3O3NB

(r)-2-hydroxyisocaproyl-coa dehydratase in complex with its substrate (r)-2-hydroxyisocaproyl-coa
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
374
structure length
374
Chain Sequence
MEAILSKMKEVVENPNAAVKKYKSETGKKAIGCFPVYCPEEIIHAAGMLPVGIWGGQTELDLAKQYFPAFACSIMQSCLEYGLKGAYDELSGVIIPGMCDTLICLGQNWKSAVPHIKYISLVHPQNRKLEAGVKYLISEYKGVKRELEEICGYEIEEAKIHESIEVYNEHRKTMRDFVEVAYKHSNTIKPSIRSLVIKSGFFMRKEEHTELVKDLIAKLNAMPEEVCSGKKVLLTGILADSKDILDILEDNNISVVADDLAQETRQFRTDVPAGDDALERLARQWSNIEGCSLAYDPKKKRGSLIVDEVKKKDIDGVIFCMMKFCDPEEYDYPLVRKDIEDSGIPTLYVEIDQQTQNNEQARTRIQTFAEMMSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords alpha-subunit 2-hydroxyisocaproyl-CoA dehydratase
publication title Structural Basis for Reductive Radical Formation and Electron Recycling in (R)-2-Hydroxyisocaproyl-CoA Dehydratase.
pubmed doi rcsb
source organism Clostridium difficile
total genus 156
structure length 374
sequence length 374
chains with identical sequence D
ec nomenclature ec 4.2.1.157: (R)-2-hydroxyisocaproyl-CoA dehydratase.
pdb deposition date 2010-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06050 HGD-D 2-hydroxyglutaryl-CoA dehydratase, D-component
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.370 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3o3nB01
3.40.50.11890 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3o3nB02
3.40.50.11900 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3o3nB03
3O3NB 3O3MB 3O3OB
chains in the Genus database with same CATH superfamily
4XW2A 2HSZA 4HRXA 4MZXA 4Q24A 5DCUA 5DYIA 2NWQA 3RT1A 3TK1A 1M2OB 3G0CA 1EVLA 2Q3EA 1DKPA 3DZCA 1YK0A 1S9HA 3KKZA 3GJYA 4FI3F 4WZBA 5SICE 5CB8A 2CZQA 1ID1A 4YACA 1BRMA 3BWBA 4GVLA 4LTDA 3VZQA 3X1WA 2OORC 1QV6A 1QE3A 1VKNA 2X0JA 3N28A 3LBHA 1ODFA 1J1UA 2A78A 2Q7XA 2NSYA 3I9KA 1N7HA 1I51A 4ZVVA 3WGIA 2DJIA 1NN3A 7MDHA 5KREA 4JKIA 2I4OA 4KYUA 2JRLA 2HM7A 3AIOA 4EO7A 1XAJA 3A6ZA 4H4EA 2C4HA 5F3DA 5J4LA 3H2KA 4PPYA 3TSAA 2C5FA 5CA1A 1ISSA 4DLLA 1U0HC 4MA4A 1RYMA 1G20B 2NQ2C 4L16A 4Q37A 1EFRD 1P9OA 2ZE7A 3KPWA 4H6HA 4YS6A 1C7JA 1ZS9A 1EUCA 4X61A 2CC2A 3JCZA 4FC7A 3TUJC 4EG1A 3PUYA 3D7LA 4MJ3A 3BSFA 1C1DA 1CR6A 1ZH6A 3A1VA 3I04M 5DHTA 4OHCA 1X74A 5LA6B 4OQFA 2W58A 3GP8A 1HPLA 1UAAA 1BYIA 2ONZA 2YMQA 3JQQA 1Z5OA 3CR3C 4OHMA 5KOHB 3BBPA 4IHQA 2J5BA 1LBEA 4IUCS 1NRWA 4RELA 1FF9A 3D2CA 1M2VB 2WF5A 3S0JA 1UFKA 2MINB 2L18A 4L3VA 1TM1E 3LX6A 3HB5X 1NW6A 4DR7B 1OXBB 1VL0A 3FYUB 2ZI3A 1F38A 5FORA 1GAWA 3COSA 3FPGA 3K9LA 4HLCA 4YRTA 2DERA 5JE8A 2BR3A 3RRZA 3TAUA 1BYUA 3SIXA 4LW8A 5CM9C 4NV0A 4Z2YA 4TM7A 3WQSB 4BO3A 3L07A 1W36C 5B6PA 1Y42X 3W79A 1MO5A 1UXKA 4OMDA 5DMHA 3BD8A 4LDJA 4S0ZA 1QIDA 1UQTA 5BY2A 2TMGA 1YZUA 1HDXA 1PR0A 3QE9Y 4WECA 2G1JA 2ZYAA 1N92A 2I7VA 3H8JA 1K08A 3K15A 4WLEA 1WAMA 3T1NA 4EKGA 5JAQA 5B12A 2WUWE 2WNIA 3SEFA 2QMEA 5L53A 4Z7OB 3FB4A 3TL3A 1C7IA 3Q9SA 1DQRA 3F74A 3GRAA 4J0EA 5F78A 2CE2X 2PNJA 4JP5A 4R84A 1B76A 2X40A 3FTNA 4BX2A 2BIFA 1XLTA 2P9ZA 3FDXA 3JD4A 2WYOA 4YONB 1WDMA 3UOAB 3CF6R 3NUZA 3U13A 5IAOA 1HYGA 1IOZA 2C0PA 4D81A 3CPEA 2R1VA 3R5KA 3R77A 4GM0A 4UPVA 1U80A 2VF8A 3AR8A 4A10A 2IIQA 3KPUA 4Y6RA 2CNOA 3CUSA 3HL4A 5A1JA 2B5VA 2D54A 2IZ5A 5E3HA 3EDQA 3RAJA 4IRMA 4AKHA 2JHAA 1HTWA 3GF4A 5IDXA 5KTNA 1HYEA 4IWPA 3M6IA 4JKOA 2EFKA 4JJ6A 5BPHA 3RRJA 2RD2A 1PR9A 3DZBA 3FRJA 3QFTA 3L3PA 1FEZA 5LM3A 5LN1A 4N65A 2QQ0A 5E9JA 5L3RA 1M1NB 3C7KA 1W75A 4FILA 2BEWB 4MVJP 2YI9A 2JGIA 2QGFA 4ZYZA 4KO1S 5KHOC 1APBA 5H8WA 3DQZA 1DRJA 4ZQCB 4ALKA 3PPWA 3VR4D 1L4UA 3P2MA 1QGED 5EHQA 2QF7A 1R6BX 1H2EA 2YN2A 2LCQA 2CFOA 1KSJA 3I8SA 3LWDA 4PBTA 3WFZA 1JHQA 1P9WA 1V8ZA 2R11A 4PIPA 4KSCA 2AMLA 1Z2OX 3JD3A 1LC0A 3AR2A 3O1LA 1BGXT 2BFCA 5A5FA 1LQUA 3W05A 4OAPA 1SPBS 1B1AA 1RXYA 3FMFA 3A4NA 2JJYA 4HWKA 4PBSA 2RSLA 3DZGA 3OE1A 3QEAZ 1NI5A 3EVTA 4G24A 3GFVA 1U65A 5GGYA 4IPTA 1UBLS 2WKQA 2OPBA 4Y6LA 3TO5A 1M72A 4LSMA 4L5YA 4DGQA 2AZ4A 4QBIA 4D8TA 1CUGA 1QMPA 3NDBB 1TAHA 1YKFA 4FKMA 4FW9A 1DEOA 4QATA 3S3TA 3WMFA 3NXKA 3OX3A 3LECA 1G5IA 2VDOB 3SCZA 2AWOA 2FK8A 2QRHA 3DFFA 4QUHA 3SQNA 2BFOA 4H3SA 4NQZA 2JEZA 3W2IA 3V3KA 3DW3X 1DNPA 1JILA 2PH7A 2A59A 1VJCA 4LWQA 1H9CA 2G25A 2QUIA 5BN4A 1GVHA 3BSWA 4ZT6A 3SE7A 2E4ZA 3RPEA 3FWZA 3WNCA 1P4SA 3B2NA 3EXFB 3EJPA 4QD3A 4EKNB 5LVAA 3RLFA 2AUMA 2EWVA 4RWZA 1EHCA 3HCCA 3OY2A 2WSSA 4RNCA 5CLJA 2XB9A 3HKBB 2K2QB 3RC8A 3F7WA 3CX7A 3IUMA 5DW0A 4U39A 3A2KA 2X0FA 1WZCA 2Q1SA 5I4IA 1PZFA 2EDCA 1ZSYA 4D92A 5DN6D 5DEOA 4EATA 1G98A 1B3RA 5BXYA 1TLLA 1GPJA 221PA 1GUBA 5KC9A 3MG9A 1JECA 4XPIB 5LQKA 5BNIA 1WD5A 3EAFA 3RGGA 2E0IA 1GGVA 2XT6A 5HF6A 1FDWA 1VB5A 1YR9A 1L3BA 3PC2A 1NP6A 1NNI1 4L22A 4XTRA 1KFJB 3S44A 1OWPA 1L4NA 2DHRA 3EIQA 4MUKA 4Q4AB 3TPCA 3VGJA 1P0FA 3QWHA 4IFTA 1BJRE 1FP7A 2Z58A 3KB2A 1QK5A 3M4YA 3Q0EA 4HS9A 4N3GA 3PX7A 3PT5A 5KJFA 3IH5A 4LV8B 1R27A 1NG1A 1E4EA 1U3DA 1UKBA 2DR3A 2O0I1 2GESA 2NU9A 1LPOA 3ZWDA 3DX4A 4GI2A 3THYA 3LT4A 3F73A 1H1TA 4XFKA 2Q3HA 2NX2A 4PAWA 3BE4A 3K5WA 1UMBA 3MJRA 5AXAA 5B1IA 1D5WA 1EVYA 5CVJA 4ZOEA 3PPIA 1X6VA 4G1VA 3LHIA 4PX3A 1XX6A 1ZN9A 1G7SA 4ZALA 5DBFA 4REQA 3R7SA 4TL8A 5LWHA 2Q6OA 4EW2A 1SQFA 3CN9A 5GIPE 2PX2A 2VAXA 1KQ3A 1KP2A 3H0EA 3RTBA 2ZM5A 4X54A 2FEAA 4H7DA 3G13A 4BATA 9LDBA 1N6HA 2RI0A 4C3VA 2BFMA 1YD7A 4B7XA 1N2CB 2LW7A 3DLCA 3COJA 2JNWA 5AM0A 2NTNA 2BLLA 2R8EA 2DZDA 3ZHCA 2IS4A 2CSXA 4OL0A 2XUHA 1E2FA 2ID8A 5EAIA 1W1UA 2YW9A 3IAFA 3INYA 1MX3A 1RJEA 1ZG3A 3ETCA 3E48A 1VMIA 1QANA 1ZNWA 2WD8A 2PAFA 3WDKA 1EZ4A 2WU3A 4ER3A 2X4LA 1AMOA 2H5LA 3ETLA 4O59O 2G82A 1P2DA 3CG4A 3LRPA 1JHAA 3OCJA 4WOPA 1JDUA 3H42B 1A5ZA 4OI4A 3CVOA 1BCRB 3JU3A 5E1OA 3NVAA 4I7EA 1OBVA 1C0PA 1KNQA 1T2EA 5FWXA 4EO4A 4EA6A 4MQBA 2FH5B 1C5KA 1CPYA 1JG1A 1FX0A 3D9QX 4YPFA 4H17A 1NRXA 2XOKA 3NOQA 5DHSA 4LNUB 5IAAA 3MOSA 2PZJA 2FPLA 1QGAA 4WXRA 3MJDA 3CISA 2I3ZA 2P9JA 2VVTA 3IVCA 4OATA 5ALEA 5AOCA 3HJTA 1DKLA 2X77A 3ZWXA 3GD5A 2Q6KA 1IN5A 1Z39A 2VXBA 1MX9A 4WDQA 4C1BA 1N3LA 1ZJ5A 4JROA 4WEOA 2VXOA 5IJ0B 2ECOA 2J3DA 1VMAA 2YOGA 2WW8A 3MCZA 3WAJA 1MB9A 3Q7IA 1DZ3A 3TFWA 2RGDA 4DDHA 3TECE 1JWLA 3MINB 3DS8A 5C7IO 3HU5A 4JWCA 2YHBA 2Q07A 3DE2X 4IEIA 3VUFA 4CF3A 3RVRA 1JHVA 1KPGA 1YU6A 2QVCA 3SU8A 2VSXA 3WBBA 5BORA 1TC1A 5J3JA 1OI3A 2FQ1A 4JP1A 2RB4A 1GTRA 1AM4D 1JLHA 3ZZUA 4U3JB 3T49A 1F5NA 3GJTA 4I55F 3Q3JB 4QASA 1YRAA 1I3MA 1OWNA 2AEMA 1AKTA 1NT2A 2RCNA 3PFBA 1AB5A 2OWDA 3BEOA 1SD2A 4H7HA 4IM2A 3PL5A 4J3JA 4OB7A 2HNBA 1KAQA 4YJHB 1FXSA 2QXLA 1UANA 4KIKB 2HQOA 3CMMA 3SBOA 2GLXA 4JI8B 1Q84A 3C5EA 2IHBA 3JATB 2CVQA 3ZLBA 4D82A 3IX7A 4GUDA 1GNLA 2VQ6A 5IKOA 2AG5A 3GPLA 3FA2A 4IM3A 4FZPA 1A71A 3F5SA 4WINA 2WWVD 5T6BA 2VP0A 3O9ZA 1CEQA 2J3HA 2IZ1A 5HJEA 2O6HA 3IXMA 3ITKA 4L8YA 5HZKA 1UIRA 1CYDA 2J9YB 3O75A 1XPRA 3N2NA 2ZS8A 1RABA 1RFLA 4LXHA 5F76A 1JIQA 1FYWA 1KPIA 4BJ3A 4BKQA 4V0RA 3PRHA 1UBHS 4JP2A 4HNTA 1BFDA 1CHDA 2VLBA 4UEJA 4BMNA 4DEYA 3G1UA 1TM2A 4ILEA 4YJFB 1E96A 1DKUA 5K45A 1KO1A 1Y3IA 4HADA 4XR4A 4D02A 5AVZA 3FI9A 2F64A 1ZU4A 1YR2A 4NS1A 1LBTA 4ZRNA 4UE6A 4MQMA 3X1JA 3GGJA 1NVVQ 4HGPA 4EB6A 5BRAA 2PKEA 4KLAA 4YJDA 2C4UA 4IRUB 3K31A 5FIGA 2YIDA 2LIVA 1CIPA 3ZS9A 3LJKA 1YB1A 3ORSA 5EFZA 1F1BA 2EZTA 3K73O 2VQDA 3FHJA 4MV6A 4MYRA 1L7XA 2K87A 4Z7JA 2QN6A 2F1AA 3CJTA 3P9XA 1W0JA 2BMFA 2IHYA 4DYDA 2W11A 4EW6A 3R5FA 1LEHA 2B4YA 3HU1A 1AGPA 2VWPA 2WFLB 4RYDA 1ZQ1A 1JR2A 4JUIA 1XZCA 2GD2A 4ACAA 5LR6A 2GXAA 4ZDWA 1IN7A 1RZVA 2EQAA 4TMXA 3V4ZA 4YRFA 4FYIA 3PCXA 1WY5A 1KI7A 1QJCA 1TZBA 5ICSA 2NU8B 4HNHA 3T15A 3ORFA 3CX6A 4DR3B 2XUPA 1RZ3A 4NSNA 3GFQA 2W71A 3ZS8A 3EJUA 1ZICA 5B1DA 2WKWA 2IX9A 4RESA 1I32A 1K06A 3GRFA 1ORVA 2F1KA 2AJLI 3OMLA 2N1BA 1OCEA 3WQRA 5JXIA 4AG6A 3OKCA 1YC2A 4TLAA 2QMQA 1ZXLA 2EW8A 5AVRA 4BQRA 2VT6A 1FL9A 1IQUA 2PZAA 1WOMA 2XKAA 2Y1KA 4ZQFA 2XWBF 3I6YA 2BSXA 3VEBA 3IGFA 4O4JF 3SQDA 4KR3A 1ZUHA 4K9KA 3RU2A 3OD1A 2WSSD 1AGXA 3AI2A 5BT8A 4GX5A 4P4TA 5DOVA 4A23A 5J4VA 2EKQA 1CUCA 3T3MB 2FE4A 4EY5A 1IY2A 2VDNB 4HUJA 3RG8A 3FW1A 3IAS6 3TFQA 1IFXA 3P2JA 3U1VA 4QM7A 4O4LF 4OAOA 1MVLA 4ZC8A 5KO2A 2CHUA 4WZZA 2O5EA 2CKDA 4RQTA 1M2NA 1P1KA 1MOQA 1VP3A 1A50B 2XNDA 2ZRJA 2Q3BA 4GP6A 4HYTA 3AR4A 1F7VA 4ZAYA 3W5IA 5JJBA 4EEZA 2Q7DA 3CEHA 5E8JA 3UJAA 3WIBA 5AKIA 3OEWA 3BHIA 4GOXA 2C8KA 3MBOA 2C3OA 4HAZA 5D5QA 4XSHA 2D1TA 4JYAB 4BVHA 3E0QA 1X1CA 3FWKA 1GSHA 1CQIA 5COQA 3BYZA 3ZDYB 1RAIA 2XDYA 3HFJA 2QTBA 2H29A 2XB8A 4L7VA 4RGQA 5LBUA 5LCXA 4E1BA 4G0MA 3O91A 4UQPA 5T3UA 1CY4A 1WQ4A 1RWXA 4TKVB 4U5XA 3VH3A 2JJ2A 3ICWA 4CTJA 3AP1A 3LHDA 5KYWB 4HGNA 3DX1A 3DKPA 4DT1B 3B5JA 1X15A 1LF5A 3ITDA 4ZT2A 1BXRB 2DUMA 1DIOB 1DC8A 1JIVA 3R3YA 4WOBA 4YVFA 3TDMA 2P5YA 3NIGB 3TDKA 3U56A 2O7RA 1G9TA 4MVJH 1E4OA 4E31A 9ABPA 3NU1A 4JYZA 3ZDBA 1W5FA 4I2VA 4GZMA 1RADA 3SMVA 1MDFA 2INGX 3FKQA 5EUMA 5C4MA 2ZIZA 1I7DA 1EXDA 2MSNA 5HGXA 2QY6A 1AKYA 3AQ4A 1JKJB 4LKOA 3NEAA 1ZD9A 3GPIA 3PV0A 2FN3A 4B82A 3H5TA 4P3OA 3RODA 3NLLA 2BMJA 2BFDB 4AKEA 2AHOA 1T13A 4KEAA 1N25A 1J70A 2X8JA 4PC2A 4ZOLF 3L46A 4TX1A 1KU0A 5EJFA 1LKZA 3D4ZA 1KGSA 4KW7A 3TH5A 4AP6A 3JYOA 4YQEA 1E3QA 1SOVA 3NGMA 3EMVA 4PSDA 3HA3A 4ZI7F 1W88A 1CZHA 5BVHB 4MDEA 1EMDA 1NVWQ 2XOKD 2FY8A 4J16A 4XJXA 1Y1KE 1TKAA 2VJKA 1UEJA 3K71B 3KAWA 4BYMA 3CW9A 2ZB8A 1SVIA 3BXZA 4NBKA 4HTAA 1XPUA 1MMFB 4MGIR 5E4JA 1MRNA 3PE4A 3NBUA 2GRAA 3F1LA 3O8QB 2HD4A 4L5JA 3VZDA 1Y1PA 3ZC3A 1C14A 2P91A 5AVYA 1N9GB 2BKUA 3C3MA 4I4TB 1Y5LA 5EUCA 5LJLA 1H9BA 2PN1A 2ZJYA 4ZMBA 5CXQA 2AJBA 3QPVA 2CZCA 4PRZA 3E3OA 3U5TA 1XV5A 4E2ZA 2W6PA 1G2PA 4NZOA 4FR2A 1N2JA 1AF4A 3OQPA 4BNXA 2D4AA 3PFIA 2AZXA 3MWDA 4NBLA 3SFZA 3A1UA 2VH1A 4P98A 1XZKA 5LOVA 2R84A 1RQGA 1VE5A 1FFXA 2AMFA 2PWPA 2J3QA 1Z2DA 4ZVKA 4ALJA 3A8TA 3BX1A 3W6NA 3HUUA 4DY4A 1E1CB 4RKEA 3HJHA 4ND8A 4RFLA 5JVDB 4ZJYA 1IRXA 3RRFA 3CW8X 5HIIA 3KL4A 2GNOA 1MBZA 2ZRPA 2OP0A 1NVBA 3R3HA 2B4TO 3IAAA 4W1QA 1JFTA 5C35A 3B6JA 4GZ5A 2NAFA 4XDHA 3A1SA 3JSAA 1XTKA 3R4VA 4YUZA 3SBDA 3N8GA 2J7PD 3LOUA 3MC1A 1XHEA 1GZVA 3VHXA 2QJOA 4UVDA 1VLMA 4RY8A 5FUMA 2KS6A 4RIIA 1VIVA 5I9TA 1A9PA 4M76B 1KQFA 3U3KA 1QIIA 3A58B 1BD4A 3LCVB 5DE3A 3KQSA 5LUAA 4RVDA 4TN5A 1M6VB 9LDTA 4NJMA 3STHA 1XALA 5FR2A 1Z5UA 4BGUA 1OZ0A 3AW8A 5JOQA 1KS9A 2DRIA 3H8VA 2HRRA 1IC6A 2OD9A 3HKEB 3IOCA 3BKWA 4MVJM 1KHTA 5CX1B 3JTMA 3PC3A 1K2WA 4AY4A 3OH8A 4DLRA 2GRJA 4O4LA 5JV5A 2XZOA 5AUQA 1E2EA 1UP7A 1XCMA 3B7GA 5K3CA 4LF6B 1XQYA 2O50A 1UBRS 3O8LA 5CEEA 1SCUA 3L01A 2P11A 3HB0A 4YXWA 5IX8A 4X66B 5JFTA 2R7LA 1UMCA 2AFIE 3IEUA 4XPZA 4PQYA 4YALA 1BDBA 3CUTA 4KLRA 4XQEA 3JR3A 2C5SA 1GTJ1 4HAIA 4OFXA 3BWXA 4PNHA 1OLXB 2PRJA 5JJIA 3D8RA 2ODAA 3NAGA 4E4YA 1GA6A 1UMDA 3H2BA 3JALB 4YCLA 4MMYB 5A5VA 3CWQA 5MGNA 2WUFA 3UJBA 4ZYYA 5A4FS 1USKA 4MJXA 5AK5A 4Q15A 4BCDA 1K2VN 4DLKA 4D9JA 3N59A 2O54A 3CHYA 1S1MA 3T5TA 1E7MA 2NVOA 1G18A 3N2EA 2CMGA 421PA 3ZW9A 2YYSA 4OIMA 3KYDA 1XXHA 3MS4A 3VU8A 5GZ1A 3ER9A 1KRXA 1RLIA 5CVVA 3ROXA 1ZI6A 1ENOA 2AZDA 7MHTA 1QC5B 3R5SA 4TYYA 1PR1A 4QYTA 2J41A 2R6GA 1LGYA 4X93A 1IHDA 3PK0A 5ALPA 3I2FA 3O3CA 4JN6B 1JJAA 4GKBA 1MU0A 3KWLA 1AJEA 4G07A 4LXIA 1HG0A 1IH8A 3UOGA 2XECA 1WEKA 2G7ZA 2IPLA 2YVLA 1AUPA 2N75A 3IP1A 3PHIA 1G20E 2X0DA 1DQSA 1KERA 3EQ7A 3O4RA 5HIJA 1N2HA 1OX6A 1SVWA 3TJRA 1BE1A 3W6UA 2VYFA 3JQAA 2G9NA 1NUPA 2IOYA 1FYVA 2OY0A 2X1VA 3M82A 4RHTA 3VC7A 2HF7A 1VE1A 2WZDA 1E18A 4K9DA 2VHJA 3NTQA 3T0GA 3GLIB 2QRVA 2OCXA 2G1KA 1KK3A 4B6PA 1RM4A 2C95A 3ABIA 1I13A 2QHXA 4P86A 4RSRA 3SDBA 3ZCVA 1XNHA 1A8PA 1NVDA 4ZOLA 4CMCA 3TZQA 4ZFNA 1I01A 4NH4A 5JAZA 1GUZA 2BFBB 1WDLA 2JBAA 4B9AA 4LI3X 4E3WA 1A5BB 1AN0A 4RADA 1UJ5A 3AEKB 2WUDA 3NUQA 3D1LA 4NU5A 3L3OM 3VVCA 2PS9A 4P7KA 4DIKA 5E6RB 5IDWA 3SK0A 4WLFA 1VYUA 4CM4A 2Y1LA 1KZHA 2YASA 3AG5A 3G8BA 4LYAA 1B8PA 1FFBA 4RQBA 1E2DA 1ICEA 1OE0A 1DPGA 1OI4A 2WWIA 3IEKA 3L9WA 4NYMR 3WGZA 5AW4A 2LDBA 2VO1A 2F1OA 1P0PA 1PJAA 1I3NA 1OILA 3DDGA 2XITA 2Z1DA 5CNKA 1ZNXA 1LDBA 1SC3A 4EJSC 1Q3HA 4PX2A 1S89A 4NWIA 4Y3UA 4C4AA 2JFUA 4LZOA 1XN4A 1CDEA 1X87A 5E1BA 1KJYA 1M6WA 2XIQA 4RM2A 5DMXA 2PVSA 1IB0A 4F3RA 1NNEA 3DBLB 2QENA 1ZA2A 2RHGB 5CW2A 4E4RA 1RC8A 5JS8A 2XQJA 1V16B 2ZQ5A 2G08A 2OMEA 3AV3A 3FZNA 3NTLA 5LDHA 2JJ2D 1USVA 3E8SA 1IHUA 3RBAA 5LB2A 4DCGA 2WIFA 3F2VA 4GP7A 1YZLA 4FGSA 2IY8A 2A3RA 1Z34A 2TMYA 1JLRA 5BMOA 1T26A 3U4MA 4TTPA 3OAAA 1CP2A 4RCVA 4XWAA 1O57A 4YRDA 1RMTA 3ZXXA 4F85A 2Y2UA 2YIBA 2AVDA 3OCCA 4DQKA 5JU6A 2PJRA 2R6FA 4CQMB 2WV7A 2Z2KA 3IRUA 4LA4A 2M1XA 4Y1EA 2O3QA 1NW5A 1L4LA 4H6IA 1L8XA 5DNAA 2XB4A 3GAFA 4MO9A 1GU7A 4E94A 5KTRA 4BNMA 1N2IA 1PT7A 2BI8A 2VNJA 4QBGB 5EA2A 2ZCVA 1N34B 3PFGA 4FZVA 3VM6A 1SZJG 2FZGA 5LZ5A 3ORHA 3CKLA 1CWUA 5F3RA 3TRHA 5IM5A 1GGMA 1ONPA 3N2GB 3HKDB 4KN6A 1DDGA 3QNJA 4EYEA 4F56A 2P6UA 5G02A 1NXOA 3KOUA 4DNXA 1LK7A 3AHIA 3R3SA 4MQ6A 5KOJA 1P9RA 3A11A 4N39A 2F00A 2JI6A 2H52A 5ALJA 5JAIA 1CNEA 3SD7A 2I3AA 3P0JA 3QBTA 1I1HA 2JLBA 3GLKA 1BX3A 3V1LA 2NZWA 2ZJBA 5LNK1 3RVBA 3KETA 4WLVA 3RD5A 1NAHA 3EWIA 3KUDA 5CGZA 4MJLA 1IN6A 2X1LA 4O2BA 1UCFA 2NU6B 4EYOA 5DYGA 1YS1X 1G8KA 4IBOA 4TXHA 1XLUA 2QUAA 3WLHA 4MR8A 5H1YA 2R6AA 1ZGCA 1C41A 2C7BA 3LPCA 3PQ6A 3V8PA 4YECA 1CUJA 1R5JA 2J3LA 5EIBC 5BN1A 5ITZB 3RAFC 1EINA 4ZJUA 3WWPA 2DTEA 1B8VA 2GCIA 5ADUS 1W8IA 4JYPA 5ECWA 3ZY6A 1WKBA 1NLFA 5CJ2A 4IW0A 1B3BA 1O95C 1Y34E 4JBYA 4FTWA 1U7TA 2G88A 4M0EA 3K0SA 4NV3A 2HDNB 2WTXA 3G7SA 3L02A 1T9AA 1KP9A 1RLUA 2VTKA 3KUXA 1BO6A 5F7JA 2UDPA 5AM4A 4OI0A 2QW8A 2VK8A 3QVMA 3UG7A 3NRCA 1ZFNA 4J0HA 4G8JA 1PUXA 4LRXA 5FV7A 4AUEA 5DK6A 3JAWA 3VSDA 3I2HA 1TU4A 3RV1A 1V47A 3LF2A 2HI0A 4ZAWA 5K01A 5L7TA 1YC5A 3WKBA 2BMAA 1LW7A 1XRLA 4JZKA 5C8YF 1UJ6A 4J07A 5D00A 3GWZA 4BBJA 3TW0A 1NSFA 2QBYB 4KVZA 1QVRA 5GJVC 3EOZA 4YO8A 2WAOA 3GJXC 1RQXA 4PBRA 4PLHA 3HDHA 4TUYB 3VC3A 1NQUA 3M70A 3QOXA 1VBMA 4HEJA 4B9EA 1GT6A 1K1EA 3I8OA 4LZPA 3UWOA 1YDFA 3BHJA 5B55A 2B30A 3F7TA 2WKPA 1WMSA 3AFHA 4Q02A 3I37X 4U7JA 2HQSA 5CCDA 3EUEA 5CD9A 5IH7A 2KYRA 5ALRA 4K9NA 4NE2A 4QEZA 3SG0A 2JATA 5KTYA 4KXUA 1UPCA 3FMGA 4IXMA 4PE5B 2NZYA 2IIVA 4Z49A 4Q00A 3HHEA 4DNFA 2G17A 1XJ0A 1GXSA 2KQUA 4IIVA 4WK0B 1KVUA 2C1XA 2G04A 3A9TA 2F7RA 3AHCA 4HDSB 2QQGA 5AVSA 3VI4B 2VT2A 1YXMA 4CLXA 1TUEA 1Z6YA 3LZ6A 4QECA 1T4BA 2EZ9A 1VE3A 3BXHA 3U39A 3N0RA 1G42A 5JH7B 2C5EA 2DH5A 2PKXA 4Q03A 4QGSA 2H0AA 4KAAA 3ANSA 1LX6A 1QLJA 1C4WA 2IP4A 3MTJA 3ZW8A 5C8VA 4B76A 3KOOA 3OJLA 4DNQA 2O1SA 3DGEC 1FFWA 2JCYA 5L3QA 4MW2A 4WLNA 5FNVF 1DAPA 1JQDA 4BL5A 3K53A 5KYXA 3KG2A 5B3LA 3EQ6A 3EEBA 3ZGVA 1PT6A 1N2CE 2FPRA 3CEAA 4GGOA 4RHXA 2WTEA 3GL9A 2ZTLA 3LSTA 3U3JA 4I4LA 5ALSA 3SICE 3GYGA 3K1TA 1A2QA 1Z0JA 1V1MB 6NULA 2F3RA 1ZIYA 3QQPA 4Z9XA 2ERCA 5A6SB 4AJ4A 5CLFA 3UPTA 4JI2B 1GQRA 2EJBA 3OMWA 1XZJA 2DFLA 3IR6A 5F5LA 4DIFA 4M54A 4TS3A 3RS2A 3VJLA 1DSSG 4UD2A 4WVLA 4L4UA 4ZPJA 4X63A 3E5NA 1D6JA 4BYGA 2Y27A 4YUYA 3Q3VA 4JI3B 4TV9F 5D5HA 2FPGA 4K9OA 5ENZA 3MWLA 4R83A 4RJIA 3RHZA 3WV5A 1GAQA 4BNFA 2H92A 5AMXA 5JSZA 3E9YA 1N2XA 5EG5A 2H1FA 1SWVA 2VDKB 4IMRA 4XIYA 1IN8A 1AGRA 1AT1A 2ZJ0A 1AG9A 4L9WA 4MI1A 1ZRNA 2EOAA 5CCXA 4JLJA 1ZSVA 1QAMA 1GDHA 3LT0A 2VRBA 4TS9A 5HFAA 4OM8A 1P7ZA 4Q4JA 5FL7D 4RZ2A 4DLTA 2XLBA 4YMIA 4XQGA 1W4RA 4EK9A 1WVIA 3BJEA 4PAGA 4CNBA 4FHFA 3WTCA 1BHQ1 1Y8AA 3BFPA 1MQ9A 4QUGA 1AQUA 5TMDA 1SXPA 2ZRHA 2AQKA 2GKOA 3NHZA 4OQ4A 3TLEA 5A3RA 1UEXC 4E2WA 1E0DA 4ADSG 4YRNA 3R74A 3ZQJA 5DV9A 2XMRA 2HSJA 3G5LA 4HZGA 4DM3A 4RBNA 1Y3FE 4PFSA 2A9QA 1HLGA 2IKQA 4PEVA 4PPFA 1C9EA 3A25A 2GZAA 1V7ZA 2Z8YM 4IR7A 3G2HA 4F38A 3GJ8A 1EUDA 3CLTC 2O3RA 4QLBA 3MAJA 3NEYA 2JFXA 3H4TA 3QVKA 4IVQA 1JEJA 4BFVA 1QTIA 4XR9A 3NBKA 4G09A 1WHSA 2WG2A 1UL1X 3KR2A 4CEIA 5EHGA 2R4TA 4H7PA 2QM8A 1ZKMA 5T4HA 2ZIVB 2V0CA 3NIDB 2HCJB 2G8LA 5DCLA 3OAAD 2R44A 4BN4A 4E15A 2WK1A 5JCJA 5I48A 2POQX 3TGPA 1N36B 2JNSA 4D46A 3B52X 2LUOA 5JAMA 1HWWA 1C9MA 1H0KA 3N05A 3PZRA 3GFRA 5LZ8A 4J0DA 2EL9A 1QAOA 1YCHA 3BK2A 4YC7A 5CYPA 2V7GA 3UYKA 2R8OA 4ZHQF 3B8EA 2OESA 3K1AB 4YCAA 1JI0A 2PAAA 4XQCA 4BWYA 1RWPA 1SXJB 1C8LA 4D4LA 2BH2A 3AY3A 1C1XA 4MAMA 1DCMA 3QF7A 5CH5A 5C8YA 2PRYA 2AMYA 1V8PA 2DQSA 1YIOA 2W43A 1VE7A 1I7LA 4XD2A 3FJ1A 4RDXA 1KF0A 1G8AA 5ADWA 3EUAA 5EHZA 2G1PA 3CXRA 3IVRA 3SZGA 3I34X 4EG5A 1SAYA 5D1HA 2XXAA 1SB8A 3T7EA 5K3OA 1R4MA 1PFWA 3AKDA 3HWRA 2Y9PB 1UBMS 2Q6VA 1PFQA 2Q6IA 2ZYIA 3Q3IA 4G56A 1GQOA 1I8TA 4BFXA 1B1CA 1W5TA 2GYYA 2ZROA 1DELA 1R0WA 3K30A 3G0DA 2IVZA 3W5HA 2IS1A 1U04A 3H18A 3K92A 3EASA 3EMKA 2JCVA 1CF2O 3EQ2A 4PS1A 3C3YA 3CUWA 3G68A 3BE8A 1LVHA 4LVNA 2YFQA 4RPIA 4XYMA 4OQLA 1Z33A 1JNXX 2Z2XA 5TSDA 1U8YA 4TYMA 1M2KA 4MROA 3SIPA 5K2OA 3W8DA 2F59A 4E5PA 1BAPA 5LQDA 2Q0SA 4OSOA 3AERB 3EY9A 3NDIA 1YB4A 2WJZB 5L7YA 1EQUA 4XWWA 2CVHA 4ZOBA 3EXG2 3EJQA 2GEVA 3LUAA 1PQWA 4UJ5A 4B79A 2QP9X 3ODGA 3H2HA 2BSQA 3ISJA 3BUIA 3A1FA 1AA6A 4G86A 1V1RB 2C2OA 4RY0A 5IS2A 2EATA 1PVVA 4JH0A 4GMDA 2YV2A 1RZRD 2O7QA 1MC4A 3AESA 1OKKA 2IUSA 2BCJQ 2FW1A 4NEGA 1DUSA 2F8MA 4O2RA 1ELOA 1RJDA 1F0YA 2PWAA 3T06B 2QZSA 2OYCA 3UFBA 3L4KA 4C22A 5I7RA 3ERCC 1RWKA 4I1VA 4DMGA 1S3GA 1DRVA 1S2IA 4OKSA 1L1RA 4TROA 5HKKD 5FI5A 2VJMA 4CXMA 3DXYA 5ISMA 1M5UA 1P0IA 1D04A 4LNHA 2BKVA 2XA1A 1DU4A 2GAIA 1EVKA 3BIOA 4IP0A 3Q85A 3EVNA 4LECA 2XHZA 4QYIB 3TX2A 4BVLA 3T3OA 3NM5A 4H18A 3AL2A 2IFTA 1TTQB 3B1FA 2Q2NA 3H1TA 4IVPA 3W2HA 5FX2A 5HQTA 4R3NA 3EOBI 5EWJB 3BFVA 3D8HA 4FEAA 3V8VA 4EHJA 4RKWA 4B3MB 4TV9A 2LDXA 3I58A 2X7HA 3ESYA 3R6DA 2CBGA 2GPYA 5FBKA 2A0WA 4EF6A 4RA6A 1E2KA 4ZVMA 3W5JA 2QVBA 2H65A 4OB6A 1O0CA 3WIDA 1SUBA 2DPXA 2VFAA 1X14A 2YIMA 2JI9A 3EBOA 3GFGA 3GRPA 1HG1A 4QOIA 2BWJA 1OF1A 4RV9A 4TYWA 5TR9A 3UO8B 2X8WA 2XT0A 3UAGA 5K0EA 1QQBA 5AQEA 2FNAA 2CJWA 2H11A 2NO9A 4HC4A 3LTEA 2IPNA 2Q99A 2QW1A 2I34A 3H0KA 1A8QA 1E3JA 4LQ4A 3MB5A 3MNFA 3HCNA 4O1IA 4PZ0A 3CN7A 1ECJA 1LSOA 2ZJZA 3CH4B 5FWYA 5KWIA 4DE5A 1I2AA 1X3SA 2HMAA 2YJNA 2ZE6A 3PXCX 1XRJA 3IAXA 3WIOA 5IKPA 5AVJA 5JFGA 5SY4A 2QMZA 3TCNA 5JZ9A 1V11A 3FSGA 4XARA 3UCXA 1UDCA 5BRNA 3W3AD 1VHQA 2NOAA 2ZBUA 1E7QA 1EE1A 1KYZA 4PYKA 3JQRA 2P2ZA 2VUUA 1T4DA 3DDUA 2GCEA 3NPMA 2OHGA 3CT6A 4ZAVA 3ZNOA 1OB5A 3R3UA 1I36A 5HUJA 2IS2A 2BL4A 1AH2A 4P81A 4LNAA 1Q0UA 3HLYA 1EB8A 5FR1A 3UMYA 4HLDA 3OSZA 2QWXA 1T3GA 4PN7A 3QFCA 5DBGA 3SY8A 1YZKA 3AY7A 2ZBGA 2CUZA 4OQDA 1G8GA 1HYQA 1N5DA 1RACA 1VMDA 1YQEA 2H5JA 2Z09A 3HVHA 3N86A 3QPBA 1DEKA 2BSAA 4CM8A 4E5UA 3SHVA 2WWWA 3O6VA 3WOVA 2JFBA 2Y1OA 3CVWA 4EJSA 1UM9A 4P33A 3DB2A 4UM9D 1REQB 4TKMA 3Q6NA 2CLCX 2H6EA 2JCGA 3NTRA 1F12A 2DWOA 4RULA 1LPSA 3CNOA 2BDEA 3I6MA 5CLQA 3TLKA 3UICA 2P3QA 2PMCA 2RHRA 3I05A 2HU7A 3WRYA 1SBNE 2XDAA 3BUBA 1Z29A 5HQ3A 1QZ3A 2JA1A 2B5WA 2HF2A 4RJLA 1HTYA 1IWPB 3RHSA 4FGWA 1Z4QA 2RGGA 1DFIA 1JFRA 4MEBA 3VQTA 4L4RA 2F18A 1D1PA 1FYDA 1FTGA 3UW1A 4C43A 4YT4A 1K89A 2Z9CA 3UJDA 3AEUB 3QYJA 5AUOB 2IBTA 4HP8A 1BWRA 3F9IA 2AUNA 4NG4A 3G9GA 1TZJA 3GEEA 4P3YA 4EJMA 3F2IA 2NXEA 1QH8B 3X1ZA 4DQ0A 4OK3A 2BGWA 2AT1A 2IEYA 3GLHB 4F7WA 1TFUA 1T2FA 4O4IB 4R7TA 4UTRA 3VR1A 4A0GA 4GW3A 3Q8WA 2Z0MA 3DCJA 4FT4A 2GCGA 3ISVA 5JANA 1O1YA 4W1SA 3GAZA 4W9RA 3ZBUA 1QHEA 2VWQA 3THXB 1X1TA 2FWNA 2XCLA 3GH1A 3ZWNA 4EECA 4Z8YA 1NAIA 4YAUA 3HBLA 4HAVA 4I50F 4RKFA 5FFMA 1Z8DA 2OXIA 4FYVA 1BE6A 1CY6A 3F3MA 3TGWA 4UMFA 4ECEA 1IXYA 2PCJA 5JD6A 2AC4A 4E21A 4G5GA 1W44A 4O4HF 1II8A 1CRWG 1UK6A 3EG9A 2DU8A 4OI1A 4GOLD 2XMGA 1M9NA 1NVGA 2RAFA 2ZRCA 3BK1A 4A0SA 4ZDKA 5IUNC 1VCOA 2D7JA 2EFJA 3OZCA 1FOEB 3SEQA 5AH0A 5KNDH 1UBSB 3ICOA 5JCJD 2IY9A 4BU1A 4JIMA 1O0SA 1S7GA 2VNAA 3REQB 3RLIA 1STOA 3M6MD 2QMHA 3E84A 3T48A 1KEPA 1DAKA 1EXMA 4QPPA 5JDIC 2W2KA 1MJ5A 2G80A 3EVGA 4IJQA 4DPKA 4AY2A 2WWHA 1FS4A 3E2IA 1Q77A 3HCBA 1ISPA 2AK3A 2WSMA 1PJQA 1DTSA 2VWHA 3L8FA 4AO6A 1JQ5A 3SZUA 5E1DA 4C4ZA 2X7JA 2WYWA 4BGEA 4DHWA 1IUPA 2JJMA 2PX0A 1JG4A 1O94D 3DVAA 4NV1A 5HXAA 3D8BA 1P31A 1O95A 3RF7A 1L5YA 3CEMA 3I8XA 2JFWA 2Q49A 3RSLA 3CGGA 1J07A 1UF9A 1SXIA 2YC4C 3SIRA 3ZDEA 3EDCA 4LE2A 5EE9A 4D9IA 1H0HA 3KTFA 2GK4A 3WIUA 4HQ0A 4CV0A 4QM6A 2P78A 4YRPA 3VVMA 1E9EA 1E77A 3EXEA 3IURA 2XCOA 5FTNA 3WB1A 2XQVA 3DV0A 4IUYA 4MAFA 3BXGA 2OENG 3K5IA 5CJPA 2XV1A 2V7TA 2B4KA 2ZJAA 3QP9A 4QT0A 3CB4A 4RH3A 2QRJA 1D6SA 5C34B 2ZULA 3GT7A 4FQ8A 4HB3A 5FO0A 2H1IA 1V43A 4D9EA 3TM4A 1ABBA 3K0AA 3KQWA 3NXSA 4CBVA 4CLOB 5HK9A 4OHVA 3KYCA 3NW9A 4R7GA 2JVIA 1V71A 1CUSA 4M0LA 1XZLA 5HHTA 1YVUA 2I8LA 1G5TA 2ZSKA 1ZJWA 2VJOA 4C89A 4AJJA 1D2MA 1I4OA 1SBCA 4EKEA 3VJRA 1LV8A 1NLYA 1XEAA 4EEKA 4X91A 1KGDA 1ZD5A 1IMOA 1C1HA 2BGUA 1P6QA 3DBHB 4BX3A 4EQ6B 2GFHA 3BB3A 1V5EA 1MF7A 3OX4A 5CM2Z 5T7BA 2H7VA 3EIOA 1ZRHA 1H2HA 4B0PA 4D4MA 2VTBB 1NURA 3N7UA 2Q2OA 5JYDA 3JQPA 5EINA 1C81A 4X20A 2E3JA 3CW2A 1UAGA 4OI2A 3WK8A 2QTWB 4ZPXA 3GLIE 3UJ7A 2YZNA 4JT9A 1ZSNA 4I6EA 2CNKA 2B0JA 1X9GA 4IYRA 3AKZA 3L7NA 1N33B 1WZEA 3S68A 2RHWA 3A0RB 3H04A 4CM1A 3C3EA 3MQ2A 1HT3A 2J9GA 3E23A 1GZDA 1WCXA 3RRNA 3CWZA 1UJCA 2J3KA 4D3FA 4E4TA 5MGBA 4I99A 4EBBA 2CLMB 3DEZA 4UU8A 5HPYB 2C5AA 3QU5A 3S2ZA 4FFSA 1CNMA 2XODA 3OF5A 4TLLB 2AFHE 1W19A 1T1GA 5IC4A 1PKEA 2Z9DA 2PGIA 2GHIA 1DO8A 4X7MA 3FPAA 4LQDA 2QR2A 5C1DA 1IZYA 1GO2A 2IV2X 1OXMA 1T25A 2QD3A 3I01M 2VNHA 4X64B 5ETJA 3HMKA 5GJWC 3LK6A 3O83A 3QYFA 4V24A 4OKIA 5HK8A 3W5UA 3WBKA 5ITVA 1NQOA 1H1LB 4K87A 1QONA 4PWYA 4RW0A 4AFNA 1S2GA 2PSDA 4ZO4A 4QTXA 1U8UA 1XVIA 3B38A 2O8VA 4IFEA 2Y92A 4QGFA 3P71T 2V0GA 3OTIA 3JYPA 4IGIA 1TZ2A 3AO0B 3OQHA 5LP6C 5JNTA 2XVZA 2HLPA 3FSGD 1W4BA 3TPZA 4H08A 2EBHX 5JSQA 1OWOA 5D85A 3ZDQA 4UCQA 2KX7A 1V0JA 4UXIA 1DT3A 3R23A 4U2DA 1C2TA 5DTIA 2OC9A 3O1IC 4KXVA 5GP1A 3BF8A 3HXOA 1E3WA 1SKBA 1IN4A 1XMVA 2E4YA 2I7TA 2VSOA 1R4AA 3K6JA 4WBNB 1EZZA 1VSUA 4ZXPA 2VPQA 1I3KA 3HYLA 3QEMA 1GKUB 3Q3CA 3A3YA 4PAOA 3EFHA 3T7AA 1ZEJA 2O57A 1BDJA 2QLJA 4BV3A 4N6OA 1QFXA 3B9PA 3RVOA 3LL7A 4TWBA 1L4GA 5IARA 3S2EA 3RS9A 5CVEA 3DE6X 1HQCA 3IP9A 4NENA 5DRTA 3QE4A 5FUWA 1DG9A 2EX0A 1EWKA 5LLSA 4MEJA 4QYMA 5KSYA 3CCCA 3QX9A 2B1GA 3E27A 4DL9A 5ADHA 3ZHQA 4JVMA 2ZM6B 2BMVA 4XQ0A 2CFTA 2O5VA 2WPDA 1D7OA 1BN6A 4M9QA 2OSVA 3IBGA 1AK9A 3PYXA 1SU7A 4YRSA 3B8HA 3R6LA 4JC4A 3AUYA 4MLDA 5IBQA 4CV1A 1FA9A 3ZI7A 4FR5A 1H4SA 3T3DA 1FJGB 4O3FA 2JCBA 2ZI4A 4HR7A 5FBQB 2XGMA 1KJIA 1P1CA 2P68A 3RYFB 1CUUA 1SBHA 1S5PA 1G6OA 2HRZA 3ELYA 3OF2A 4FWBA 3N8KA 2OUKA 2YWEA 1BKSB 1UPTA 3HEBA 4MP6A 4QYWA 3GWGA 3RS4A 1KOGA 2P7IA 2PKQO 3FNIA 2I87A 2OPHA 4BNDA 3KB1A 3ONDA 4B73A 3WL3A 2E6KA 2PFKA 4R9RA 4A73A 1D1QA 4Y0VA 1LPBB 3MGAA 2QRGA 1R0LA 3JQEA 5EIWA 5G2OA 1RAGA 2ACEA 2C2GA 3EWSA 3TQCA 3UENA 4C7BA 5KX5F 1I6LA 2QAGC 1Y9JA 3LRXA 3QLUC 3SPXA 1HRKA 2P0YA 4GSYA 3CIFA 2G77B 3O8OA 5FOQA 2BEUA 1X7XB 3QV1A 5K09A 2SICE 1YRYE 1I2ZA 1M2EA 1T8YA 2R7KA 5AYVA 1JBEA 5D3ZA 5B37A 3ZUPA 1B15A 5I45A 3CX8A 5K0TA 2XYHA 2RHBA 1DXYA 2AKYA 4MWCA 4D3YA 3N5KA 4ENPA 4H77A 2OKGA 2AIRA 4PX9A 5LQAA 2O3UA 4NXMB 1Y48E 1U1DA 1JMYA 4BFZA 2XVAA 3QI7A 1T2DA 2VOJA 3K0KA 4JNKA 2HQ1A 4OH7A 5GY7A 5JSKA 3V2UA 3ZKWA 3ZV7A 2BUAA 1KE2A 5DYNA 4AS2A 4RZIA 1KZ6A 1QE5A 3NDPA 2X3UA 3LHFA 1DL5A 4B71A 2FDCA 2VJLA 1UK9A 5DISB 1EVEA 1NTOA 2AXNA 3UUGA 3UFXB 1U7WA 3AINA 1IATA 3I32A 3Q3EA 4G67A 3RE1A 3EFOA 4FDAA 1K0UA 1W0KA 4AZ3A 4ZI3A 2C2MA 4WPCA 2FLWA 2QLFA 3GCWA 3N2KB 1Z16A 4JNCA 3UXEA 3ZK9A 1RIIA 5I7VA 3VYUB 3NBMA 1TL7C 2PZEA 4HYYA 6YASA 4HBGA 4IDQA 1R34A 1ETUA 4ZAZA 1DGQA 3KFLA 1PNTA 1KI4A 2HDOA 5CDFA 4P82A 2VAMA 2J32A 4X1YA 2P90A 1PW7A 3JQGB 1NUQA 3S1LA 1G2IA 3CNHA 4NEHB 3TTSA 1Q7GA 2ISCA 1ADYA 3O7MA 2ZRMA 3B7PA 1XZQA 5KC8A 2V6MA 3MJ4A 3EXG1 3NIBA 1NVVR 3F5QA 4NZNA 5C2JB 3M6UA 3ZHZA 3PUHA 2WNHA 1QFSA 4ZZ2A 1E7YA 3T7RA 4AZ0B 3KYIB 5KJ6A 1X0XA 3AFMA 2FR0A 4O08A 3KJNA 3VR4H 4C0AC 3DYVA 2QAJA 3D4LA 1Y3AA 3Q9UA 3NNSA 4X71A 1NN5A 5DNWA 3RASA 4YV7A 3L92A 2MT9A 1X38A 2IYPA 1SHUX 1KSFX 4IFIA 2E4WA 3EGVA 4JYCA 2HYIC 5A9RA 2PS0A 4PXYA 3IHLA 3LLMA 3OKAA 3OLCX 1K88A 5DHPA 4AP5A 4DJTA 1RP1A 2HGSA 3HBAA 1RBYA 1WXQA 1JWAB 2Q7OE 3GH3A 1Z62A 3TW8A 3ELWA 3T1HB 1LDNA 4JUFA 3WMRA 1VLQA 4GSKA 5A5GA 4INOA 3II6X 3SYRA 1Z8HA 1T8WA 1D0VA 3R0VA 3A3OA 1L7VC 3WJ1A 2J9ZB 1JU4A 2QI9C 1T15A 2JGNA 2OZVA 3AEZA 2X0KA 3C3JA 3A6HA 2EG5A 4D99A 5BN4B 2IEDA 4OEHA 1M83A 5TGTA 4RAOA 5GOZA 2JJ8A 4R2IA 1SUCA 5C3UA 4B4OA 2PV7A 3ZN2A 2C99A 2AN4A 4BLWA 4XA8A 2H5EA 2JKVA 3WB0A 2AW3A 2HBRA 1RCUA 3FZQA 4DMLA 1X04A 4EA8A 5GZ3A 3U16A 3TZHA 1COWA 1RYYA 4MGKR 2ZVQX 1CF4A 1FSFA 3HN6A 2EYUA 3W2FA 2H63A 5AHKA 3JYNA 4NY1A 4E22A 3MQFA 1I7NA 4MPTA 1KEEA 2GF4A 4XCXA 1Z74A 1JQJC 1QYCA 4JEUA 1GTG1 4EZWA 4QU9A 2IJGX 1PG5A 5FJJA 1AMUA 1RAHA 1QP7A 4R5IA 5TQ0B 4DCNC 3IPYA 3RABA 3ZKAA 2LZ0A 5EKTA 4YRGA 4TMVA 3LK7A 2YWJA 1LWOA 5EE3A 2HSWA 1U8FO 2FSIA 3DAPA 4G0QA 4RVUA 4XB1A 5CIWA 1FP4A 2WSLA 3GG9A 2AR9A 5FWDA 1HM5A 1MEOA 2J9XB 4QE3A 2HB6A 1VCMA 4RV4A 2PSHA 2YUTA 5DNYB 2RGEA 3A4TA 3D6TB 3IAS1 4FHCA 2GEBA 1CJUC 3FHCB 2N3ZA 2VP9A 4MQFB 1QYXA 3T0IA 2A9FA 3T1TA 4BNHA 2W2XA 4GBGA 2YIAA 1WNTA 2W8BA 4KQXA 2OAP1 3QVVA 1E6EA 4BIMA 1YZTA 1ZCAA 4IX9A 2F4VB 1L5QA 4CFSA 5IBPA 3PQ4A 2CYAA 3MA0A 1UWKA 1QK4A 3I23A 5CEFA 2IPMA 1HDOA 2WJVA 4I8XA 4EZEA 2P1DA 1UDBA 3I9V6 5M7EA 5DGTA 3ENVA 4NBNA 5ED0A 4AB1A 4C1NA 2OBFA 1INLA 3LYUA 5DM1A 3WJ7A 2GF2A 5E38A 5C7LO 3SNHA 2C4WA 1XTQA 3EZFA 1HDRA 1SXJE 1GL7A 2CUKA 4OHKA 4NCBA 4IJWA 3LP5A 1EHIA 1T43A 1TIPA 1H94A 1YNSA 2W2NA 3DHEA 3OUTA 4NOJA 3VTZA 3OKPA 4R9NA 2IWRA 1LBHA 1C8VB 2LCIA 1U98A 3PHHA 2VHYA 5JSHA 2RI6A 3TTVA 4UBJA 3COZA 2ANCA 4Z1OA 2FX3A 1YAHA 2WPDD 1ZK4A 4IHJF 3PQDA 1J21A 4B9QA 1P74A 3PGJA 1Y3CE 2P4EA 2BBOA 3OE7A 3QNMA 5G0VA 3D8SA 5JS2A 1M1YE 4C7XA 4RNDB 1PT9A 3C3PA 3KPYA 2YJ5A 4KZKA 4C03A 4EY8A 1EJ2A 1A4IA 4JOQA 1CSEE 4H0CA 5EE5B 5FWXB 2GYWA 1Z07A 4NTZA 4LVOA 2ST1A 3A6DA 5H5JA 5IKMA 4BBZA 3B5IA 2EJWA 3HVUA 4X6LA 1C4KA 4EPXA 1VHDA 3ER8C 2OLEA 1EX9A 3TBKA 3FUTA 4AVYA 1Q74A 1F8FA 2VDWA 1U5AA 4QEDA 3RAGA 4BGIA 4XIJA 1ML4A 4XGKA 3DEIA 3I3OA 4Z9YA 3FMOB 1CIVA 1U0RA 1Q12A 4AZSA 5KINB 1S2LA 1V48A 3LMKA 3NMUF 1SRQA 2QTGA 4DNPA 3HKCA 4H60A 4JQCA 2A3NA 5F1PA 1PYOA 2F1RA 4PF1A 5KQRA 1XK7A 2PEYA 1FPQA 4ZRDA 1ZUWA 1WB9A 1N2EA 4LMRA 3PNVA 5HILA 2CHQA 2ZT7A 4D3SA 1ODIA 4DG5A 3WFIA 1NC1A 1QYDA 3NHMA 3QKSB 621PA 3HAHA 3PTAA 2FFRA 3S7ZA 4TS4A 1VG1A 2C9BA 3OLWA 3LVTA 1U28A 3O2QB 3NP7A 3PR2B 3R0XA 4DMRA 1Z68A 3AJ9A 3UHOA 3ZR4B 4C7OA 1PJTA 1QSGA 2J08A 1P29A 4I81A 1QS0A 2Q41A 1P72A 4PGFA 4OHUA 4RE6A 4ZVLA 3CLRC 3D5EA 2YQZA 4IJ5A 4TWJA 3LOPA 3WL8A 1UXIA 2I9PA 4QICA 4A6EA 2X3FA 4B4KA 3UMVA 1FMCA 5FBLB 1KJNA 1RYHA 3DNMA 1NV8A 1JQEA 4PYOA 4A0FA 1KI2A 3VPDA 2F48A 4DMKA 1MB2A 2GXSA 3QHQA 5LXTB 1NC3A 4EJFA 5LIPA 3PGKA 4M0KA 1EQAA 1P33A 1Y9DA 3PKZA 4RPGA 5EZ6B 3VR6D 4BX8A 4F6RA 4JGGA 1QH0A 4WKPA 4XB6B 5DGHA 3V6MA 1UZAA 2OV6A 1H9AA 2ASVA 2LPMA 4PYJA 2XDQB 4C0XA 2G4CA 1C3OA 1T6XA 1H2BA 1O6CA 3LXUX 5E4YA 4JL8A 4AN1A 5DOZA 4AJHA 5TPZD 1RMYA 1L5OA 1N6OA 3A05A 3T94A 3DKKA 4JD5A 5IU6A 1ZRSA 4R5JA 3V1YA 3T7KA 4EB6B 3RK4A 2GUWA 4GECA 1JHYA 5GM1A 1PO7A 1JNYA 1OZHA 1Q1BA 4ZC1A 1X77A 1ONBA 4TTQA 2UYGA 5A9SA 1NJ6A 1R8XA 2SCUA 2ZSJA 5JXWA 1E1RA 3ZHUA 4D6XA 4BNEA 1ZNYA 4BQIA 1VGQA 1JU3A 4QWWA 1NU8A 1TUBA 3X44A 1QWNA 4OUDB 4EG4A 1FXWF 1YJCA 3EVAA 4DA0A 3TGLA 2VQ3A 4B84A 4CCYA 4L76A 1AKUA 4UFOA 2J5KA 3AEQA 2W4MA 3S29A 3TEJA 3KSAC 1GFZA 5HZMA 3LD9A 4RJTA 2Z4RA 3KKNA 3SJUA 1TADA 3DDZX 3FYUC 4LJYA 3BVUA 1U2QA 1Z0FA 2XGOA 3ILSA 1G6KA 1JVBA 1SU6A 5FLEX 4LXTA 4Q4HA 5KYUA 3RS0A 1IZ8A 3A98A 3WZMA 2Q6LA 3W06A 4E6EA 1ONSA 2N0SA 3AB3A 3FTFA 4TV8F 2IUYA 1CJSA 5FIUA 4CU5A 2HSEA 2QN8A 2ZB4A 1ATIA 4RL6A 4EW3A 2ZUEA 1DX9A 1K6XA 4F5ZA 4MW9A 3TR5A 2H1WA 1THMA 2C2WA 3UUWA 3I2YX 2Z0VA 4QGGA 5EJ2A 4M86A 4X1IB 5BYKA 3V1KA 1L8LA 1Y6GA 4P3NA 3K2EA 1XRQA 3AOGA 3L4EA 4ZT7A 1Z6AA 5LP6A 1WDWB 4FT2A 1GZUA 1NXPA 3CBQA 4PSUA 3A4IA 3JQ6A 4DDWA 2P9GA 4YI3A 4E1VA 3GVHA 4XLZA 5CURA 2XE6A 2X4DA 1JAZA 1ZM7A 4YDSA 5EIAA 3RIMA 4IHJA 1T1EA 4YAFA 1PJLA 1RWMA 4EJ0A 4UNNA 5AVWA 1ZPDA 2R8YA 1XAHA 1CXZA 2AN1A 2VZ8A 4EVQA 4RX1A 3IC5A 1KQOA 1UBNA 2C1EA 2IXAA 1PVDA 1JEOA 2VA8A 3BIFA 3GLHE 4J1TC 4CCAA 3KT0A 5J4KA 1RYZA 1MTZA 1P4RA 1ZGGA 2C83A 1GGJA 1PGQA 2QDKA 4KV7A 4U7DA 1FLAA 2MJLA 3EVFA 3LQYA 2HFKA 2QI9F 1ZN2A 4U4AA 5IMSA 2GCOB 5KZMB 3LC7O 1XNQB 1NVFA 1GADO 3E5RA 5E1MA 2QW0X 1Z88A 4KXMA 4PRKA 4B1FA 3NJRA 4MTCA 2UZAA 3K9WA 1UEIA 1TM7E 2VF7A 4YRJA 4CQLA 2GSWA 1ECCA 1NSYA 2RC6A 1FLNA 3VKHA 3DZKA 3OCVA 4CDMA 1X1DA 3PUVA 4UDYX 2ZZKA 1L7QA 2V03A 5BUQA 1Z63A 4CL8A 2V7PA 4KR9A 5CUQA 4R01A 2CWWA 1JIXA 3ZE7A 1ABFA 2MIIA 4LBWA 1MRSA 4NLLA 3M6XA 4N5DA 5AW9A 2YHUA 3OC6A 1C50A 3WMGA 1WO8A 1T5IA 3QSGA 1N4AA 3SN6A 2P5TB 4KMMA 2IYWA 3M3HA 1EA5A 3IP7A 2ZKLA 2FHSA 1RPTA 2F67A 1ZU5A 2GO1A 3RSHA 3K8QA 4KXLA 4XVQA 3WK9A 1P0CA 2QAGA 3C2QA 2ZYVX 3PFNA 3QLUA 1EFHA 3DX0A 2BUBA 2IXBA 3KQYA 3FKSD 2GO7A 1JJIA 4L08A 4BNIA 1AURA 3FFWA 1QPBA 4WN9A 5JSYA 4C2UA 4NHEA 2RAIA 1WUHS 4U7FA 4CMBA 1K98A 1NULA 3OE7D 5AIBA 5D86A 3LCMA 5HIKA 1ZXBA 3ET5A 2XZDA 4IIDA 5TRTA 1EFTA 1Y7PA 4ZVUA 2CL5A 3DT9A 3FPCA 4NC9A 1HY3A 4Q9JA 3NC4A 3NM6B 1IUKA 1NATA 4CUKA 5JC1A 1S6YA 4JN4A 4WNYA 4RXTA 4ZGBA 5AQ1A 1AIPA 2FPPB 2QG9A 3DUFB 3PF9A 1SR8A 1FDVA 3WC4A 1AQNA 2FPIA 3R9XB 5JZSA 3N2YA 1Q0LA 1NVUQ 1QBKC 2QVYX 4UAUA 4BZWA 2RGNC 3IT0A 4MV0A 1OMOA 1C1YA 4LOKA 1I10A 1NHGA 3PGMA 4II2A 3PWZA 4MIKA 521PA 2QLNA 3KDAA 1A9OA 2O07A 1HKHA 1WVMA 4L07A 4M1YA 4RK7A 3EZXA 2Q4OA 5DBHX 1SVMA 1HFKA 1WA5A 4PM4A 4TYPA 2PEZA 4ZU1X 1AC5A 1FVOA 1FSPA 3SLKA 1T5LA 1EFPB 2P9HA 4M8NE 3VX3A 5JRDS 3ENZA 3GRVA 5CCBA 4E0BA 4BRUA 2F9FA 4UXJA 1H8HA 4N0MA 1FXWA 3INGA 4IWXA 3L0IB 4HKTA 1WMFA 2AJDA 1KI6B 1QORA 2LKCA 2RG7A 3BTSA 3CRZA 1X7ZB 4MLCA 3C8DA 4YT8A 4NMLA 4XOUA 5BR7A 5J1SB 2RAPA 4C05A 1XHFA 5ALTA 1J1ZA 5F9MA 1TPYA 2B4AA 4W9NC 3SF0A 5K4AA 3WLKX 3IAM6 4BVKA 3PR1A 1UXOA 2QL7A 3ETGA 2ORED 1F2VA 1RHRA 5FOWA 1AHHA 2H1RA 1V5IA 3B1KA 1IVYA 1RWOA 3MRSA 4TV8A 3FWYA 4MH0R 1WXFA 5DTMA 2CVPA 2ZI5A 4NZYA 3NWOA 3ZTTA 4Y0NA 3D3WB 1LJ8A 4A7PA 1PG2A 1R5EA 4ZAXA 5JISA 2E2WA 3OQNA 1I2CA 5CFLA 5MN6A 2JW5A 2X0IA 4Y9TA 4A03A 4BMXA 3ELDA 4HNVA 1Q91A 1VHLA 2J5QA 1VL8A 2O4CA 1M5RA 4RAQA 3VHXB 3Q7PA 4OAQA 3H3XA 2C42A 1Q7RA 1NRIA 1H3FA 2C57A 4Q47A 3NNNA 3U6BA 1GCAA 3OZRA 2Z95A 3G3EA 2OO5C 1PCXA 2B5OA 1TKCA 1P7WA 2ORIA 4S24A 3M1LA 4HNSA 3KB6A 5T8KC 2ATEA 1KEWA 1DBIA 2PK3A 2XAAA 4CMEC 4Q7LA 3PLTA 1OLSB 1NLZA 3PX2A 4A8PA 1NUSA 4LPKA 4QOSA 3LE8A 1VKJA 1H4TA 1KZ9A 1Q14A 1UPFA 4IDOA 4PPQA 4ZO6A 3SQLA 4KKXB 3NJ4A 3CBGA 4CF4A 2NO0A 4DCJA 4YLYA 1FUKA 2IYVA 4Z54A 1POXA 2OM6A 1RVV1 1BA2A 2YNMD 4HQ6A 4OCZA 4DKJA 3IHTA 2NZVG 1J5XA 4UBNA 4C0HA 4V0ME 1HC7A 5KNBA 3PD7A 1CS0A 1RTKA 2NSJA 4M83A 4X5OA 4IIEA 1WZ2A 4QQKA 3F6PA 3K6KA 4RJKA 1VRVA 2AN3A 2YC2C 1E2IA 2MDTA 4MINA 1Y4SA 4R0VA 3RUEA 4ON9A 3RIHA 4YUXA 1C7FA 4AAYA 5DSZA 1UMDB 2VCEA 3VVBA 1B8NA 2B8NA 3MUOA 3BRWA 3GPCA 2KPOA 4PXAA 1XTVA 1LLUA 4JUBA 3V4SA 1YZNA 2P8SA 4HRVA 1NUTA 2COUA 3FE2A 1AQYA 4RHCA 2JAHA 4JAVC 3RC3A 2P0AA 4NBTA 1XXHB 3WLSA 2D1LA 1ODCA 5BUSA 3GFSA 3SHQA 3ADOA 2UU9B 5LU8A 3F6RA 4HR1B 2JK0A 2E5WA 2Z56A 2B82A 4H0NA 4JXKA 5KVQA 3T3IA 2F55A 1TA9A 2H9IA 1ND6A 2YHIA 3NOVA 3ET4A 3JQ7B 4IDEA 4MR9B 4ZV4A 4RY2A 1T9GS 5AIAA 5E6UB 3R41A 2R86A 5KWEA 2C9CA 2VATA 3ABSB 4LX8A 2JD1A 2LD4A 3PQ5A 5FADA 2CXXA 2GDJA 3DAHA 1HDGO 4EFLA 5LA6F 1E32A 3TNYA 1YS2X 1EM8B 3T54A 3T3HA 1DMSA 3I6QA 2D0DA 1JFFA 4E5SA 2EV9A 4IW3B 1K86A 5TMBA 1MV5A 4E30A 2QRVB 4TXJA 4NOLA 2HBYA 5DO9A 4N03A 2VXYA 4I6JA 2WQ7A 2NP7A 3GZ4A 1R33A 4JI6B 3P97A 3WWCA 2OAEA 5BWMA 3ACDA 2PUBA 3PFWO 2JBAB 3L40A 4UNQA 1Z17A 2BF4A 4UU1A 1EUYA 3OTGA 4C29A 3AJEA 2UYOA 3H05A 5B7NA 1NHWA 4YBZA 3A10A 4HNRA 2DGDA 2P3OA 3WDMA 1NIJA 4B6GA 1KAMA 4OA8A 4C7JA 4UQOA 3HXMA 3N2ZB 1L3CA 3CVJA 4OYHA 4C07A 4LFAB 3EQ8A 3WTBA 2VWGA 3BCHA 1I7QB 2JHFA 3K8ZA 2WJJA 1E7WA 3AR5A 4QAQA 2EKLA 4EVIA 1R1DA 1LVGA 2BM1A 1PZMA 4LY6A 4RS3A 4DZTA 2PRZA 4F96A 2PSFA 3KXDA 2W2LA 3MPOA 3KX2A 4ALIA 4PZDA 2VRNA 3IQDB 3LHSA 1SVLA 2VHEA 5EZ5A 1QLWA 3H75A 1NMEA 4UHKA 3TLGB 4ALLA 3I2WA 4N7JA 1W4ZA 3B2EA 1QTQA 5BP7A 1P4GA 1YCGA 1Q11A 3SHWA 4CIXA 4UAJA 1UPUA 4ZREA 1BXKA 5IG2A 2NLOA 3B89A 3BAFA 4IYJA 4J3FA 1H2ZA 1P1RA 4QPCA 1C3JA 5B1SA 1UT5A 2Y67A 2V4MA 1I2BA 8GPBA 1ZEMA 2DX7A 1Z6GA 3QE6A 3HE3A 4N5HX 2R8RA 1U7UA 2FOXA 3HXKA 3OEED 5CYOA 3V1TC 3WLQA 2JG3A 3IOBA 4L0MA 4DY6A 4WXEA 4DA7A 1PR2A 4I1RA 4ZVSA 4CIBA 2PLNA 1WPXA 1TQSA 4GVPA 4LCEA 2W42A 2XBUA 4JX8A 5AW5A 1E6WA 5IZCC 4YRCA 5BN5B 4ROTA 3QOFA 1GNRA 2VZ9A 1EIZA 2IPOA 2QMUA 3ZV4A 1J2YA 1I30A 2DC1A 2GN1A 1I4LA 3Q87B 1OYVA 3T4XA 4G85A 4ZMSA 3PKJA 4AJIA 4DG8A 4E51A 2XGGA 4XVCA 3IUSA 2Y93A 2OFFA 1ULBA 2ZBVA 2O23A 5CK5A 1ISMA 2HK8A 2WSYB 1R18A 2BGTA 2RBGA 3KCQA 3LH5A 1Y7HA 1QHSA 2EEZA 4M3NA 3V32A 2XZTA 3QKTA 3CH7A 2AFIA 2REXB 4ENRA 1JDTA 4GDMA 1QO9A 4ASUA 3SEZA 5BRJA 3OOYA 3PJFA 4UZFA 1HL7A 1NYQA 3RO7A 1U5CA 4PANA 1RWWA 3IOEA 1U2EA 2EG9A 4P8RA 3WB2A 3FSJX 4UFPA 4II7A 3NP9A 4KITB 1KQPA 1U0LA 1IWOA 1A69A 4XM1A 3ZIAD 3EMDA 3ZU5A 1M2OA 4OY3A 3RADC 2ZWAA 4N41A 1R8JA 1P2SA 1D7AA 4WXHA 3ZJUA 4MP3A 3CE6A 2O2DA 3G88A 1PK7A 1ADBA 2IW3A 4AZ7A 3HCRA 3O9VA 3ILVA 4MR8B 3KHTA 4JBXA 4W7IA 4YJ2F 5SY9A 1RYBA 5CFQA 1VIDA 1PZXA 2C2KA 2YQ4A 3H2GA 4EVRA 3RG2A 2IPXA 3N8DA 1MVOA 2FWPA 1N3IA 4V1CI 3TD2A 2ZJ7A 3IB6A 3HJUA 4ZMRA 4OM7A 3D0QA 3I12A 3KJZA 1G7RA 2PMBA 3IO3A 5G1PA 2YQ5A 5CRIA 3MT9A 4HQOA 4ZVNA 4DEXA 4YCMA 2HA0A 3OU7A 1J97A 1G20A 2MI7A 3FUUA 4HG2A 4O2AB 3OHMA 1DUVG 2AR0A 1PHPA 1TVCA 2HO5A 4GKJB 4XIIA 1DUIA 1FFSA 3SI7A 5DEIA 5ALLA 3PLNA 4NYIQ 1LI7A 1Z2NX 2F2TA 4K9QA 4I1UA 4DTCA 4R41A 1F4LA 3CO0S 3QPUA 1JRLA 2F3PA 2D4HA 1QV7A 2JA2A 2WZCA 2DFNA 3LUJA 3M33A 2E6UX 4M21A 4Q4LA 1VCHA 3GU3A 4Y2GA 3WWDA 5EUQB 2WUGA 1UBJS 4Z0HO 1O97C 4YIKA 1I80A 5COAA 5LA6A 2VRCA 3BIXA 3SZLA 5EJ9A 1Y8QA 1E9DA 3IB3A 2QX7A 1JPNA 1FX1A 3CMCO 4U8GA 4XH9B 5G41A 5IDVA 5KOHA 2OUIA 3LGAA 2YZMA 4FMPA 4TSRA 1M2VA 1FDOA 1OXXK 3HJAA 721PA 1VJDA 1EE9A 4DSOA 2JIBA 1HTTA 4IY1A 3FYUA 1TZCA 3ZNPA 2VJQA 3HP1A 3RVDA 4Q3LA 1W9MA 2W6IA 3QV2A 4BZZA 4MVJI 5IVPA 1C29B 2ZVDA 2IYLD 3RJMA 1OR8A 4ESEA 4L9AA 3VR2A 1J90A 4AICA 5EMNA 2BEJA 3TWOA 4MHTA 1GZHB 1TYBE 4CUZA 2EFHB 4AZTA 3SVZA 4QGAA 3PUXA 3IIEA 5CU7A 2VA9A 5BQ3A 3P2KA 5K6RA 4KR0A 2HTFA 3O93A 5FA5A 2HTEA 4MVJF 3UKDA 3WVNA 4KGZA 1OAOA 3JWPA 3KZOA 4E3ZA 5F2KA 2RGUA 1OBCA 4F2DA 1EWYA 3IKJA 3SWWA 3ZZTA 4J49A 2YX1A 1MN6A 3REFA 4JITA 1VHJA 1CTQA 1POWA 3S8EA 1ZZEA 1G60A 5F7XA 2EIHA 3RS5A 5KTSA 2R2AA 1LI5A 5HW0A 1J7KA 1VA5A 2J5XA 1BU5A 2QL6A 4J1TA 4A0HA 3KHUA 3P5SA 3DO5A 3ASZA 5JQGF 1JQAA 2AGVA 2IX3A 1V41E 5H7XA 1JTFA 4UEKA 2ORWA 1RBMA 3OEHD 4IIJB 3KE8A 4BB9A 1B8UA 4CI0B 4DLPA 5DZSA 1JFSA 1WRBA 1KFBB 2P3SA 3HVIA 3RS8A 1SO8A 4HPXB 2FTKE 4GRIA 4MWEA 1P2GA 1O7JA 4QDTA 4HDQB 4BZQA 2XCQA 5B5SA 1R0KA 2EFGA 4FYXA 4D7AA 4L8GA 1P44A 4I9UA 2OOKA 2X5OA 1R64A 1JA9A 3QNIA 1UKYA 2W48A 4NH0A 3U48A 3W9SA 3QBEA 4IGAA 3ZD9A 2A1UB 4QDJA 4B34A 1VIYA 3GGCA 4UM9B 5DT2A 1T6ZA 2ZRAA 2AK2A 1M1NA 1YS9A 4H7EA 3T5GA 3IJ5A 3M83A 4FX2A 2JLQA 4EJ6A 4UVHA 3R0JA 5FWAA 3NTVA 4QJ5A 1LRLA 2PIAA 4WCFB 1Z5ZA 4KPFC 4EHDA 1TEVA 1RHJA 3BTUA 1FB5A 4KB5A 821PA 1M0SA 1G38A 3UKJA 3FYTA 4FGUA 2RKWA 2QRUA 3HDYA 1E92A 2PANA 2Q9AA 3TRIA 4F4DA 3D59A 1P9NA 1XTPA 3BQMB 3UB2A 4IF6A 4JLUA 1F14A 4TQUS 3WYCA 4ESHA 3AM1A 1B43A 2Y71A 3L7JA 1ESZA 2V6JA 1M34E 3GFFA 3LNTA 2TMKA 1A2KC 1F0PA 2W9XA 4RIGA 1PSZA 1ILWA 5IABA 2C2HA 2G36A 2GETA 4DC9A 4MWDA 1T3LA 2IYNA 2NYAA 4QBKA 2B34A 3DJFA 4MCHA 3P5BA 4DZZA 1P7PA 1E2BA 2EQBA 4II3A 2A5DA 3CV5A 3IPLA 1QH1B 2W2LD 4J94A 4DUZB 1NPTO 1XFDA 2OCIA 4AJ2A 1DIAA 1K4YA 1BW9A 1X1QA 4G5XA 4KPGA 5EJ5A 1H2XA 1MORA 4MYCA 2RH8A 1E7SA 1ZYLA 1V2GA 3IDZA 4EHNA 3IV6A 3TQFA 1DKYA 3DGFC 3KYBA 1EUDB 1JLMA 1KY4A 2FRXA 2QT9A 2M6RA 2C7GA 2NPIA 5DX0A 1UOOA 5MDHA 1ABEA 1OZGA 1XSEA 3H1PA 3LMFA 3G02A 3NONA 3ZE0B 4Q3KA 4YAEA 3KC2A 1GFSA 1SKUA 3OA0A 4G36A 3LO8A 1RAAA 3E3LA 4GX2A 2RGNA 2JFHA 1U2TA 2CFRA 1MT3A 5EQFA 5JJKA 4X3CA 3W9UA 1WTCA 3GLVA 1KYTA 4CLDA 4HGZA 4X84A 1XCLA 2YV1A 3VZPA 4MPJA 2ORVA 4XPIA 4D8VA 3DVQX 1NQVA 3CF4G 1D2AA 5IVKA 4NX2A 1VPTA 2O05A 2PQ6A 3OC0A 2W2VA 2H8GA 5FLXA 1R6TA 5C31A 1L5MA 1ULAA 1DOAA 4Q4AA 1EIWA 4XD7A 4F4HA 3WP0A 1Y4UA 2YMMA 5CTJA 1KI8A 5EXEA 2UUPA 1MENA 3OQMA 3LLUA 5CT6A 1P6UA 2ZRNA 1OU0A 4LJ7A 1OX4B 1R4MB 2FETA 3C4VA 4YFYA 4N5MA 1PX0A 1PGPA 1MHTA 1GN8A 4OYLA 4YJKA 2FP3A 1P1HA 3NRJA 1H0SA 2I4MA 3U1BA 3VBEA 3JQ8B 2DECA 3VNBA 3OE4A 2HIGA 4YPVA 1NYLA 1XDWA 2XMPA 5HYVA 4WXMA 1CUFA 3G8YA 2X2EA 1RBZA 3OLQA 4JVOA 4PR0A 5E8RA 1M1XB 2FZWA 2UUCB 3E4CA 1V8DA 3ICPA 3WI7A 2ZRDA 5FPKA 4MRVA 1SBYA 2AR7A 4P7GA 1L8QA 1SOUA 2XYGA 2VL7A 3EBPA 2FG7C 1KEVA 3KVOA 4Q0MA 2DSTA 2H4WA 2H2AA 3BSYA 4IGKA 2JBHA 4XGRA 1QP8A 1L5KA 2QNBA 3WGGA 5LSAA 3ZJTA 3ANNA 2QEQA 5IULC 1JAIA 2QYOA 1T2VA 2IHJA 2OO5A 1N2CA 4HVAA 5IH3A 4MYHA 1C80A 1O4WA 1TF2A 2C9DA 4LXQA 5T8KA 2M6KA 4CMEA 4F9GA 1IM2A 1QMGA 2BR5A 3WLRA 1SELA 4I0WB 4UHFA 2ISQA 1NU6A 4U00A 4PRLA 3S27A 4EPWA 3ESAA 2QORA 3K1ZA 1MGOA 2Q3DA 3LQFA 3R7WA 1ZMOA 2KI5A 2YJTD 3W78A 3ADDA 2VDVE 3HJRA 3SVTA 4FDVA 2X9NA 4TMWA 1UKCA 4LOAA 2H7YA 3SFVA 1BCRA 3O8BA 2HNAA 2ZSHA 4R4JA 5KVSA 3PRYA 3Q88A 1TLFA 5EWLB 3JR7A 1F5SA 3AF5A 3UH1A 1U7PA 2GAJA 4ZEXA 1YDEA 1RKUA 1Z2CA 4ZT5A 16PKA 2WHEA 4PNEA 4LNUA 3PPXA 4FJ0A 2GSDA 1WETA 2VRCD 4Z3OA 4RLSA 4QWMA 1LLCA 3FBWA 4AQYB 3ME5A 1N2BA 1WBBA 1J0EA 2I29A 3OOHA 4HY3A 5JJLA 4EZXA 1A9XB 5IJ0A 4JJIA 2BJWA 1H05A 2VR1A 1NXVA 1JDPA 4X6UA 4IX1A 2VPWA 5TDHA 3UHJA 5MN5A 2ZWVA 4B45A 3E9ZA 3FJYA 3OLVA 4M0DA 1DOZA 4X3OA 2ZATA 1P0MA 2P2SA 2P67A 4W8OA 4ZGWA 1NBIA 4HQLA 1K27A 5CP8A 1S8FA 1YZYA 3D4OA 3AU8A 4DLXA 5E7MA 4L8LA 2CLOB 2XA2A 3L7YA 3QLJA 1NASA 2MSKA 4J0GA 4U3JA 4W99A 5EPOA 3UPUA 1KKMA 3MWEA 3KCNA 1SUSA 3W90A 5FWYB 5B53A 4HXFB 4YJHA 3BM5A 2I3GA 2PBRA 2ZSEA 3LC1O 1OASA 4EPVA 2NP6A 4KIKA 1FMLA 3JATA 1PNVA 4P31A 4XQ9A 4FD2A 1IBRA 2OHVA 4ZVPA 2XRZA 5EWMA 3B1WA 4GBED 5KYGA 2AKAB 3OM0A 4L8WB 2RIPA 1FW6A 2GM4A 4AX8A 3OP4A 4C0QC 4F2HA 5FBVB 1H85A 1IXZA 3PRJA 5LD2B 1DV1A 2GXQA 2Y4NA 3AX6A 5K0SA 2VEOA 2JFOA 3LT5A 4M7PA 1E4YA 1PS0A 2J3MA 3V2HA 5AM3A 4P53A 3G7NA 3UIEA 3NBQA 4HDAA 1U0FA 1GN9A 5U4QA 1E8DA 4EZRA 1YNOA 2CXSA 3BVTA 4C6TB 1LFAA 4DR1B 3UT5B 3O21A 5DCYA 4JI0B 2NZ2A 3CCFA 2AHRA 2QJWA 4YJFA 1FFYA 2X9LA 2WKRA 2GNAA 3W6PA 1UM9B 4D6YA 4PYRA 2GBPA 2W2OA 1OAKA 3QVOA 2FPOA 4PZEA 5JASA 4K88A 1QTRA 4G0ZA 3GGPA 4G5YA 2VSNA 4I4NA 3IKLA 4PFQA 4B46A 4FM9A 1M1ZA 3M5DA 1SD1A 2IP1A 3TIVA 3QWBA 1JJBA 4RHEA 4IQGA 1T9KA 1W59A 4CMKA 3ZTYA 3DWIA 2I9KA 1WDKA 4FOTA 4JEMA 4JFAA 3RFFA 3WKDA 4XWOA 4I4TF 1CJCA 4BP3A 3NIFB 2QRKA 1TU0A 1DCFA 4G25A 4KRXA 4Q48A 2QM0A 2PE5A 5KDOA 4WY5A 5FI0B 4D56A 1W581 3E58A 3ZLTA 5PNTA 4DNOA 1Y3DE 3KXPA 1E0KA 3CLVA 4Z9AA 3HDJA 1L5RA 3N07A 2OKCA 3TEFA 1AK2A 3X1YA 4EGJA 1VZ2A 3GGGA 4BVBA 1GRQA 1YHZA 3IJEB 4S1PA 2YKTA 1N1DA 4WXPA 4Y9RA 5DP1A 4D8WA 3BXXA 3KQTA 2QN2A 4KQFA 4W5RA 3HR8A 4XEHA 2GN2A 5AVKA 4RTLA 5IZCA 1PL8A 1QUEA 3BRQA 1ADJA 1ZD4A 3KLPX 1RPJA 1NQAO 2H85A 5JVDF 1B0AA 3WQQA 4H35A 1KE1A 3QKRB 2IYYA 2DBZA 4B3DA 3PEYA 1NY6A 1JW9B 3TD9A 2VJAA 4ZCQA 4CKBA 2PHZA 4GI1A 1YOBA 1IJFA 1S4QA 1Q2XA 1XYGA 2A67A 2QD2A 2QV7A 3ICQB 4GBMA 4DJ5X 4X97A 1P75A 4EDFA 2CLKB 1YWGO 3QBJA 3FXAA 5M3BA 5FI1B 2V5VA 5JXGA 1YL6A 2WWTA 2EYQA 1J9EA 5HR5A 3M34A 3RTAA 4MI3A 2OHXA 4PG7A 2HBQA 2Q5QA 4Q9LA 4D96A 3EFBA 4RFSA 4YR7A 2ZI7A 4ARCA 3W7AA 4KHZA 1W5SA 3IP5A 4ECAA 4WNAA 1YJ8A 4MWGA 5BOSB 2IU3A 2Q8PA 4DVGA 4E2XA 4ZYXA 3BL6A 5EL0A 4C2BA 4EHHA 2GXUA 2Z5FA 3H5WA 5AM5A 5ESWA 3GJQA 3LA8A 2PT9A 5GM2A 4FDUA 2DTDA 5KEIA 4XZ3A 2B2NA 3D6VA 2LTAA 3U4HA 5K5EA 2MR5A 4F8EA 3EBLA 1P4HA 2NVWA 4LI0A 2JAPA 2WSIA 1N8SA 3H83A 3KKKA 2B1IA 4BE7B 1G66A 3F71A 1IMJA 1A76A 1DCKA 3FLBA 1EVJA 2QU7A 5EQDA 2HRBA 5LIRA 3HXQA 1ZD3A 4AMBA 1QOZA 1ZCZA 1BEEA 4FHEA 5KBYA 1T34A 3G9QA 4B8YA 1QVWA 4RQAA 1GGFA 1H65A 3VC2A 4G37A 1RXEA 2IZZA 3SBXA 2E82A 2I0FA 1OREA 2Q27A 2WIKA 1Z6ZA 3GUCA 5NLLA 4U2KA 2ZJ6A 1OI2A 3EXEB 4W5WA 3T9FA 3L43A 1BXZA 3DV0B 1NV9A 1RWBA 3ED1A 4TKVA 1Y1QA 1G1MA 3L7DA 3U4IA 1XCJA 3WJAA 1OX5A 2Q3MA 4LJ9A 1KC1A 2OCBA 5KYWA 4OL9A 4Z7NB 1TUIA 5KSWB 2IOFK 2V74B 3I9JA 3LX5A 4LIPD 5CBPB 3KDPA 3ETNA 3P0EA 3VA7A 1BXRA 1YA8A 2CVFA 3DMGA 4LISA 3HNRA 4P4LA 1K68A 3L8CA 3KP1A 3BGWA 3GT0A 4MPPA 2W70A 2UZ1B 4MRMB 4UBKA 1U0JA 1U9CA 3I1FA 3ETDA 3V00A 2PUCA 3DKIA 1RYFA 4G63A 2YWCA 2CNBA 3R5TA 1NWHA 2C84A 3N8IA 2OFXA 5D7BA 1OTHA 4EFMA 4N3CA 2RGBA 1PZNA 4LQCA 4O29A 3PCTA 4OV6B 4PSAA 1JKJA 3P4XA 3QEKA 2R7MA 3SGLA 3SR0A 1GYPA 1HE1C 3MAGA 2QIPA 1P8JA 1Z22A 2FU5C 3A28A 4H4CA 3IO5A 4ZWNA 5JWHA 1XZBA 4KWCA 4CHTA 5DP2A 5J47A 2NXWA 3X1MA 2BFDA 2XQKA 3E8MA 4IDPA 5BWBA 3HXTA 1YGPA 5I8ZA 3T7DA 3U49A 5AKYA 3TVYA 3EVCA 7AT1A 1O9GA 1U9IC 1E0JA 3TBHA 3P9PA 3UJ8A 4B3BA 1Z0SA 3CKMA 2PSEA 5BVHA 1LXCA 3HO1A 3ZE8A 2JLZA 5FA8A 4F06A 3OZDA 5TEVA 4UTPA 1QX4A 1M8PA 1RSZA 3D6FA 2Y66A 4JJZA 2YLLA 3RJZA 3BD9A 1VM6A 2VK4A 3CONA 3EARA 4A91A 3BQ9A 3OWHA 4OXNA 4BEJA 1SFRA 3QUQA 4EZNA 3MLAA 2PX3A 4HJXA 4G4JA 4I5FA 5JPIA 3RKRA 3UUFA 2AOUB 2DWUA 2PZKA 1YJAA 3M6LA 4GX1A 3KUKA 3RC1A 1Y89A 1PJ8A 2SBTA 1E5DA 3G8CA 4N47A 4JP8A 4HF7A 4PPGA 1ORWA 2AV6A 1RQLA 5WRFA 4MOWA 1G17A 4W7HA 4C0WA 3HGMA 3OM9A 4HSEA 5K0LA 5TLSA 2CFSA 3FLEA 3HY4A 3G6KA 1I6KA 2I55A 1EVZA 1GL9B 2YXNA 1DAGA 3FYDA 1JPUA 2V59A 3AHEA 5F7ZA 5CB0A 1J4AA 1I4EB 3EG5A 3CINA 1ZHHA 3IDSA 4UHCA 2BEVA 2XNSA 1MH9A 5IC5A 1XNRB 1M2FA 3GMTA 1Y8RB 2CXHA 2IYZA 2BN4A 1A77A 2HA5A 3D7SA 1Q3TA 2RAUA 3Q8XB 5I7HA 2VUSA 2KJQA 3NM4A 3BJIC 3I6BA 1LLDA 2YL5A 1E1CA 1VPVA 2AC7A 3BA6A 3RSGA 4ZV7A 1Z4IA 3PXAA 4M60A 2QL9A 5IC6A 3DCIA 1GKIA 4LOLA 2FF5A 4LHYA 3ZE1B 3C87A 4B7UA 4ZCTA 2JKZA 3F96A 5L3SB 4RD0A 3VNVA 1TD1A 2J33A 1UFQA 4YCBA 1NQWA 4MQLA 4CEHA 1Z3IX 1GSIA 2NNWB 3WLEA 3H7IA 4X00A 1IJBA 3DVLA 3BMOB 3EGWA 5BR8B 3SHFA 2QLBA 4P4SB 4YP9A 4BVEA 1XTJA 3DTYA 4CG2A 3H2YA 2JFQA 3CPJB 1X1RA 4ZKEA 4X1KB 4M1EA 4LY9A 3FZGA 1NVAA 2QTRA 1M6VA 4ND2A 4KUEA 2JAWA 1W73A 4JA0A 3FNEA 4PIMA 2GBFA 2ZITA 4C30A 4B09A 3VO2A 1TJYA 3HKEA 4NENB