1O7DB

The structure of the bovine lysosomal a-mannosidase suggests a novel mechanism for low ph activation
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
75
structure length
75
Chain Sequence
IRVNVLYSTPACYLWELNKANLSWSVKKDDFFPYADGPYMFWTGYFSSRPALKRYERLSYNFLQVCNQLEALAGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysosomal alpha-mannosidase
publication title The Structure of Bovine Lysosomal Alpha-Mannosidase Suggests a Novel Mechanism for Low-Ph Activation
pubmed doi rcsb
molecule tags Hydrolase
total genus 15
structure length 75
sequence length 75
ec nomenclature ec 3.2.1.24: Alpha-mannosidase.
pdb deposition date 2002-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.50 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Glycoside hydrolase family 38, central domain 1o7dB00
1QX1A 2F7PA 2WYIA 3BUIA 2WYHA 2F18A 2F7RA 3DX0A 3DX4A 2FYVA 3EJPA 3DDFA 3BVUA 3CV5A 3BVXA 3DX1A 5KBPA 2ALWA 3DX3A 1TQVA 3EJSA 1O7DB 3BVWA 3LVTA 3BLBA 1TQSA 3D52A 1QWNA 3BVTA 2OW6A 3EJRA 3BUQA 3DDGA 3BUBA 3EJTA 1TQUA 1HXKA 3BUDA 1TQTA 1HWWA 3D4ZA 3D4YA 1O7DC 2OW7A 2F1AA 2F7OA 1R33A 2F7QA 1PS3A 1TQWA 3CZSA 3DX2A 3BUPA 1R34A 3D50A 3D51A 3BVVA 3EJUA 1QWUA 1HTYA 3EJQA 2F1BA 3CZNA
chains in the Genus database with same CATH superfamily
3HAJA 4AZBA 2YIVX 4NPHA 4H6HA 4F01A 1DKXA 4BNEA 3ERCC 4R5KA 3KAWA 2V0OA 1HXKA 1TQTA 2GAFD 4AZ5A 1R34A 3L3OM 1I4LA 2Z8YA 3I01A 1QX1A 4JWCA 4FZOA 3BVXA 1TQVA 4I1QA 3HAHA 2X3XA 3BLBA 1TQSA 4EZRA 4JWIA 1E2UA 3I2WA 1O7DC 2QKWA 3B52X 3UITA 1SUFA 4AZIA 1I4DA 2F18A 2NCZA 3O3MB 2EWFA 3ER8C 3EJSA 2QXLA 5FIGA 2X5CA 1SU7A 1U00A 2X3WA 2D1LA 1X04A 3ABHA 3CZNA 4AZGA 4AZCA 3BUIA 3O3NB 3DX4A 4JNFA 3LVTA 2ELBA 3RPMA 4EZWA 2OW7A 4JLCA 1MJGA 3EJUA 4JN4A 2OBMA 3A98A 1SU8A 2F7PA 2KHOA 3G9GA 2YI9A 4IM0A 3VKHA 3PLTA 3ER9B 1TQUA 3Q84A 3QWEA 3D2EA 4HR1B 3DPOA 4AVMA 2F1BA 2D4CA 4NQIA 4EZXA 3DDFA 2YKTA 4IWPA 3CV5A 3DX1A 3DX3A 1ZYLA 3C7NA 3T46A 4R5GA 3BUQA 2RAJA 3GI7A 2YL6A 2F7QA 3B51X 4EZOA 2LM0A 3KAVA 2WINM 2Z0VA 3M3WA 3DX0A 4NSWA 4AZHA 2YL5A 2ND1A 3O3OB 1O7DB 4D8JA 3VEBA 3T48A 3T4AG 4AZCB 4KIKA 1Y2OA 4EZZA 1HTYA 3CKDA 2FYVA 2C08A 4FZPA 3BVUA 4EZNA 1R5EA 3QE6A 4HYBA 4AZ7A 4IM2A 2OBLA 2OW6A 3DYTA 3DDGA 4M0MA 1URUA 4H6IA 1OA0A 1I49A 4HY9A 3CZSA 4IWOA 2ND0A 1QWUA 4ATMA 1LQ7A 4FM3A 4EZYA 4JNEA 4IW0A 2ALWA 2QFFA 4G6QA 4EZVA 1DKZA 3EJRA 2O0I1 3RV0A 1R33A 2OO2A 3D51A 1OA1A 4EZUA 2WYIA 3OHXM 4IM3A 3OWGA 3ZEDA 2OZNB 3VEAA 4R5LA 4JWDA 2N3KA 1GN9A 3EJQA 4WPEA 3DPQA 2JNSA 2F7RA 2YL8A 2Z0NA 2GA9D 2GF4A 3T49A 2YLLA 1ZWWA 3BUDA 2X3VA 3T47A 2ZXQA 3D4ZA 4DYLA 2Z0OA 2F7OA 4UDYX 1X03A 3LMFA 3BVVA 2RAKA 3ACOA 1GNLA 4EZTA 3L3PA 3QNIA 5KBPA 4R5JA 2EX3B 4H8SA 2FICA 4R5IA 2RT6A 2YI8A 2F1AA 3DPPA 4E81A 3D50A 1UPXA 5TKYA 5C5BA 4HR1A 3F7WA 2YIAA 1I4TA 3BVTA 1GNTA 2YL9A 1DKYA 2Q13A 3CAZA 3D2FA 4UDXX 4JWEA 4DCNC 2PMRA 2RAIA 2EFLA 1PS3A 1YWMA 2PY6A 3OK8A 5E84A 4E3CA 2WYHA 3EJPA 4AZ6A 3QNJA 3BVWA 1E1DA 4AKVA 3D4YA 1WDZA 2YLAA 3LLLA 3DX2A 4WPCA 2MI7A 2Q12A 1SU6A 4F00A 3RV1A 3QA8A 4PO2A 1QWNA 1W9MA 3BUBA 1HWWA 3HAIA 1JQKA 4B9QA 3FD9A 1TQWA 2LXYA 3CVRA 3BUPA 1E9VA 2EFKA 3SOGA 3Q0KA 4KIKB 5FLEX 3I39X 3B53X 4EZPA 4EZSA 3SYVA 2JNKA 4EZQA 3D52A 5C5BB 3EJTA 4FZSA 1OAOA 3KDRA 4IWQA 4JL9A 3I04A 2YIBA
chains in the Genus database with same CATH topology
1QX1A 2F7PA 2WYIA 3BUIA 2WYHA 2F18A 2F7RA 3DX0A 3DX4A 2FYVA 3EJPA 3DDFA 3BVUA 3CV5A 3BVXA 3DX1A 5KBPA 2ALWA 3DX3A 1TQVA 3EJSA 1O7DB 3BVWA 3LVTA 3BLBA 1TQSA 3D52A 1QWNA 3BVTA 2OW6A 3EJRA 3BUQA 3DDGA 3BUBA 3EJTA 1TQUA 1HXKA 3BUDA 1TQTA 1HWWA 3D4ZA 3D4YA 1O7DC 2OW7A 2F1AA 2F7OA 1R33A 2F7QA 1PS3A 1TQWA 3CZSA 3DX2A 3BUPA 1R34A 3D50A 3D51A 3BVVA 3EJUA 1QWUA 1HTYA 3EJQA 2F1BA 3CZNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QX1 A;  2F7P A;  2WYI A;  3BUI A;  2WYH A;  2F18 A;  2F7R A;  3DX0 A;  3DX4 A;  2FYV A;  3EJP A;  3DDF A;  3BVU A;  3CV5 A;  3BVX A;  3DX1 A;  5KBP A;  2ALW A;  3DX3 A;  1TQV A;  3EJS A;  1O7D B;  3BVW A;  3LVT A;  3BLB A;  1TQS A;  3D52 A;  1QWN A;  3BVT A;  2OW6 A;  3EJR A;  3BUQ A;  3DDG A;  3BUB A;  3EJT A;  1TQU A;  1HXK A;  3BUD A;  1TQT A;  1HWW A;  3D4Z A;  3D4Y A;  1O7D C;  2OW7 A;  2F1A A;  2F7O A;  1R33 A;  2F7Q A;  1PS3 A;  1TQW A;  3CZS A;  3DX2 A;  3BUP A;  1R34 A;  3D50 A;  3D51 A;  3BVV A;  3EJU A;  1QWU A;  1HTY A;  3EJQ A;  2F1B A;  3CZN A; 
#chains in the Genus database with same CATH topology
 3HAJ A;  4AZB A;  2YIV X;  4NPH A;  4H6H A;  4F01 A;  1DKX A;  4BNE A;  3ERC C;  4R5K A;  3KAW A;  2V0O A;  1HXK A;  1TQT A;  2GAF D;  4AZ5 A;  1R34 A;  3L3O M;  1I4L A;  2Z8Y A;  3I01 A;  1QX1 A;  4JWC A;  4FZO A;  3BVX A;  1TQV A;  4I1Q A;  3HAH A;  2X3X A;  3BLB A;  1TQS A;  4EZR A;  4JWI A;  1E2U A;  3I2W A;  1O7D C;  2QKW A;  3B52 X;  3UIT A;  1SUF A;  4AZI A;  1I4D A;  2F18 A;  2NCZ A;  3O3M B;  2EWF A;  3ER8 C;  3EJS A;  2QXL A;  5FIG A;  2X5C A;  1SU7 A;  1U00 A;  2X3W A;  2D1L A;  1X04 A;  3ABH A;  3CZN A;  4AZG A;  4AZC A;  3BUI A;  3O3N B;  3DX4 A;  4JNF A;  3LVT A;  2ELB A;  3RPM A;  4EZW A;  2OW7 A;  4JLC A;  1MJG A;  3EJU A;  4JN4 A;  2OBM A;  3A98 A;  1SU8 A;  2F7P A;  2KHO A;  3G9G A;  2YI9 A;  4IM0 A;  3VKH A;  3PLT A;  3ER9 B;  1TQU A;  3Q84 A;  3QWE A;  3D2E A;  4HR1 B;  3DPO A;  4AVM A;  2F1B A;  2D4C A;  4NQI A;  4EZX A;  3DDF A;  2YKT A;  4IWP A;  3CV5 A;  3DX1 A;  3DX3 A;  1ZYL A;  3C7N A;  3T46 A;  4R5G A;  3BUQ A;  2RAJ A;  3GI7 A;  2YL6 A;  2F7Q A;  3B51 X;  4EZO A;  2LM0 A;  3KAV A;  2WIN M;  2Z0V A;  3M3W A;  3DX0 A;  4NSW A;  4AZH A;  2YL5 A;  2ND1 A;  3O3O B;  1O7D B;  4D8J A;  3VEB A;  3T48 A;  3T4A G;  4AZC B;  4KIK A;  1Y2O A;  4EZZ A;  1HTY A;  3CKD A;  2FYV A;  2C08 A;  4FZP A;  3BVU A;  4EZN A;  1R5E A;  3QE6 A;  4HYB A;  4AZ7 A;  4IM2 A;  2OBL A;  2OW6 A;  3DYT A;  3DDG A;  4M0M A;  1URU A;  4H6I A;  1OA0 A;  1I49 A;  4HY9 A;  3CZS A;  4IWO A;  2ND0 A;  1QWU A;  4ATM A;  1LQ7 A;  4FM3 A;  4EZY A;  4JNE A;  4IW0 A;  2ALW A;  2QFF A;  4G6Q A;  4EZV A;  1DKZ A;  3EJR A;  2O0I 1;  3RV0 A;  1R33 A;  2OO2 A;  3D51 A;  1OA1 A;  4EZU A;  2WYI A;  3OHX M;  4IM3 A;  3OWG A;  3ZED A;  2OZN B;  3VEA A;  4R5L A;  4JWD A;  2N3K A;  1GN9 A;  3EJQ A;  4WPE A;  3DPQ A;  2JNS A;  2F7R A;  2YL8 A;  2Z0N A;  2GA9 D;  2GF4 A;  3T49 A;  2YLL A;  1ZWW A;  3BUD A;  2X3V A;  3T47 A;  2ZXQ A;  3D4Z A;  4DYL A;  2Z0O A;  2F7O A;  4UDY X;  1X03 A;  3LMF A;  3BVV A;  2RAK A;  3ACO A;  1GNL A;  4EZT A;  3L3P A;  3QNI A;  5KBP A;  4R5J A;  2EX3 B;  4H8S A;  2FIC A;  4R5I A;  2RT6 A;  2YI8 A;  2F1A A;  3DPP A;  4E81 A;  3D50 A;  1UPX A;  5TKY A;  5C5B A;  4HR1 A;  3F7W A;  2YIA A;  1I4T A;  3BVT A;  1GNT A;  2YL9 A;  1DKY A;  2Q13 A;  3CAZ A;  3D2F A;  4UDX X;  4JWE A;  4DCN C;  2PMR A;  2RAI A;  2EFL A;  1PS3 A;  1YWM A;  2PY6 A;  3OK8 A;  5E84 A;  4E3C A;  2WYH A;  3EJP A;  4AZ6 A;  3QNJ A;  3BVW A;  1E1D A;  4AKV A;  3D4Y A;  1WDZ A;  2YLA A;  3LLL A;  3DX2 A;  4WPC A;  2MI7 A;  2Q12 A;  1SU6 A;  4F00 A;  3RV1 A;  3QA8 A;  4PO2 A;  1QWN A;  1W9M A;  3BUB A;  1HWW A;  3HAI A;  1JQK A;  4B9Q A;  3FD9 A;  1TQW A;  2LXY A;  3CVR A;  3BUP A;  1E9V A;  2EFK A;  3SOG A;  3Q0K A;  4KIK B;  5FLE X;  3I39 X;  3B53 X;  4EZP A;  4EZS A;  3SYV A;  2JNK A;  4EZQ A;  3D52 A;  5C5B B;  3EJT A;  4FZS A;  1OAO A;  3KDR A;  4IWQ A;  4JL9 A;  3I04 A;  2YIB A; 
#chains in the Genus database with same CATH homology
 1QX1 A;  2F7P A;  2WYI A;  3BUI A;  2WYH A;  2F18 A;  2F7R A;  3DX0 A;  3DX4 A;  2FYV A;  3EJP A;  3DDF A;  3BVU A;  3CV5 A;  3BVX A;  3DX1 A;  5KBP A;  2ALW A;  3DX3 A;  1TQV A;  3EJS A;  1O7D B;  3BVW A;  3LVT A;  3BLB A;  1TQS A;  3D52 A;  1QWN A;  3BVT A;  2OW6 A;  3EJR A;  3BUQ A;  3DDG A;  3BUB A;  3EJT A;  1TQU A;  1HXK A;  3BUD A;  1TQT A;  1HWW A;  3D4Z A;  3D4Y A;  1O7D C;  2OW7 A;  2F1A A;  2F7O A;  1R33 A;  2F7Q A;  1PS3 A;  1TQW A;  3CZS A;  3DX2 A;  3BUP A;  1R34 A;  3D50 A;  3D51 A;  3BVV A;  3EJU A;  1QWU A;  1HTY A;  3EJQ A;  2F1B A;  3CZN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...