 2C98A 1RXIA 4RJJA 4Y2TA 1W6UA 3BFXA 2Q1WA 4ZVPA 2V6MA 4HADA 1KEPA 1A4XA 3JQPA 3OZRA 4PAGA 4EFDA 1U9IC 1PGJA 4BX3A 4UFPA 2J31A 3PGA1 2B1RA 4NBSA 3ZU2A 3UK1A 5KPJA 3E5HA 4W5HA 1BVHA 3NBXX 2JEYA 3EEOA 3HO1A 3TPCA 4OXIA 4UKDA 4MVJG 5DIZA 4QYIA 3OPYI 4NOMA 1D6NA 1M67A 221PA 3C6QA 1C3LA 4FE7A 1NG1A 1KPHA 721PA 3NBFA 2ZS7A 1ZJ5A 3LVRE 3PUZA 2GEBA 1JAIA 4CG0A 4RLSA 1K4YA 4RELA 4D79A 5BUQA 3DE7X 4XYBA 1P2UA 3RSGA 1W9MA 1U90A 3KSUA 1JG7A 5JROA 2V0CA 1F5NA 4J0QA 3GWGA 2V7EA 1XNQB 1VCIA 1EFHA 4PLVA 4TKUB 1UPBA 4TPKA 4RZ3A 2RGGA 1GUAA 2OSVA 3FM9A 2B0CA 2ZRMA 3BSYA 2OBLA 4EDFA 2B7BA 1CFZA 3CW2A 5F5XA 1QLJA 1T8UA 3I8XA 1W19A 5BN5A 3N2IA 2ZJ5A 3TVYA 3M3DA 1ABFA 4N0EA 1NJ8A 1JHMA 1ACLA 2JD0A 1AF7A 3MBIA 4NHOA 4RKRA 1T35A 1N0IA 1JR2A 3B1KA 3A70A 3WV4A 2C96A 1M72A 2D5AA 2PX6A 1LPMA 1YFZA 1FFAA 2YJZA 2FSHA 2YVQA 3G1TA 3I9V1 3LC1O 4IHQA 3TSWA 5IZCC 3MOSA 2I29A 4LRWA 1IYZA 2BEWA 1IXKA 1EFAA 1CJSA 1H1LA 1T15A 1OJLA 4OO3A 4RK6A 1DKXA 3AB3A 5D8DA 4Q4JA 5M3BA 3Q5GA 2IBTA 3O03A 4BMOB 2YXBA 1X94A 1KNXA 2XT6A 2XKKA 1PK7A 4N8EA 1IXYA 1D1PA 2PQMA 4IZOA 4EW2A 4AKIA 4PQGA 2CE2X 3MT7A 3N2EA 5F21A 3RYFB 1HLFA 3STUA 3FVWA 3NWJA 3QKSA 3OZVA 3PBKA 1YAHA 3FKJA 2VP9A 2I1VB 3AVVA 2HXSA 1JJVA 4B3XA 3VU8A 4KU4A 3V1LA 1NXTA 3UK7A 4M9ZA 4BECA 1RMTA 5JFOA 4Z9BA 3I3OA 4TXMA 3TJMA 4N6OA 3NMUF 1JA9A 3KL2A 3OOEA 3RSOA 1O95A 4EPYA 3BULA 2I7DA 3CBQA 4G5OA 1ECFA 2P2CA 2WIJA 4GQIA 5FHQA 4MB2A 1VIVA 4WK4B 4C30A 3HFRA 1TECE 5D6OA 4NVRA 2K2WA 3MJ4A 1SR8A 3AL3A 3FYTA 2H6EA 5AKIA 1EGQA 1T4GA 2P9HA 3L0BA 5FFFA 4BLPA 1N1DA 4YJHB 1V11B 2PSHA 2QT0A 2PXHA 2UUOA 3L6BA 4CQMB 1H3EA 2YIBA 3I8OA 4ITRC 3UQYS 3F2VA 4QTZA 5HGJA 3I2HA 3UPDA 4K6HA 4GKAA 4C4ZA 1RFLA 4M8KA 4GUAA 4RK4A 4ABYA 1QFMA 3GUZA 3DZKA 4LFCB 1Z3CA 2BF4A 3ZHZA 1JW9B 1EBFA 4V0NA 5E1BA 5CDYA 3G0HA 5F1OA 3HXLA 4Q34A 2YJ3A 2Z1NA 2I6TA 1ULZA 3DG9A 1WKCA 5LNK6 1Q1GA 3JWGA 5T6BA 2DHQA 3CPHA 3NWOA 3GX1A 4NAVA 4W99A 3E9DA 2YLAA 3ME5A 4AICA 2G1PA 2I3BA 1G0OA 1VXOA 3JWPA 2CUTA 2XNKA 3AY7A 3P96A 5BYAA 2BKLA 3KR1A 3MXTA 3S70A 1QU2A 3KKQA 1SOUA 2A59A 4TT3D 1O6CA 3GROA 4CR8A 1ZIXA 3H97A 3PT5A 4B9EA 2HR1A 1TL7C 1VLJA 4A23A 1Z2EA 1Q7EA 4H18A 1FU7A 4Y2HA 1E2MA 1EH5A 2QGZA 2YL5A 4NJMB 3NBYC 1VSTA 5BP7A 1M3SA 2PX2A 3BGSA 5F9FA 3R40A 4BMYA 3D2CA 2AHOA 4YJFA 5HZGA 1F8UA 5SY6A 1IXZA 2OWEA 2QE6A 3QPDA 1ABBA 1CUUA 1TUIA 3ABQB 3IAM1 3SP1A 3IE0A 1G20A 4EW3A 5EG5A 1ZN9A 2JIOA 3QJGA 1LQUA 2NU6B 3M33A 1CETA 1J2JA 2X40A 4KXVA 1ZRHA 2PEYA 5FPSA 3O2NA 4XIIA 5IAKA 5EJIA 2ZR7A 1BJTA 1W96A 3QBDA 2FFBA 5DTJA 3N0VA 4DVGA 1M7BA 5C5EA 3F47A 4LNAA 5FX2A 1QIKA 5LXTF 1Q57A 2Q7XA 3QMMA 4LCBA 1F12A 4AMGA 3PXAA 2NSJA 5C3MA 3FG9A 3MTAA 4OXQA 4FT4A 5IMBA 2QTAA 3M6AA 3C3DA 1EB9A 4O5OA 3VPBA 4B46A 4JB0A 1ZR2A 4UHHA 1SC3A 3O74A 1E7MA 1NNI1 1NVDA 2KM1A 4RZUA 1EKXA 3CZPA 3F98A 2WSLA 4N1AA 3BRQA 3UM9A 3PD7A 3CLTC 5EMHA 1Q6YA 2B4TO 3TRHA 2WPDD 3UUWA 3ZZ0A 4D3FA 5JBIA 4PYOA 5AW0A 1SFRA 3WXMA 1U2DA 4DIFA 3HB1A 3R9IA 3IDQA 1PLJA 3KVVA 3RBAA 3KPWA 4RXTA 2HIHA 1FCJA 1QAOA 1RYEA 1B6GA 4DA8A 3OQOA 2XHEA 2IZ7A 3NAZA 3CLVA 3HQ4O 4LK3A 4O02B 4RVDA 1PT5A 1Z4NA 2R1TA 4C0SA 6REQB 3DXZA 2JLCA 4RZSA 4CIXA 4HFNA 4FIDA 4Y1FA 1V6SA 3UICA 1KJ8A 3OIDA 1Q1BA 4U7WA 5IBCA 5LMZA 3EJSA 2OK7A 3PI6A 4OHFA 3PFGA 1XTTA 1S2IA 3OCXA 3LPLA 2QVGA 2EQBA 3MYYA 4WK2B 4XCVA 5TF0A 3NKFA 3U3MA 1YF3A 4WLOA 5L40A 5EZSA 1ZLYA 1R4NB 4F92B 2GSDA 1CJUC 2GZ2A 3FMGA 1KEEB 2JHGA 4UM9B 4QXOA 4ZDKA 5IANA 3CEMA 1JYFA 3QUAA 3EUFA 5FL7A 4QGSA 2ENWA 4D4HA 1TZBA 1R18A 3AEXA 3HVHA 1SWVA 5DMHA 4INZA 2VDKB 2NSYA 1GPDG 1BE1A 1U04A 1MVOA 1V4BA 1WKBA 4KQ2A 1E5XA 4QOIA 4ZV9A 1GD1O 3QPVA 3DDFA 1TGVA 3IEKA 4PYKA 5ALJA 3UK2A 5KX5B 1L7RA 2JJ8A 1HUQA 2Y1LA 2ORVA 3QENA 3KLPX 4X6UA 1ZP6A 3T1NA 3I53A 1PJQA 5KQMA 2YYZA 1YA8A 4MGKR 4EELA 4UULA 5CB6A 2IGTA 3BF8A 3QU7A 5IVKA 4TYMA 1VPVA 1OLOA 4IW0A 4IDQA 3G02A 3QE3A 4RV9A 3T9DA 2RE8A 4FVTA 4NCNA 5CLFA 1Q3HA 3LDGA 3D7LA 1EFPB 2B34A 2DMRA 1ZEJA 3GL9A 3LLCA 4IDDA 1YR8A 1RQ2A 1DWUA 2PRSA 1JU4A 2ILVA 3H2ZA 3Q2KA 4X54A 5CDGA 4OBXA 4DG9A 1A77A 4BRZA 1WB9A 1M5RA 1XDUA 1E7RA 1UJ6A 4AIRA 3BRWA 4B3MB 1GOTA 3LQRA 4RHYA 4AO7A 4EUNA 4D92A 5FPKA 4UUQA 4GZ3A 1I10A 4GBJA 4JJ4A 3EDOA 4FXPA 4LWQA 4MI1A 4LSMA 3JR7A 1Y5RA 2XUZA 3JTMA 1RKXA 3H18A 3O93A 5ALVA 2YJNA 1Z63A 1GYPA 2W4QA 1BW9A 1QHHB 2UVDA 4HWSA 2B94A 5CPBA 1YZFA 3IEUA 5GTDA 1ZMTA 5FA6A 4AULA 4TLMB 1SD2A 4HNAB 3U7FB 4NH4A 3G9GA 4XJSA 2TMYA 5CIQA 1D1QA 4E46A 5C7IO 2F2TA 2WDZA 4TROA 3N75A 2ZE8A 5H16A 3RC1A 2G5GX 2GARA 1MORA 1PQUA 1UQRA 2VUIB 3TQRA 4LOAA 1KZHA 3TDKA 4QOEA 4ND4A 4IUCS 1NVWQ 1KY5A 3H7AA 4B5KA 2VG8A 3GIWA 4QPJC 4YY3B 1N6KA 2DSTA 3RJZA 3E48A 4BP3A 2N0SA 3IDAA 2X0RA 5LXTA 1NN1A 3MB5A 1ZBQA 3QKIA 4IJQA 1H2BA 3ZW8A 2ZI6A 2QT1A 3IGFA 3A9RA 3DLTA 1K7CA 2VTKA 2F7PA 4LYEA 1E8MA 3UJ7A 1TYEB 3W05A 3U44A 3ADCA 4Q1BA 3FROA 3VO8A 1Y63A 2Q2NA 3FHCB 3R5SA 5BT9A 1HK7A 4AS3A 3VC2A 2NTEA 2WJGA 2GXAA 4Z3KA 3PL5A 1KBOA 4U0JA 5E38A 1XQ9A 3EH2A 2O7RA 4Q9JA 2D1QA 5SZHB 3AX6A 5C5BB 1C0EA 1UWCA 2BTQA 3ETDA 4X63A 3UA3A 1IBMB 3HC7A 1MJ5A 3BICA 4MVJI 1FRZA 3A32A 3HU2A 3ZZUA 2DRIA 4UAUA 1R66A 5JLAA 4F00A 1GPH1 3EC1A 5FYQA 1N9KA 3HCAA 5JXJA 4XX1A 1AXRA 3E1KA 3L0IB 4NFSA 5IPFA 2VJLA 2ZSEA 1UJBA 3GLKA 3OTIA 4R0VA 3AVOA 3F7OA 1J22A 3EXG1 3U9TA 2H1VA 4MUKA 2JAXA 2YW2A 4JNKA 1GFWA 3C43A 2I22A 5IVPA 4BASA 2VC2B 3LA8A 4FDVA 1Y3BE 1ZONA 2H06A 2YL2A 3EXIB 3PKJA 2Z8YM 3GPCA 4TYPA 3G8AA 1DJLA 2YC4C 4BFTA 2KBFA 4YMIA 4BU0A 3O92A 4EVQA 4ALKA 5L45A 1DDOA 3WHIA 2AWNA 2V03A 1JEYB 1IFXA 3DGFC 1YGYA 1PL7A 1VGRA 1T1IA 3DKVA 3OHPA 5EI5A 1FX0A 2D4HA 3SOZA 5U4XA 2JIZD 1JA1A 2NU7A 1CBUA 3FIUA 3JX9A 4HAYA 5K0LA 3CVXA 3KKMA 3GZ4A 5CDFA 1QYXA 5DBGA 4DADA 3WIVA 2EFJA 1CUYA 3Q40A 1ECLA 3VUEA 4F86A 1E5TA 1YH3A 1ZKDA 2IV2X 3FLAA 2P2DA 3AO0B 3IOYA 4EAAA 3QVSA 4XJVA 4H3SA 1NXOA 2R2GA 2WVJA 4MWSA 4DJDC 4NE2A 4F97A 3WMWA 4CQMD 1FXSA 1PJLA 4ZCSA 3F7NA 3C1UA 3HA3A 4Y6GB 2JZNA 1A9PA 4II7A 4Y1RA 2PGDA 3OU7A 5E84A 4HR7A 3RWOA 3O1LA 3PPVA 2RGAA 1G8GA 4R69A 2VBIA 1KYYA 2YN2A 1FOEB 5L9AA 5EWMA 4WOBA 1Z56C 4UOQA 2IDJA 1K7XB 2GRJA 5EQDA 2G9RA 3VYWA 2GR9A 3W9BA 1NNEA 3TOCA 4R3NA 3LECA 4RESA 2OKCA 3HYTA 3TB6A 3VR6A 4DQDA 2QQFA 1E6LA 1GGKA 3AF2A 4UMVA 4X1KA 1W25A 5TQ0A 3FTDA 1VHTA 1Z5WA 2C78A 3W4JA 4LJ7A 3IB3A 4PO3X 4I3FA 2IS4A 3ZDYB 1GT91 1U0GA 1YZGA 1CDOA 3GR6A 4NBVA 4HWGA 3RVOA 4W1RA 3I6IA 4AN1A 1QB8A 5JC1A 1N8KA 3IJ5A 1OUMA 4AKVA 1TQDA 4FI3C 4MUBA 4YWJA 5BSGA 3DBVO 1PT6A 1YOVB 4ZHQB 1HT2E 1KZ7B 3OIYA 3AUXA 3FPLA 3NGXA 1ICEA 3Q12A 4BKPA 4Z4GA 4BGVA 2F1AA 2C61A 2REXB 2JIBA 3LO5A 2WUDA 1ODFA 5C1OA 2OFXA 1Y3DE 4FGUA 4EJMA 4YJGB 2QUZA 3MUOA 3W79A 1KIFA 4G4IA 4D9BA 3SN6A 2FYTA 4PEVA 1Q0PA 3AL2A 4WCFB 1DRWA 1OYYA 2W2KB 3GFRA 4Q1CA 2IF2A 1VE6A 3NT4A 5CLIA 3IIKA 2AC7A 4I7EA 3RUFA 2QRVA 3WLNA 4DNQA 2XZOA 4M7OA 1X1TA 3DEFA 1RQXA 3NIGB 5THQA 2JG3A 4UQLA 1XJ5A 4B2LA 4B71A 3U4DA 1L5YA 1VJRA 1WZEA 3RS5A 5TGDA 5BPFA 3CVOA 5FUVA 2ZRGA 3TJZA 1DTEA 4CDGA 3PT9A 2Z3VA 5I45A 1SKMA 3IQDB 4FKZA 4GMKA 4MW1A 4YCDA 3H3FA 4LJKA 1CNFA 1Y8CA 2WPNA 1JVBA 2XB4A 3C1AA 5DBHX 1RWVA 3VSDA 3LV8A 3S2ZA 4AY4A 2JLVA 3HDQA 3I1FA 3HA5A 4BZZA 4LYJA 4PAQA 2FXIA 4NK5A 1YJQA 1S02A 4IIJA 5CA1B 1HMYA 1DKNA 1RI5A 1UBRS 2ZJ7A 3HBJA 1SCKA 4G36A 3VSEA 1DI0A 3ZJUA 3PXXA 1TQWA 3A28A 4EG1A 3JZAA 4GUDA 5BW4A 5JNTA 4ZYTA 1W52X 5BW8A 4K8RB 2C4UA 1AKEA 3RF6A 4TVBA 1Y9DA 3ZWOA 3I0MA 3UMMA 3QE0A 4ZEXA 4PS0A 4HQOA 2NQ8A 3E9EA 1EXNA 1B6RA 3D02A 3CRRA 2HN9A 5D5QA 1SD5A 1SIOA 1NJSA 2PSFA 2XMGA 3GRKA 5EXTA 4GXNA 2QGNA 5TPZA 1I36A 1GNTA 5I9SA 2ZK7A 3G13A 1G66A 4P0QB 1W29A 3FBTA 3GI1A 2FPWA 1K5PA 3RUPA 1YVRA 3FNFA 1YS1X 4RUKA 2OZVA 4KWTA 1QCDA 2AVNA 4I1VA 5TR9A 1R64A 4WKNA 1QOQB 1GGVA 3BE5A 3FYUC 1FRFS 1EFRA 1KVSA 3IBYA 2XT9A 2GCPA 3Q2OA 5JC8A 1MX1A 3FYUB 2ZRPA 1HDIA 3DVSX 3IAHA 1WUYA 4QGBA 4MR9A 3ZNQA 2FMTA 3B7GA 3DVQX 3R7SA 3KOYA 4HFMA 1QORA 3B53X 1AVTA 1E5LA 5AK3A 3UMFA 1NI5A 2DM6A 2IF0A 3ES9A 5EKDA 3UV6A 5JDCA 4GLBA 4A92A 4WDQA 3IOEA 4A5OA 4MCHA 5CB4B 1VP9A 2ORIA 5CDUA 2HL6A 4HL6A 3G0OA 5TQ0B 5C5CA 1E92A 2ZR9A 2OW7A 3Q3EA 5ILOA 5A0TA 2G5TA 4I1YA 2P6NA 1RHQA 1X7ZB 1I01A 3KB2A 4X7RA 4RTOA 2Q0XA 3SIPA 3ST7A 3F67A 3ECSA 3N39C 4IQ0A 3SQMA 4DWVA 5CPFA 2E87A 4R2JA 3R5XA 4ZU3A 2RGCA 3FI0A 4WAUA 4GICA 4LVCA 3WNZA 1IN1A 5HRAA 3O47A 3U44B 2G70A 3B9BA 4DRZA 2VR1A 3GA7A 2ZAMA 4E2FA 4MUYA 3ESYA 1E4YA 2WYWA 5JADA 4J29A 3IALA 1KO7A 3ELUA 5U9CA 1VMEA 4BQPA 5K0BA 2Y8EA 1O94C 2XNDD 1N34B 3PQ6A 4CE6A 2ECFA 2XMQA 1C1DA 3BRSA 1TZJA 2OM2A 2YL9A 4GRDA 1UWVA 3D3WA 4BEBA 5LLDA 2PRIA 1PV4A 1DAGA 2VP5A 4UAGA 4S2EA 1SOWA 4YCMA 2ODWA 4L3WA 4KQHA 1UDWA 1USWA 3BD6A 1FS4A 1XX6A 2QW0X 3L7OA 4LBWA 5BRNA 3R6LA 1JEYA 1HYEA 4IMPA 4RIHA 1XNHA 3F6BX 1WPQA 4JR2A 4S1VA 1E89A 5F3DA 1CS0A 2YWJA 1JFFB 2PHZA 3MRTA 4L95C 4XA8A 4FBGA 2FWMX 5JH7A 5F98A 2WG0A 3CBGA 1KVQA 4KMRA 4ZRMA 3TTWA 1ONSA 1UQTA 2PX4A 4KXFB 5EPOA 2QZSA 4B4WA 2FWNA 3SLKA 2ETVA 2HC9A 3B85A 3NB0A 4ME6A 4B3IA 3L9WA 1M2OB 4KO2S 1ARZA 1LVUA 2OXTA 3ONEA 4QU9A 4MS3B 2X2PA 3DUWA 4OGFA 2X0EA 5EJ5A 1IZ9A 4Q1EA 1TEZA 1GZ4A 2FAXA 4UTPA 3S81A 1FK8A 3CH7A 5EWJB 4Z6KA 1G20E 1Z5PA 5LZ5A 4F0JA 2ZTUA 1X3SA 2P9TA 2YXDA 3N2NA 1VIAA 2W37A 1L4FA 3ORFA 4PQYA 4B79A 3N86A 3OP4A 3WIEA 2HRBA 4CIWA 3QSGA 4EO7A 4DXAA 5EZYF 1BEZA 2YWEA 3E7WA 3I5AA 3KPYA 3M6IA 4R6XA 5DU2A 1J56A 5TQJA 1GNVA 1C7FA 3WXBA 3GUYA 1AA6A 4WCFA 2RKOA 2QLTA 1OWLA 3DJFA 3GAFA 4V03A 5I7EA 1VE1A 3AZOA 1NVGA 2XHZA 4BKQA 1VSBA 2I0FA 3DPSA 2VJMA 2YS6A 1YKSA 2W9XA 3HFJA 3GI7A 4P98A 1R7RA 4OM7A 4X8HA 2ZE6A 2JBAB 5P8WA 4EGAA 3UGJA 4G0YA 3NWEA 5E4JA 4CJXA 4GHWA 3M82A 2QXUA 1XRNA 4CRWB 3PR1A 5AJZA 1O5IA 4OLBA 4A5SA 2O50A 5ALGA 2FN3A 3LQYA 3P9PA 4BWVA 3EWAA 1CQWA 3TI9A 1CULC 4BZQA 3FUVA 2YL8A 4DSOA 1WDMA 1GUZA 1SZJG 2AE2A 2D13A 1BJKA 3KWFA 3JQRA 2VQFB 1DG3A 1JBEA 1XIVA 2Q62A 1EX7A 3UOAB 1XRRA 4EABA 1CUAA 4RETA 4IBOA 1JHQA 2EFEB 1WVGA 5LBTA 5AKJA 4K87A 5HQJA 1OH6A 1OFUX 5KKCA 1UZNA 4DIEA 1Q7GA 2AZDA 2O05A 2WJYA 4B2YA 3L02A 4MVJP 4QYMA 3VPFA 2IHKA 3GLHA 3GY0A 2VP0A 4DSUA 3HL0A 4GMDA 1JA0A 2PMBA 1T2FA 2HX1A 1QJCA 3KAPA 1W5FA 2HMTA 1C7IA 4URZR 1IUOA 4MUAA 1YC2A 2J9ZB 1AS3A 3K1AB 4BRUA 1PN3A 5DYGA 3MJFA 4LZAA 2C9YA 5REQA 1U1FA 2J3DA 2O6LA 5F2NA 3H05A 1LK7A 1EFCA 3MW8A 3O91A 3DFZA 3RSLA 1JS1X 3SI7A 2FEAA 4A7PA 4Y6PA 2ZZNA 1NVMB 5FO1A 3VZDA 3ZEIA 1J8QA 1O57A 2VDLB 3P9IA 4K3VA 1YDEA 1VLMA 3FOCA 1H4TA 5AOCA 3D43A 1N75A 3O7WA 1K6JA 4OU5A 4F5WA 1X1RA 3K30A 1I3LA 4G07A 1JDJA 2OO5C 1QM5A 3WQSB 7REQA 3RTGA 1HQYE 2IXBA 5FO0A 1OWMA 1HORA 4HMPA 3KQWA 1QH8B 1H65A 1JU9A 2DX7A 2W0SA 3C16C 5FV7A 1QYDA 1AG9A 1SIUA 4H7DA 5K3EA 2NU9B 3B1FA 1R5NA 3NJ4A 4ILEA 5AUPB 4JYZA 2GKSA 1F6WA 3O0TA 2W6IA 4Q1DA 2V3VA 2QN6A 3L04A 4E5DA 2BI4A 2OXRA 3DFIA 2KB0A 4V24A 5BSRA 3V4VB 3BZWA 2FJUA 2YDXA 2H00A 1GTVA 1I30A 3FMPB 3MJEA 2FN4A 3F74A 2X8WA 3PVSA 4IGAA 5A7GA 2XDWA 3UC9A 3AKZA 3HV0A 1NQXA 3HDVA 3HMKA 2QA5A 4V0QA 3H11A 1PJZA 4H7IA 5CNIA 1UM9A 1VCHA 3TINA 2EJWA 1OU0A 3K4HA 3L82B 3T99A 1L5NA 1FTYA 3KTAB 3QVVA 1U6KA 3RV1A 3BCHA 4FYWA 4X61A 1TLFA 2PLFA 2NU8A 3STVA 3VR3A 5CB0A 3GDHA 2UYHA 1FSPA 4YMVA 2ZM5A 3VJMA 1OT5A 2MU1A 4HAXA 4QUJA 3D8HA 5LA6B 3IIEA 1FJXA 1FUKA 1F0NA 2PQ6A 5BSFA 3HUDA 4ZOLF 1EWTA 1WHTB 4ND5A 5EL0A 4AK9A 3CRVA 4DHWA 4QOGA 2C1XA 3IXQA 3VX4A 4FZPA 3KUKA 5BWMA 2PWYA 1VJ5A 1MU0A 1S1CA 1FP7A 1VBNA 2VL7A 3M6UA 3LCUA 2ZBVA 3QBJA 2FOXA 3BDVA 3D3EA 3QKRB 1GR0A 4S1TA 3UB2A 3V8PA 4EJ6A 2I1QA 1DIRA 4DLAA 2ZT5A 1YIAA 1YJ8A 2GJAA 3L7JA 3OX1A 4EQZA 2X7XA 3Q0IA 4YNBA 2FI1A 2WFLA 3TS1A 2B99A 1X7WB 1I5RA 3CQ9A 1QGUA 3NU1A 5KYUA 5LDGA 3VR2D 1NMSA 3JWEA 4HRXA 5A02A 1I9GA 5A3VA 1HYQA 2PE5A 1A5BB 1E1RA 3LBIA 3ZWWA 3EGIA 5LZ2A 4IUDS 3FH0A 4CKWB 4JENA 4WFJA 2M32A 3GD7A 3U4CA 3H0CA 1Z5GA 3NHYA 2WLTA 4P86A 5J40A 3B9QA 3LS2A 1E3IA 2X2FA 4FNGA 4D9FA 1A9OA 3TQIA 1HKUA 3P1JA 5KYWB 1VTKA 2Q4DA 2FFHA 3H1BA 5TMDA 3P0RA 1S2LA 3D5QA 3ODPA 4RIFA 5FWXA 3UWDA 4TT3A 2I2BA 3B9PA 3B60A 4RTJA 2GAOA 3RSFA 1NU8A 2AVDA 2XZTA 4IIGA 2NNLD 3LP8A 5DTIA 1FNDA 3CX4A 3D0KA 2JGDA 4KSYA 4A9AA 4JSYA 3QKTA 1BU8A 1L8OA 2H5IA 5AI8A 2Q9UA 1Z2CA 1ULHA 3GVHA 3Q7EA 4MI9A 4OV6B 4O63O 2OKGA 3G2PA 4JEHA 4KC0A 2V45A 1J4AA 1MGOA 1CP3A 1KSGA 3AJRA 5DRYA 1EX9A 4YRRA 1KPIA 3UHJA 2OQRA 4XUCA 4ND1A 1DJMA 2OPHA 2GCOA 2EJBA 1YMVA 4DT1B 1ELOA 4E1AA 1OH5A 4XIYA 1JKFA 4F72A 4BNKA 1M1YB 4Y9RA 4KAFA 2YMPA 5TPWA 2KSQA 1EB8A 1NBHA 2OQIA 3GD5A 4D5GA 2IYPA 4OXRA 4LRTB 4CN8A 3DUFA 4MROA 3OE5A 3O4IA 1FQJA 2DZDA 3E2PA 3WMEA 1YV9A 3U4QA 4WPEA 3ZWXA 3U4QB 4EZZA 2Q5QA 1P4SA 2PKRA 3D7RA 1DKZA 3B6MA 3WRWA 3BGWA 2WLSA 5AM5A 1DEAA 2H08A 1TT5A 4M1MA 2LM0A 4RQAA 2I4MA 4QTYA 5IF9A 2OC9A 2WNIA 2IOFK 2VH2A 3O82A 4N3BA 4B7XA 4JVOA 3REQB 2GXSA 2K5UA 3D64A 4XGQA 3GNSA 1XVLA 1KU0A 3NPMA 1JVSA 4IO1A 4OHWA 5AW6A 4O2AA 2IYOA 1MO2A 2WTBA 4D98A 1Z5UA 3PB3A 2ZBUA 4CQLB 1N0VC 4JQSA 3COSA 1U3CA 4TQAA 4AKSA 4QFDA 3VU0A 5FBWB 3Q4GA 1R6VA 3F5SA 1UBHS 1D6SA 4MYHA 1F5SA 5IHXA 4KV7A 1NVAA 1ZQ9A 4E07A 4WA8A 3BUQA 1K0UA 1S2MA 1CUEA 2YMMA 3AYXB 1TQ6A 3DQPA 4XGNA 1DP4A 2WWXA 1AMUA 2Q3HA 3T3OA 1WQ4A 1L6IA 2UDPA 3SYLA 1CE8A 3N0WA 4JB3A 3DV2A 1O5OA 3DZCA 1LNSA 2IYTA 1R0YA 1U3DA 3PSAA 2CLIB 2K87A 3WWEA 4KEAA 3QMPA 4R3UC 1L7BA 1YL5A 1PS0A 3EGCA 4L02A 4PRZA 1E6UA 2ESRA 3ZTWA 1U8ZA 3C74A 4ND2A 1F7VA 4JLAA 1Z33A 4L7QA 3FSJX 4Y9DA 5IYZB 1GNSA 1F20A 1C81A 1KO8A 1RYYA 3ICPA 2J3KA 4EZYA 3N7AA 4H08A 4D0NA 2BEKA 3T4UA 2IXFA 3PQ5A 2ZWAA 2YUIA 3STTA 3TM5A 3WSWA 4Q0MA 4IGIA 5DHRA 2C9OA 3WY9A 2FUNB 3RU2A 2V74B 1B6SA 1XQ6A 3JD4A 4KLZA 4UTNA 1Q1ZA 2Q8PA 2MHCA 2W6MA 2WYOA 4HG2A 4ID3A 3GZTB 4O4HB 4OYYA 1JR6A 2MDTA 3WDMA 1VP3A 3V6MA 4FR5A 3DB1A 3HSYA 3K2EA 4E5NA 4DCCA 1LK5A 4OYHA 3GFQA 4I4CA 1C8VB 4HH1A 4OSOA 3A10A 3R3ZA 5FUMA 4IFEA 1NM5C 3WB0A 3CSUA 5MGNA 1AGPA 1MEOA 3ANMA 4QQFA 4QPZA 4DF3A 4EVIA 3IHKA 5B55A 4PSDA 4YXFA 3M6LA 3LA6A 4XB1A 4PO2A 4JLJA 4XFJA 1T1JA 2VPZA 4XLTA 3ZOKA 1Q91A 2SKCA 4BO3A 3TZLA 2JCYA 3ZGXA 1R74A 4EY3A 4W4TA 5ICFA 1IBLB 3Q9NA 2O2YA 3QYFA 4PBSA 1LTQA 1RC0A 1V9LA 2OBFA 2ZANA 3B1YA 1T43A 5AXBA 2R00C 3KLOA 2YV3A 4RHEA 4PO8A 5JE8A 3O26A 4D46A 3KQUA 4F2DA 3LKDA 1U99A 4ACBA 4I0WB 3A1EA 1GQOA 3USCS 3CRNA 1L7MA 1Z08A 3AERA 1I4EB 4LZLA 1XXHB 1YUBA 3M2PA 5K3OA 4DV1B 4XQCA 4P38A 1LV8A 2HV8A 2PJZA 4GVXA 1VLQA 4EB0A 3DYIA 4WGFA 3F5QA 1FMTA 2VNHA 4OTZA 5JDIA 1WSWA 1MOQA 5SYAA 1GTSA 2VO1A 1CF9A 3ANTA 3D8RA 3U80A 3FNHA 2NQTA 4M9QA 3E23A 2DBQA 1NJ6A 1PR4A 2V7XA 1RLUA 3O4FA 4LGYA 1GKYA 3V34A 2GDZA 2ETXA 2JJ1D 1SHZA 2XDYA 1EWKA 4R40A 4A0GA 3S2SA 3HHEA 3P9RA 2CMKA 3AHCA 1JIJA 4WBNB 1N7IA 5J2UA 5DTRA 2F55A 3TK1A 5I5EA 1R9JA 4GQBA 4R9SA 3UK0A 3P2MA 3OJCA 4W6ZA 5FI5A 3L06A 5JWHA 3KHTA 4GL4A 3EIQA 1JT2A 2W6PA 1JDUA 1NV9A 2CLEB 3FMIA 3KPUA 3PQ8A 5EHQA 5DLEA 3ZYZA 1L1RA 3DAYA 1VJDA 3C14C 5IUKC 2RH8A 3IULA 4OMUA 5AICA 2CCGA 3DVAA 3FIJA 2R6GA 4C88A 2PFKA 3JVDA 1CLUA 1U28C 2CGEA 2UVPB 2WIDA 3LY8A 4G8CA 1TM2A 2HHAA 4GP9A 1KMQA 2OZKA 4PM4A 2NYAA 5LLSA 4DBLC 4E22A 4U63A 5AVQA 1EVKA 5FL3A 3HV2A 4YCJA 2QRZA 3B51X 1FTGA 3LFTA 5JNSA 1AC5A 1XMSA 3GN1A 1V8DA 1T29A 1E3DA 1XXHE 4XXHA 3W9SA 4F2WA 5IUNC 4H4CA 4DABA 1UXIA 4HPXB 4QT4A 3TD9A 1RPNA 2TS1A 4ZOAA 4MQBA 3ANSA 1DNPA 2J5QA 3O9ZA 4G01B 1UMDB 4IUYA 2XCUA 4MX8A 2BKAA 1FUIA 1YWGO 2JEOA 1XU7A 3LT4A 2HO4A 4JXJA 4L2IA 4N3AA 3AHEA 4DEYA 5C8VA 3GFVA 2HK6A 2ZBQA 3BH7A 1ZCFA 1VPLA 3A9CA 4BAGA 3A6PC 4RBNA 1DUIA 1F2DA 3EJPA 2QTFA 4RK0A 5ILGA 5YASA 3TB4A 4TYNA 1PHRA 1E1DA 4MVJA 2VT6A 1RADA 4EENA 1U8YA 3EBPA 1H93A 2PBLA 3NR2A 4JBWA 4R9RA 5B1IA 5TEWA 3HCFA 1T9GS 2FWAA 4FN4A 3BIOA 3HTXA 5HE9A 1EK1A 1QO7A 4NL4H 2QW8A 4NEHB 3WJAA 4D44A 3K5IA 1LX6A 5LIRA 1WETA 3KTDA 4IPTA 2AJTA 4B6EA 1QOPB 1JSRA 2JIZA 1GPJA 4AUKA 3L8ZA 2WM3A 1GG9A 2X19A 1PZNA 3SXUA 5F4ZA 3O1IC 3B8HA 2Q07A 1TKCA 1Z5NA 3EAQA 3KV1A 3Q7SA 4G6ZA 4RQUA 4J7UA 4YJ2B 3UCEA 3W5SA 5JEDA 4JYCA 2EWMA 1DADA 2BGIA 1I7DA 4F11A 2AR0A 3DCJA 1BX0A 4FLEA 1TMYA 2IYRA 3JRWA 2IEYA 4G3XA 3ED1A 2BE7A 2I66A 4ALIA 3L7YA 1JHVA 4HAVA 2P4QA 5CAEA 5JCZA 4WADA 1Z0UA 1T91A 4LOHA 3D51A 2OVBA 2PZBA 5F33A 4JUDX 2A67A 2GHTA 4CV0A 1AH2A 1QYIA 2RHGB 5CX1B 2Z1DA 1GKIA 5BN5B 3DB2A 4IJ5A 2FF5A 5AHKA 2CLOB 3UGTA 3JQEA 4B4VA 5JZSA 4B6FA 4QXQA 4ZMSA 2GAJA 2WD7A 3AV3A 3HJBA 3IDSA 2OCLA 3HKDA 2EX4A 2QS9A 3OECA 5EN4A 2C94A 1NLFA 3CF4G 3IKLA 4L6IA 3FHJA 4U5XA 4C04A 4BQEA 5JQGB 4R7TA 1DG1G 4KJXA 5FDFA 2DP4E 3NORA 4NYIR 4ZQCB 4R1OA 5KI6A 3GUUA 4ZQHA 3RYHB 3L7MA 1O0CA 4YCSA 1TLTA 4BFLA 2XB9A 4E4YA 1YRBA 2ZIZA 4WA7A 2G25A 1Q6ZA 2H2WA 4IRMA 5CYPA 1REQA 3C3JA 3KKZA 3DBHB 3R6DA 2PQ0A 4M9CA 3OE7A 1GCUA 1UKVY 1VGVA 2VEOA 5FEMA 2P6MA 2QGFA 4PANA 4ITVA 5AJVB 1MC1A 3AM3A 1A9XB 1JQEA 2V7VA 4B33A 2D5LA 2VHCA 4GZMA 3LXRA 4HVAA 5DK4A 2PT9A 4DIOA 4ALJA 1XZNA 3F6YA 5DE3A 1ESDA 2AK3A 2AJBA 4UOEA 3LYHA 1T5SA 2QX8A 5KAMA 4ZEVA 3ONFA 3DDZX 1U0HC 3R6GA 1EDOA 1CK4A 4B9QA 1UQUA 2WSSA 1UP7A 5AI6A 4YPVA 4UPVA 1HYBA 2QNIA 2Y68A 3VR6D 2EHDA 2C8JA 4QJ5A 4YO7A 1UDBA 1N5LA 3SIXA 3GPDG 5LFAA 3CVUA 4YJ3A 3R6WA 1K7SN 2PV7A 1UWKA 5D87A 1QE0A 4XWGA 3SEZA 3K1JA 3HKCA 4GXTA 4DQLA 2DWQA 3HRIA 3W1EA 2O3TA 3HZHA 3EZFA 5LCXA 1E9CA 1V47A 1DC8A 1NSTA 2J48A 2QRVB 4XCXA 3N5KA 5CM9C 1EMDA 1TW2A 2NO4A 2HBZA 3T38A 4P4SB 3ZWAA 5ICSA 3DPOA 1XL0A 1H0SA 4URYR 1KTIA 1VG9B 1PZMA 2CW5A 2PZKA 2ANBA 2Z2XA 2DFKB 2C7GA 3NWPA 4IDAA 3AGQA 3KOUA 4RC9A 5JO0A 4R2MA 1H8EA 2KLHA 1KE2A 5H4HA 3MBOA 4UZSA 4WLFA 4F3KA 1AKUA 2GT1A 5F35A 3I09A 4GI3A 3P9SA 4O4JF 4QBHA 1ZJ4A 1QRSA 1TUBB 4ALNA 2FW6A 5I51A 1ZJWA 3RG2A 4F3CA 1PTJC 2WU4A 1OVGA 1YBMA 2H1HA 3R3UA 4LA4A 1B74A 2V5UA 3ZDFA 4L73A 5JJIA 4JY7A 4V2UA 1W36C 5BN3A 1M2OA 4D3YA 1PTJA 4A1FA 5T6MA 4KQCA 5A9RA 2C00A 2PH5A 4HI0E 4G84A 5AI5A 5CUQA 3W2HA 3HXKA 4TTSA 2FG5A 4J1TA 4Q19A 4O25A 4R1QA 3V6LA 3VTKA 4H7EA 4CU2A 5DNUA 2EW8A 1NVVR 3CZRA 4OHBA 4Q9KA 1E6KA 1NLZA 3KJFA 4NU6A 3AR9A 5FORA 3GUVA 3RBZA 1QUEA 1PR5A 2LD4A 3PCRB 4MIKA 4ZV7A 3VYVA 3EWNA 1O97C 4QQ8A 2PMFA 4U7HA 1G6OA 2UVQA 2ZTHA 5EE5B 1T2NA 2APJA 1XLVA 3H2JA 3PICA 3DBHA 4QFBA 3AK4A 4Q9AA 4TMYA 1L7DA 4IOKA 3K96A 3U4IA 4IP0A 1T1GA 4YDQA 2O2GA 2I6FA 4G1BA 2WWIA 2ZJ8A 2IPNA 3BX1A 1SXHA 4ZXPA 1V7QA 3L7AA 2VXBA 1GUBA 5KSZA 1EUQA 3PUYA 1BN7A 4R54A 4COKA 4BBPA 3Q3GE 3D2LA 5AXAA 1LUAA 1T1SA 2PMKA 2QFFA 1GAQA 4JWIA 3JQFC 5CMLA 3ZXUB 3IPLA 4IOJA 1MTZA 4KIKB 1X7YB 1WBJB 3H6HA 1AX9A 1CB7A 4IVQA 5C1BA 4PNZA 1SU6A 2VUHB 4PY2A 4CIBA 3ZVRA 2BTOA 4HXEB 1U0RA 2IYEA 4NFYA 3YASA 4PFKA 4RTRA 2QPOA 3O75A 1ODKA 3GMDA 4RZIA 2IY8A 1Z07A 3D0RA 4XB2A 3WNVA 1JR3E 1RTTA 4CZ2A 4OY3A 4A91A 3AM5A 5CT8A 3KJGA 3ET4A 1QFYA 3MNFA 5HX7A 5C31A 4YQYA 1YTUA 1RXUA 1NT2A 1YRWA 3EW7A 5AHXA 2XXAB 1RI3A 2IVFA 1TFUA 1YIDA 1FZTA 5B6IA 4JWEA 4JOBA 2HGSA 4I1IA 4MIOA 3T3EA 1LI5A 2NP6A 4MDEA 5AVYA 5IBPA 1ODLA 3ACDA 1UBOS 1LDNA 3RTDA 3TX6A 2QBYA 1XMOB 2PA3A 3BJRA 1Z6AA 1KDZA 1XTSA 2H85A 1AKTA 1ECPA 3NP9A 1SUCA 4KAJA 1L7PA 2WIBA 3G7UA 4YAJA 3TD2A 4DC9A 1ODCA 5C32A 4QVGA 1R4MB 2IXDA 3F6SA 1ULTA 5KVQA 2VHVA 5LLTA 1T2VA 2RKBA 1RKBA 4PSVA 4UDXX 4AZGA 1KI6A 3MGAA 2IH4A 2BH2A 3IAAA 2J6BA 4JS0A 2VAWA 4HPWA 3QVWA 4IILA 3D1VA 4EZEA 1HO3A 4H3HB 1A71A 2ECPA 2A84A 3BWDD 1YDWA 4JVMA 4B75A 4AJ1A 4DIKA 3C4QA 2YHSA 3A2NA 2ZM6B 1ISRA 1ZK3A 3GCDA 2NPOA 3RFFA 1YZTA 1P6QA 5AP9A 1MEEA 2WOOA 1RLIA 4NULA 2I4TA 1EFRD 1U94A 3CZSA 1I2CA 1U2SA 3JQ8A 2D6FA 2XBMA 3TBKA 1UXJA 5CXSA 4ZQIA 1JDBB 2BZGA 2ZJ4A 4WFKA 1PI3A 2C99A 2FVXA 2IW1A 3OTGA 3OPMA 1LX7A 3QWHA 4ILKA 1ESCA 3VXKA 5EZ6B 3B3FA 4CWAA 4G0UA 1ADYA 1THZA 4P3YA 4HF7A 1DKMA 2R1VA 5EZYB 4EJ2A 1OJ7A 1UMCA 3CISA 3FBGA 3NFRA 2DJ5A 4ZU1X 5FIUA 4BO9A 2ZATA 2XZDA 2R96A 2AXQA 2BDTA 3S2FA 1W7AA 4LMAA 1M0WA 2OXEA 4O4HA 4EG8A 1YR2A 4F04A 3I5XA 4XDYA 3RANA 2X0FA 4V2IA 1E4OA 1C1XB 5BWNA 4EF6A 2NMVA 4WDRA 5J2TF 3ZHRA 3ZQJA 3CF4A 3QSYA 1SZDA 4QNMA 3ORSA 3BE8A 1OXKB 2F3TA 2G4CA 2HXYA 2QV0A 3HA2A 3CVRA 5FOSA 1CUZA 2WF6A 4FFWA 2Y05A 2AXNA 1T3SA 4RKYA 3AGPA 3D6TB 3TSAA 4CMKA 1J8VA 1E3WA 3C7AA 4J0HA 4HDKA 4QEZA 2I2DA 1LW7A 1NY6A 4UHDA 5B1HA 3OWXA 1MB2A 4BMZA 2JEZA 2VJQA 4P3OA 3THOA 3BIWA 1G98A 2VNKA 4NMXB 5KNCH 4XEUA 4CUJA 3AY3A 4PSCA 4H8SA 3GLRA 3NI2A 1M2EA 4BAZA 1T25A 5EXXA 1I7QB 2R5NA 2XCSB 3MRSA 4R6WA 3AF4A 3KR9A 3V8VA 4A8TA 1OREA 1R6DA 1PJBA 2C84A 2P41A 2XOEA 1DBIA 3KP1A 2HQOA 4LC9A 4RVOA 1KQFA 1XXHA 3ZE7A 1MAHA 1J00A 1XT6A 5I3ZA 1RXSA 3MPOA 3P9QA 1GKLA 1YZNA 1Y6RA 1DARA 3EVFA 4WKCA 1TA0A 2XKBA 3D3NA 3WK5A 4OGLA 3IKTA 3VA7A 1DTWA 2RH4A 1A27A 4DCVA 2JA1A 4R7GA 2CXSA 5JAPA 3AFMA 4UTZA 2XEXA 2ZQ5A 2CWWA 1MRNA 5J1TB 1CJTC 4P4LA 4C5CA 4EL5A 1XDSA 1Y9ZA 3U3DA 1N1MA 3IJEB 1XA3A 2B30A 5KKAA 2GCIA 4PQFA 4BBZA 1XZ8A 5EVJA 1EZ1A 3NIWA 2WQ6A 5EC8A 2GYUA 2IDZA 2OVFA 1LV7A 3OLXA 3JWIA 2GM4A 1G8YA 2WUGA 4C87A 4YIHA 1QMPA 4ISBA 3WLMA 5IASA 1XMJA 5IP5A 3MA0A 2JC3A 5LXTB 4WPCA 1SUBA 3E6AA 3AJDA 1WMSA 1L4UA 5FFNA 4EY5A 4IIUA 4BNZA 1SELA 1YA4A 2B5VA 3DBLA 3QLTA 4RLHA 3G6WA 4BEVA 1WDLA 3FPSA 3TSYA 2JGFA 1TYBE 3MGBA 3ADKA 4BX9A 3THYB 2HIMA 3EVDA 2H1CA 4IIHA 3QELB 4URVR 4LJLA 1NRIA 1L5OA 5HF8A 3LZCA 3CYFA 3GO4A 5AMXA 1ZH2A 4C6RA 2J9FA 4HEA1 2J5XA 3PF9A 4KRXA 2AW5A 2NADA 3TLCA 4AJPA 2NX2A 2A86A 2E48A 2JF0A 5DXFA 2PWPA 3VU1A 1CJMA 5T7BA 2IS6A 3UJ6A 2V0OA 1MX9A 5EHIA 2CLCX 5I9LA 1N8NA 2VOEA 4NYJR 4CIAA 2P6UA 3T0GA 4CT5A 1RBZA 3TAUA 3OQMA 4J94A 3ANYB 4YASA 5THKA 1JDVA 4S3MA 4ZCMA 2H4ZA 1SZCA 2IEGA 3V1NA 4YCAA 2BFDA 2GOYA 4J0FA 3ADDA 3DPPA 4HS9A 4A6DA 4E1VA 3F9CA 5LB4A 3QFTA 3SE7A 2DQYA 3B6JA 3LK7A 1OXSC 3VC7A 5KVSA 1I1HA 1VFPA 2P9FA 3JAKB 4DIBA 1RRMA 3D8TA 4JI4B 4J6EA 1IVSA 3FWPA 3M34A 1G1AA 4BJ1A 3CVJA 1TO1E 4BKMA 1SXGA 2XE6A 3IPXA 2YIVX 4MLCA 1P1IA 4HP8A 3OP1A 2BMAA 1KZ9A 2AEEA 1B73A 3I1IA 4EO4A 4ARZA 2DLCX 2FR8C 1A8IA 2V7TA 2X5JO 3IOMA 1NI4A 4RPKA 4KQEA 3B20A 2QLNA 5H0IA 3S40A 1X7WA 2W2LD 4QHSA 4ECEA 4EPTA 3V32A 4RY2A 4EFMA 5A4MS 2NZ8A 1DT3A 4WNIA 3F5DA 3FCUB 3MJHA 1TKAA 2NZVG 5AKGA 2PJDA 5GJBA 3DXYA 1CR6A 2HA4A 1M2KA 3TZKA 2GAAA 2ODNA 3THSA 1ZK4A 2OHIA 1Y5NA 4ZYLA 4FQ7A 3G5MA 1M6EX 3B82A 1AHPA 4QDTA 3IAFA 1HTTA 2RAUA 4IEEA 1IEXA 4AT1A 3KALA 4E14A 4ZT5A 1RZRD 3F3YA 3GV0A 1WW8A