1WDZA

Crystal structure of rcb domain of irsp53
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
231
structure length
231
Chain Sequence
SLSRSEEMHRLTENVYKTIMEQFNPSLRNFIAMGKNYEKALAGVTYAAKGYFDALVKMGELASESQGSKELGDVLFQMAEVHRQIQNQLEEMLKSFHNELLTQLEQKVELDSRYLSAALKKYQTEQRSKGDALDKCQAELKKLRKKSQGSKNPQKYSDKELQYIDAISNKQGELENYVSDGYKTALTEERRRFCFLVEKQCAVAKNSAAYHSKGKELLAQKLPLWQQGVDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords insulin receptor substrate p53
publication title Crystal structure of RCB domain of IRSp53
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 112
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 1wdzA00
2X3XA 2FICA 2Q13A 3Q84A 2D4CA 2EFLA 2YKTA 2X3WA 2Z0VA 3PLTA 1I4LA 3QNIA 3DYTA 3HAIA 2Z0OA 4ATMA 3I2WA 2EFKA 4NQIA 4NSWA 3CAZA 4I1QA 5C5BB 4AVMA 4DYLA 1I4DA 1WDZA 2X3VA 2C08A 3HAHA 2D1LA 3M3WA 4WPCA 2ELBA 2RAIA 3Q0KA 4AKVA 2Z0NA 1X03A 4DCNC 4WPEA 3ACOA 4BNEA 3QE6A 1Y2OA 2RAJA 4H8SA 3SYVA 4FZSA 3ABHA 1I4TA 2V0OA 3OK8A 1I49A 1ZWWA 3G9GA 3HAJA 3QWEA 5C5BA 1X04A 3SOGA 1URUA 3LLLA 2RAKA 2Q12A
chains in the Genus database with same CATH superfamily
1DKXA 2YLAA 2YKTA 3DDFA 3BVWA 1TQUA 3OHXM 3HAIA 2Z0OA 5FLEX 4IWQA 2QXLA 4B9QA 2JNSA 3QE6A 3I04A 4R5LA 3BVUA 2WYHA 3SYVA 2YI8A 2V0OA 2GA9D 3D4YA 3DDGA 4FZOA 4F01A 3PLTA 1O7DC 3GI7A 1R33A 1TQVA 4I1QA 4JWIA 3T49A 3BUIA 4JWEA 3QA8A 4JNEA 2OZNB 3EJUA 1I49A 1X04A 3D2EA 2KHOA 2FICA 2WINM 3C7NA 2Z0VA 4EZUA 2Z8YA 2OBMA 1SU6A 2F1AA 4WPEA 4HR1B 3LMFA 1GN9A 3ABHA 1HTYA 2Q12A 1MJGA 3T47A 2ND0A 2D4CA 3VKHA 2F1BA 3BUPA 3EJQA 1SU7A 3CAZA 2YLLA 1QX1A 1GNLA 3HAHA 2X3VA 2MI7A 3ACOA 4FM3A 2RAJA 2YL8A 3O3OB 3F7WA 1QWUA 3BVTA 1URUA 2YIAA 1JQKA 4R5KA 3D50A 2OW6A 4UDYX 2YIVX 1ZYLA 4EZWA 1E1DA 3B53X 2OBLA 3KDRA 4JLCA 4EZZA 3KAWA 4EZPA 1UPXA 3DPQA 3LLLA 4EZSA 3O3MB 3T48A 4ATMA 4UDXX 3D51A 2ELBA 1LQ7A 3O3NB 4R5IA 4KIKB 1SU8A 2OW7A 1QWNA 2RAKA 4HY9A 4D8JA 4HYBA 2EFKA 4M0MA 1OA0A 3LVTA 3D4ZA 2JNKA 1E9VA 3RV0A 3ER9B 4EZXA 5KBPA 1R34A 4IM3A 1TQWA 4AZCA 4FZSA 2F7QA 3EJPA 3QNJA 4JWCA 1O7DB 2YL6A 3I39X 2X3XA 1HXKA 3I01A 4IWOA 4E3CA 1DKZA 1R5EA 4NQIA 2RT6A 4EZNA 4F00A 2F7PA 5E84A 3Q0KA 3BUDA 4H8SA 3BUQA 1I4TA 2QFFA 2ALWA 4DCNC 2PY6A 4JNFA 4EZQA 3KAVA 2FYVA 4EZYA 4IM2A 4AKVA 3VEBA 1SUFA 3ER8C 4EZVA 3FD9A 1YWMA 2EWFA 3L3OM 5C5BA 1DKYA 3CZSA 2OO2A 3EJTA 1I4LA 4G6QA 3T4AG 5TKYA 3RV1A 1I4DA 2RAIA 2YIBA 1PS3A 3DPOA 3D52A 4IW0A 1Y2OA 2ND1A 4EZTA 3BLBA 3B52X 3DX4A 2X5CA 1U00A 4PO2A 3CVRA 3L3PA 2EX3B 4AZBA 3BVVA 4H6HA 1X03A 2GAFD 3BVXA 3VEAA 3B51X 3EJSA 4AZ7A 2Q13A 4JWDA 4AZ5A 3UITA 4DYLA 1OA1A 4AVMA 2D1LA 3DPPA 4FZPA 3EJRA 2F7OA 4AZGA 2NCZA 3SOGA 1HWWA 3CKDA 4R5GA 2EFLA 4JL9A 2N3KA 3BUBA 3DX2A 4NPHA 3I2WA 3ERCC 3DX3A 5C5BB 3M3WA 2Z0NA 4H6IA 3ZEDA 4R5JA 2LM0A 3Q84A 3OWGA 2X3WA 3QNIA 4EZOA 4KIKA 4NSWA 2C08A 4WPCA 2F7RA 4BNEA 2YL9A 2LXYA 3DX0A 1TQSA 3QWEA 2PMRA 4IM0A 2F18A 3OK8A 1E2UA 3CZNA 3DX1A 1W9MA 4AZHA 2O0I1 2WYIA 1TQTA 3A98A 2ZXQA 1OAOA 4AZ6A 2GF4A 1GNTA 4IWPA 1ZWWA 3G9GA 2QKWA 3T46A 4EZRA 3DYTA 4HR1A 4AZCB 5FIGA 3CV5A 4E81A 3RPMA 2YL5A 1WDZA 4AZIA 2YI9A 4JN4A 3HAJA 3D2FA
chains in the Genus database with same CATH topology
2X3XA 2FICA 2Q13A 3Q84A 2D4CA 2EFLA 2YKTA 2X3WA 2Z0VA 3PLTA 1I4LA 3QNIA 3DYTA 3HAIA 2Z0OA 4ATMA 3I2WA 2EFKA 4NQIA 4NSWA 3CAZA 4I1QA 5C5BB 4AVMA 4DYLA 1I4DA 1WDZA 2X3VA 2C08A 3HAHA 2D1LA 3M3WA 4WPCA 2ELBA 2RAIA 3Q0KA 4AKVA 2Z0NA 1X03A 4DCNC 4WPEA 3ACOA 4BNEA 3QE6A 1Y2OA 2RAJA 4H8SA 3SYVA 4FZSA 3ABHA 1I4TA 2V0OA 3OK8A 1I49A 1ZWWA 3G9GA 3HAJA 3QWEA 5C5BA 1X04A 3SOGA 1URUA 3LLLA 2RAKA 2Q12A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X3X A;  2FIC A;  2Q13 A;  3Q84 A;  2D4C A;  2EFL A;  2YKT A;  2X3W A;  2Z0V A;  3PLT A;  1I4L A;  3QNI A;  3DYT A;  3HAI A;  2Z0O A;  4ATM A;  3I2W A;  2EFK A;  4NQI A;  4NSW A;  3CAZ A;  4I1Q A;  5C5B B;  4AVM A;  4DYL A;  1I4D A;  1WDZ A;  2X3V A;  2C08 A;  3HAH A;  2D1L A;  3M3W A;  4WPC A;  2ELB A;  2RAI A;  3Q0K A;  4AKV A;  2Z0N A;  1X03 A;  4DCN C;  4WPE A;  3ACO A;  4BNE A;  3QE6 A;  1Y2O A;  2RAJ A;  4H8S A;  3SYV A;  4FZS A;  3ABH A;  1I4T A;  2V0O A;  3OK8 A;  1I49 A;  1ZWW A;  3G9G A;  3HAJ A;  3QWE A;  5C5B A;  1X04 A;  3SOG A;  1URU A;  3LLL A;  2RAK A;  2Q12 A; 
#chains in the Genus database with same CATH topology
 1DKX A;  2YLA A;  2YKT A;  3DDF A;  3BVW A;  1TQU A;  3OHX M;  3HAI A;  2Z0O A;  5FLE X;  4IWQ A;  2QXL A;  4B9Q A;  2JNS A;  3QE6 A;  3I04 A;  4R5L A;  3BVU A;  2WYH A;  3SYV A;  2YI8 A;  2V0O A;  2GA9 D;  3D4Y A;  3DDG A;  4FZO A;  4F01 A;  3PLT A;  1O7D C;  3GI7 A;  1R33 A;  1TQV A;  4I1Q A;  4JWI A;  3T49 A;  3BUI A;  4JWE A;  3QA8 A;  4JNE A;  2OZN B;  3EJU A;  1I49 A;  1X04 A;  3D2E A;  2KHO A;  2FIC A;  2WIN M;  3C7N A;  2Z0V A;  4EZU A;  2Z8Y A;  2OBM A;  1SU6 A;  2F1A A;  4WPE A;  4HR1 B;  3LMF A;  1GN9 A;  3ABH A;  1HTY A;  2Q12 A;  1MJG A;  3T47 A;  2ND0 A;  2D4C A;  3VKH A;  2F1B A;  3BUP A;  3EJQ A;  1SU7 A;  3CAZ A;  2YLL A;  1QX1 A;  1GNL A;  3HAH A;  2X3V A;  2MI7 A;  3ACO A;  4FM3 A;  2RAJ A;  2YL8 A;  3O3O B;  3F7W A;  1QWU A;  3BVT A;  1URU A;  2YIA A;  1JQK A;  4R5K A;  3D50 A;  2OW6 A;  4UDY X;  2YIV X;  1ZYL A;  4EZW A;  1E1D A;  3B53 X;  2OBL A;  3KDR A;  4JLC A;  4EZZ A;  3KAW A;  4EZP A;  1UPX A;  3DPQ A;  3LLL A;  4EZS A;  3O3M B;  3T48 A;  4ATM A;  4UDX X;  3D51 A;  2ELB A;  1LQ7 A;  3O3N B;  4R5I A;  4KIK B;  1SU8 A;  2OW7 A;  1QWN A;  2RAK A;  4HY9 A;  4D8J A;  4HYB A;  2EFK A;  4M0M A;  1OA0 A;  3LVT A;  3D4Z A;  2JNK A;  1E9V A;  3RV0 A;  3ER9 B;  4EZX A;  5KBP A;  1R34 A;  4IM3 A;  1TQW A;  4AZC A;  4FZS A;  2F7Q A;  3EJP A;  3QNJ A;  4JWC A;  1O7D B;  2YL6 A;  3I39 X;  2X3X A;  1HXK A;  3I01 A;  4IWO A;  4E3C A;  1DKZ A;  1R5E A;  4NQI A;  2RT6 A;  4EZN A;  4F00 A;  2F7P A;  5E84 A;  3Q0K A;  3BUD A;  4H8S A;  3BUQ A;  1I4T A;  2QFF A;  2ALW A;  4DCN C;  2PY6 A;  4JNF A;  4EZQ A;  3KAV A;  2FYV A;  4EZY A;  4IM2 A;  4AKV A;  3VEB A;  1SUF A;  3ER8 C;  4EZV A;  3FD9 A;  1YWM A;  2EWF A;  3L3O M;  5C5B A;  1DKY A;  3CZS A;  2OO2 A;  3EJT A;  1I4L A;  4G6Q A;  3T4A G;  5TKY A;  3RV1 A;  1I4D A;  2RAI A;  2YIB A;  1PS3 A;  3DPO A;  3D52 A;  4IW0 A;  1Y2O A;  2ND1 A;  4EZT A;  3BLB A;  3B52 X;  3DX4 A;  2X5C A;  1U00 A;  4PO2 A;  3CVR A;  3L3P A;  2EX3 B;  4AZB A;  3BVV A;  4H6H A;  1X03 A;  2GAF D;  3BVX A;  3VEA A;  3B51 X;  3EJS A;  4AZ7 A;  2Q13 A;  4JWD A;  4AZ5 A;  3UIT A;  4DYL A;  1OA1 A;  4AVM A;  2D1L A;  3DPP A;  4FZP A;  3EJR A;  2F7O A;  4AZG A;  2NCZ A;  3SOG A;  1HWW A;  3CKD A;  4R5G A;  2EFL A;  4JL9 A;  2N3K A;  3BUB A;  3DX2 A;  4NPH A;  3I2W A;  3ERC C;  3DX3 A;  5C5B B;  3M3W A;  2Z0N A;  4H6I A;  3ZED A;  4R5J A;  2LM0 A;  3Q84 A;  3OWG A;  2X3W A;  3QNI A;  4EZO A;  4KIK A;  4NSW A;  2C08 A;  4WPC A;  2F7R A;  4BNE A;  2YL9 A;  2LXY A;  3DX0 A;  1TQS A;  3QWE A;  2PMR A;  4IM0 A;  2F18 A;  3OK8 A;  1E2U A;  3CZN A;  3DX1 A;  1W9M A;  4AZH A;  2O0I 1;  2WYI A;  1TQT A;  3A98 A;  2ZXQ A;  1OAO A;  4AZ6 A;  2GF4 A;  1GNT A;  4IWP A;  1ZWW A;  3G9G A;  2QKW A;  3T46 A;  4EZR A;  3DYT A;  4HR1 A;  4AZC B;  5FIG A;  3CV5 A;  4E81 A;  3RPM A;  2YL5 A;  1WDZ A;  4AZI A;  2YI9 A;  4JN4 A;  3HAJ A;  3D2F A; 
#chains in the Genus database with same CATH homology
 2X3X A;  2FIC A;  2Q13 A;  3Q84 A;  2D4C A;  2EFL A;  2YKT A;  2X3W A;  2Z0V A;  3PLT A;  1I4L A;  3QNI A;  3DYT A;  3HAI A;  2Z0O A;  4ATM A;  3I2W A;  2EFK A;  4NQI A;  4NSW A;  3CAZ A;  4I1Q A;  5C5B B;  4AVM A;  4DYL A;  1I4D A;  1WDZ A;  2X3V A;  2C08 A;  3HAH A;  2D1L A;  3M3W A;  4WPC A;  2ELB A;  2RAI A;  3Q0K A;  4AKV A;  2Z0N A;  1X03 A;  4DCN C;  4WPE A;  3ACO A;  4BNE A;  3QE6 A;  1Y2O A;  2RAJ A;  4H8S A;  3SYV A;  4FZS A;  3ABH A;  1I4T A;  2V0O A;  3OK8 A;  1I49 A;  1ZWW A;  3G9G A;  3HAJ A;  3QWE A;  5C5B A;  1X04 A;  3SOG A;  1URU A;  3LLL A;  2RAK A;  2Q12 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...