1O7DB

The structure of the bovine lysosomal a-mannosidase suggests a novel mechanism for low ph activation
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
75
structure length
75
Chain Sequence
IRVNVLYSTPACYLWELNKANLSWSVKKDDFFPYADGPYMFWTGYFSSRPALKRYERLSYNFLQVCNQLEALAGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Lysosomal alpha-mannosidase
publication title The Structure of Bovine Lysosomal Alpha-Mannosidase Suggests a Novel Mechanism for Low-Ph Activation
pubmed doi rcsb
total genus 15
structure length 75
sequence length 75
ec nomenclature ec 3.2.1.24: Alpha-mannosidase.
pdb deposition date 2002-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.50 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Glycoside hydrolase family 38, central domain 1o7dB00
1PS3A 1O7DC 2F1AA 3EJTA 3LVTA 3BUIA 3D4ZA 1HXKA 3BLBA 3BUDA 3BVTA 3D51A 1HWWA 1QX1A 3DX0A 3DX1A 2OW7A 3D4YA 2F7OA 2F7RA 1QWUA 1O7DB 3DDFA 1QWNA 2FYVA 3BUBA 3BVVA 2F1BA 3DX2A 3BVXA 3BUPA 1TQTA 2ALWA 3CV5A 3D50A 3BVUA 3EJPA 3EJQA 3DDGA 1TQUA 1R34A 1R33A 3BVWA 1HTYA 1TQVA 3CZNA 2OW6A 2F7PA 2WYIA 2WYHA 2F7QA 3CZSA 3D52A 3EJUA 3DX3A 1TQWA 2F18A 5KBPA 3BUQA 3EJRA 3DX4A 1TQSA 3EJSA
chains in the Genus database with same CATH superfamily
3PLTA 4B9QA 1LQ7A 3Q0KA 4AZ7A 3I39X 2YLLA 2GF4A 3D2EA 3ERCC 2D1LA 3DYTA 4DYLA 2YL5A 1Y2OA 3HAHA 2MI7A 3D52A 2EX3B 3B53X 2LM0A 4EZNA 1I4TA 3D4ZA 2YL6A 2QKWA 3D2FA 2Z0OA 3L3OM 4JNFA 4AZHA 2F1BA 3D50A 2YI9A 1HTYA 3RV1A 1OA1A 4WPCA 4EZQA 4HR1B 1SU6A 2F1AA 2N3KA 4AZ5A 1X04A 3DDFA 4IW0A 1E1DA 4IWOA 2FYVA 3BUPA 1TQUA 4JN4A 3KDRA 2YIAA 2X5CA 3RPMA 3OK8A 2RAKA 3QNIA 2KHOA 3QA8A 2OZNB 2O0I1 3BUBA 3B52X 1E2UA 1R5EA 2NCZA 4AZBA 3EJRA 4ATMA 1I4LA 2YI8A 1YWMA 1HXKA 4AZIA 4AZCA 4JWIA 3L3PA 3BVUA 3DDGA 3OHXM 3BVWA 3A98A 2YKTA 2D4CA 1DKYA 3T48A 4PO2A 3DX4A 1PS3A 3I2WA 3M3WA 4NSWA 2YL8A 3KAWA 2YL9A 2YIBA 3D4YA 3QWEA 5C5BA 1WDZA 2QFFA 3DX2A 3HAJA 3EJQA 1R33A 4AVMA 4AZ6A 4D8JA 3T46A 4R5KA 2Q13A 3DX0A 1GNLA 3LLLA 3QE6A 1QWNA 3O3OB 5E84A 3DPPA 3BVXA 4NPHA 2Z0NA 4EZWA 3CV5A 2ALWA 3ER8C 3ER9B 4IM3A 2C08A 4BNEA 3ACOA 4EZPA 5FIGA 3EJUA 3I04A 1TQWA 3RV0A 3BUQA 4HR1A 4EZVA 3LVTA 3O3NB 1HWWA 4KIKA 4M0MA 2X3XA 4F01A 1MJGA 3CVRA 2LXYA 3G9GA 3BVVA 3CKDA 2F7PA 4G6QA 3CZSA 4H6IA 2YLAA 1JQKA 5TKYA 1URUA 3HAIA 4H8SA 4EZTA 3EJPA 3SYVA 2OBMA 4H6HA 3SOGA 3LMFA 2V0OA 4JNEA 4HYBA 4AKVA 1OAOA 3VEAA 3EJTA 3D51A 3BUDA 3ABHA 1O7DB 2OO2A 4WPEA 1U00A 1TQTA 2WINM 4E3CA 2GAFD 2PY6A 2WYIA 4EZXA 3VEBA 2ND0A 4FM3A 1O7DC 4AZCB 1X03A 2X3VA 2OW7A 4UDXX 2F7OA 4I1QA 2YIVX 1DKXA 1SU8A 4IWQA 2GA9D 2X3WA 5KBPA 1I49A 3CAZA 4NQIA 1QX1A 3F7WA 5C5BB 2QXLA 3DX1A 4EZYA 2F7RA 3FD9A 1OA0A 4IWPA 3VKHA 2RT6A 4JWEA 3ZEDA 3CZNA 2F7QA 1W9MA 2JNKA 2EFKA 1TQSA 3EJSA 4EZUA 4JWDA 2EWFA 2ND1A 4R5LA 3T47A 4E81A 1QWUA 4FZPA 2EFLA 1ZYLA 4UDYX 1R34A 1TQVA 2Z0VA 2Q12A 2F18A 1UPXA 1DKZA 4KIKB 2ELBA 3UITA 2FICA 2PMRA 1GN9A 4DCNC 4EZRA 4IM0A 3B51X 3OWGA 1SUFA 4FZOA 2OW6A 4R5IA 2RAJA 2ZXQA 3T49A 1GNTA 4JL9A 3BLBA 3DPQA 3QNJA 2Z8YA 4JLCA 4R5GA 3T4AG 2RAIA 4IM2A 3GI7A 1E9VA 1I4DA 4JWCA 4EZSA 2WYHA 4EZZA 3DPOA 3DX3A 4AZGA 1SU7A 4EZOA 1ZWWA 3BUIA 3BVTA 3I01A 5FLEX 3Q84A 3O3MB 4FZSA 3KAVA 4HY9A 2JNSA 2OBLA 4R5JA 4F00A 3C7NA
chains in the Genus database with same CATH topology
1PS3A 1O7DC 2F1AA 3EJTA 3LVTA 3BUIA 3D4ZA 1HXKA 3BLBA 3BUDA 3BVTA 3D51A 1HWWA 1QX1A 3DX0A 3DX1A 2OW7A 3D4YA 2F7OA 2F7RA 1QWUA 1O7DB 3DDFA 1QWNA 2FYVA 3BUBA 3BVVA 2F1BA 3DX2A 3BVXA 3BUPA 1TQTA 2ALWA 3CV5A 3D50A 3BVUA 3EJPA 3EJQA 3DDGA 1TQUA 1R34A 1R33A 3BVWA 1HTYA 1TQVA 3CZNA 2OW6A 2F7PA 2WYIA 2WYHA 2F7QA 3CZSA 3D52A 3EJUA 3DX3A 1TQWA 2F18A 5KBPA 3BUQA 3EJRA 3DX4A 1TQSA 3EJSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PS3 A;  1O7D C;  2F1A A;  3EJT A;  3LVT A;  3BUI A;  3D4Z A;  1HXK A;  3BLB A;  3BUD A;  3BVT A;  3D51 A;  1HWW A;  1QX1 A;  3DX0 A;  3DX1 A;  2OW7 A;  3D4Y A;  2F7O A;  2F7R A;  1QWU A;  1O7D B;  3DDF A;  1QWN A;  2FYV A;  3BUB A;  3BVV A;  2F1B A;  3DX2 A;  3BVX A;  3BUP A;  1TQT A;  2ALW A;  3CV5 A;  3D50 A;  3BVU A;  3EJP A;  3EJQ A;  3DDG A;  1TQU A;  1R34 A;  1R33 A;  3BVW A;  1HTY A;  1TQV A;  3CZN A;  2OW6 A;  2F7P A;  2WYI A;  2WYH A;  2F7Q A;  3CZS A;  3D52 A;  3EJU A;  3DX3 A;  1TQW A;  2F18 A;  5KBP A;  3BUQ A;  3EJR A;  3DX4 A;  1TQS A;  3EJS A; 
#chains in the Genus database with same CATH topology
 3PLT A;  4B9Q A;  1LQ7 A;  3Q0K A;  4AZ7 A;  3I39 X;  2YLL A;  2GF4 A;  3D2E A;  3ERC C;  2D1L A;  3DYT A;  4DYL A;  2YL5 A;  1Y2O A;  3HAH A;  2MI7 A;  3D52 A;  2EX3 B;  3B53 X;  2LM0 A;  4EZN A;  1I4T A;  3D4Z A;  2YL6 A;  2QKW A;  3D2F A;  2Z0O A;  3L3O M;  4JNF A;  4AZH A;  2F1B A;  3D50 A;  2YI9 A;  1HTY A;  3RV1 A;  1OA1 A;  4WPC A;  4EZQ A;  4HR1 B;  1SU6 A;  2F1A A;  2N3K A;  4AZ5 A;  1X04 A;  3DDF A;  4IW0 A;  1E1D A;  4IWO A;  2FYV A;  3BUP A;  1TQU A;  4JN4 A;  3KDR A;  2YIA A;  2X5C A;  3RPM A;  3OK8 A;  2RAK A;  3QNI A;  2KHO A;  3QA8 A;  2OZN B;  2O0I 1;  3BUB A;  3B52 X;  1E2U A;  1R5E A;  2NCZ A;  4AZB A;  3EJR A;  4ATM A;  1I4L A;  2YI8 A;  1YWM A;  1HXK A;  4AZI A;  4AZC A;  4JWI A;  3L3P A;  3BVU A;  3DDG A;  3OHX M;  3BVW A;  3A98 A;  2YKT A;  2D4C A;  1DKY A;  3T48 A;  4PO2 A;  3DX4 A;  1PS3 A;  3I2W A;  3M3W A;  4NSW A;  2YL8 A;  3KAW A;  2YL9 A;  2YIB A;  3D4Y A;  3QWE A;  5C5B A;  1WDZ A;  2QFF A;  3DX2 A;  3HAJ A;  3EJQ A;  1R33 A;  4AVM A;  4AZ6 A;  4D8J A;  3T46 A;  4R5K A;  2Q13 A;  3DX0 A;  1GNL A;  3LLL A;  3QE6 A;  1QWN A;  3O3O B;  5E84 A;  3DPP A;  3BVX A;  4NPH A;  2Z0N A;  4EZW A;  3CV5 A;  2ALW A;  3ER8 C;  3ER9 B;  4IM3 A;  2C08 A;  4BNE A;  3ACO A;  4EZP A;  5FIG A;  3EJU A;  3I04 A;  1TQW A;  3RV0 A;  3BUQ A;  4HR1 A;  4EZV A;  3LVT A;  3O3N B;  1HWW A;  4KIK A;  4M0M A;  2X3X A;  4F01 A;  1MJG A;  3CVR A;  2LXY A;  3G9G A;  3BVV A;  3CKD A;  2F7P A;  4G6Q A;  3CZS A;  4H6I A;  2YLA A;  1JQK A;  5TKY A;  1URU A;  3HAI A;  4H8S A;  4EZT A;  3EJP A;  3SYV A;  2OBM A;  4H6H A;  3SOG A;  3LMF A;  2V0O A;  4JNE A;  4HYB A;  4AKV A;  1OAO A;  3VEA A;  3EJT A;  3D51 A;  3BUD A;  3ABH A;  1O7D B;  2OO2 A;  4WPE A;  1U00 A;  1TQT A;  2WIN M;  4E3C A;  2GAF D;  2PY6 A;  2WYI A;  4EZX A;  3VEB A;  2ND0 A;  4FM3 A;  1O7D C;  4AZC B;  1X03 A;  2X3V A;  2OW7 A;  4UDX X;  2F7O A;  4I1Q A;  2YIV X;  1DKX A;  1SU8 A;  4IWQ A;  2GA9 D;  2X3W A;  5KBP A;  1I49 A;  3CAZ A;  4NQI A;  1QX1 A;  3F7W A;  5C5B B;  2QXL A;  3DX1 A;  4EZY A;  2F7R A;  3FD9 A;  1OA0 A;  4IWP A;  3VKH A;  2RT6 A;  4JWE A;  3ZED A;  3CZN A;  2F7Q A;  1W9M A;  2JNK A;  2EFK A;  1TQS A;  3EJS A;  4EZU A;  4JWD A;  2EWF A;  2ND1 A;  4R5L A;  3T47 A;  4E81 A;  1QWU A;  4FZP A;  2EFL A;  1ZYL A;  4UDY X;  1R34 A;  1TQV A;  2Z0V A;  2Q12 A;  2F18 A;  1UPX A;  1DKZ A;  4KIK B;  2ELB A;  3UIT A;  2FIC A;  2PMR A;  1GN9 A;  4DCN C;  4EZR A;  4IM0 A;  3B51 X;  3OWG A;  1SUF A;  4FZO A;  2OW6 A;  4R5I A;  2RAJ A;  2ZXQ A;  3T49 A;  1GNT A;  4JL9 A;  3BLB A;  3DPQ A;  3QNJ A;  2Z8Y A;  4JLC A;  4R5G A;  3T4A G;  2RAI A;  4IM2 A;  3GI7 A;  1E9V A;  1I4D A;  4JWC A;  4EZS A;  2WYH A;  4EZZ A;  3DPO A;  3DX3 A;  4AZG A;  1SU7 A;  4EZO A;  1ZWW A;  3BUI A;  3BVT A;  3I01 A;  5FLE X;  3Q84 A;  3O3M B;  4FZS A;  3KAV A;  4HY9 A;  2JNS A;  2OBL A;  4R5J A;  4F00 A;  3C7N A; 
#chains in the Genus database with same CATH homology
 1PS3 A;  1O7D C;  2F1A A;  3EJT A;  3LVT A;  3BUI A;  3D4Z A;  1HXK A;  3BLB A;  3BUD A;  3BVT A;  3D51 A;  1HWW A;  1QX1 A;  3DX0 A;  3DX1 A;  2OW7 A;  3D4Y A;  2F7O A;  2F7R A;  1QWU A;  1O7D B;  3DDF A;  1QWN A;  2FYV A;  3BUB A;  3BVV A;  2F1B A;  3DX2 A;  3BVX A;  3BUP A;  1TQT A;  2ALW A;  3CV5 A;  3D50 A;  3BVU A;  3EJP A;  3EJQ A;  3DDG A;  1TQU A;  1R34 A;  1R33 A;  3BVW A;  1HTY A;  1TQV A;  3CZN A;  2OW6 A;  2F7P A;  2WYI A;  2WYH A;  2F7Q A;  3CZS A;  3D52 A;  3EJU A;  3DX3 A;  1TQW A;  2F18 A;  5KBP A;  3BUQ A;  3EJR A;  3DX4 A;  1TQS A;  3EJS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...