1WDZA

Crystal structure of rcb domain of irsp53
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
231
structure length
231
Chain Sequence
SLSRSEEMHRLTENVYKTIMEQFNPSLRNFIAMGKNYEKALAGVTYAAKGYFDALVKMGELASESQGSKELGDVLFQMAEVHRQIQNQLEEMLKSFHNELLTQLEQKVELDSRYLSAALKKYQTEQRSKGDALDKCQAELKKLRKKSQGSKNPQKYSDKELQYIDAISNKQGELENYVSDGYKTALTEERRRFCFLVEKQCAVAKNSAAYHSKGKELLAQKLPLWQQGVDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords insulin receptor substrate p53
publication title Crystal structure of RCB domain of IRSp53
rcsb
source organism Homo sapiens
total genus 112
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 1wdzA00
2X3VA 4AKVA 1WDZA 3SOGA 3I2WA 2RAKA 1I4TA 4DCNC 4NSWA 3SYVA 4ATMA 3HAHA 4NQIA 2Q12A 2ELBA 1X03A 3HAJA 1I4DA 2D1LA 3ACOA 4WPCA 3LLLA 3DYTA 4DYLA 1Y2OA 2X3XA 3OK8A 2X3WA 1X04A 4BNEA 1URUA 3HAIA 2C08A 2RAIA 3CAZA 2Z0NA 2D4CA 2V0OA 3PLTA 4I1QA 3G9GA 3QNIA 2EFKA 1I4LA 4FZSA 3M3WA 2Z0OA 4WPEA 5C5BA 4H8SA 3Q0KA 4AVMA 3Q84A 1I49A 2RAJA 2Q13A 3QE6A 3ABHA 2Z0VA 1ZWWA 2FICA 3QWEA 2YKTA 5C5BB 2EFLA
chains in the Genus database with same CATH superfamily
3I2WA 2RAKA 4FZPA 3BVWA 4IW0A 2ALWA 1I4DA 4JWIA 1QX1A 1ZYLA 4AZCB 4JNFA 3QNIA 4FZSA 2GF4A 4KIKB 2Z0VA 3QWEA 1I4TA 3HAHA 4H6IA 4PO2A 2YL8A 1SU6A 2PY6A 2RAIA 3FD9A 3BUDA 2QKWA 3I04A 2O0I1 4E3CA 3CV5A 4NSWA 3SYVA 1HXKA 1W9MA 2FYVA 3EJTA 3D50A 1Y2OA 2OO2A 1URUA 3D51A 4HYBA 3I01A 3G9GA 3M3WA 1DKZA 4F00A 4R5IA 4AZBA 1R5EA 4R5KA 3B51X 3CVRA 3D4YA 3F7WA 3BUPA 1GN9A 2F18A 4IWOA 4IM0A 4EZXA 4EZOA 1SUFA 2KHOA 4AVMA 4EZSA 5E84A 1OAOA 4AZ7A 2EFLA 3CZNA 3DDFA 2N3KA 2F7OA 1U00A 3CZSA 4EZYA 3RV0A 3BVXA 4EZVA 1I49A 4UDXX 3BUBA 2X3VA 2YL9A 3D2FA 2YI8A 3EJRA 2WYIA 2YLLA 2Z0NA 3DX2A 2Z0OA 4AZHA 4NPHA 3O3NB 3BLBA 3BVTA 4AKVA 3EJSA 3L3OM 2MI7A 2ELBA 1OA0A 3QA8A 1O7DC 3OWGA 3ERCC 3OK8A 4AZ5A 4BNEA 3LVTA 3DX0A 4EZTA 3DPQA 3ABHA 1ZWWA 1E2UA 4EZNA 4JN4A 2GAFD 4NQIA 1MJGA 3HAJA 4AZGA 3BVUA 4EZRA 3DYTA 1JQKA 4R5JA 2OW7A 2LM0A 2QFFA 4KIKA 2V0OA 4E81A 3RPMA 3T48A 3ER8C 4JWCA 1O7DB 3T4AG 3RV1A 3BUQA 1X03A 1UPXA 3KAVA 4WPCA 2PMRA 1HTYA 2YIVX 4D8JA 5FLEX 2GA9D 4HR1A 3DX4A 2RT6A 2EFKA 2LXYA 5C5BA 3DX1A 2RAJA 2ND1A 4IWQA 1QWUA 3UITA 1SU8A 2F1AA 1GNLA 3D2EA 4R5LA 1HWWA 3KDRA 3I39X 1I4LA 3A98A 4EZZA 2ND0A 1E1DA 1PS3A 2YIAA 2F7QA 2YL5A 4EZWA 3LLLA 3DPOA 3D4ZA 5FIGA 1E9VA 3HAIA 1TQUA 4JWDA 4JNEA 5TKYA 4HY9A 4WPEA 1TQWA 2Q13A 4G6QA 2JNSA 2F7PA 2F1BA 1OA1A 2Z8YA 4FZOA 3EJQA 2OBMA 2YL6A 3CAZA 2WINM 4IWPA 2YLAA 4I1QA 3B53X 3VEAA 4AZIA 1SU7A 2X5CA 3LMFA 1R33A 3ZEDA 1TQVA 2Q12A 2D1LA 3BUIA 3O3OB 3T47A 4DYLA 4AZCA 4JWEA 2X3WA 1X04A 3B52X 3BVVA 3T46A 4F01A 3CKDA 4HR1B 3T49A 2FICA 5C5BB 3L3PA 4ATMA 3ER9B 2YI9A 3DDGA 4B9QA 4EZPA 2X3XA 3VKHA 2ZXQA 1R34A 3EJUA 3DPPA 1DKXA 4IM3A 1LQ7A 4JL9A 1YWMA 3D52A 2WYHA 5KBPA 1TQSA 1WDZA 1TQTA 3SOGA 2OZNB 4EZQA 4R5GA 3ACOA 3O3MB 3EJPA 3VEBA 1GNTA 2D4CA 4JLCA 4M0MA 2NCZA 4UDYX 2OW6A 4H6HA 2JNKA 4EZUA 4H8SA 3Q0KA 3Q84A 2QXLA 2YKTA 4DCNC 2YIBA 1QWNA 2EX3B 3C7NA 1DKYA 4IM2A 2OBLA 3KAWA 3GI7A 2C08A 2F7RA 3DX3A 3PLTA 4FM3A 2EWFA 3OHXM 4AZ6A 3QE6A 3QNJA
chains in the Genus database with same CATH topology
2X3VA 4AKVA 1WDZA 3SOGA 3I2WA 2RAKA 1I4TA 4DCNC 4NSWA 3SYVA 4ATMA 3HAHA 4NQIA 2Q12A 2ELBA 1X03A 3HAJA 1I4DA 2D1LA 3ACOA 4WPCA 3LLLA 3DYTA 4DYLA 1Y2OA 2X3XA 3OK8A 2X3WA 1X04A 4BNEA 1URUA 3HAIA 2C08A 2RAIA 3CAZA 2Z0NA 2D4CA 2V0OA 3PLTA 4I1QA 3G9GA 3QNIA 2EFKA 1I4LA 4FZSA 3M3WA 2Z0OA 4WPEA 5C5BA 4H8SA 3Q0KA 4AVMA 3Q84A 1I49A 2RAJA 2Q13A 3QE6A 3ABHA 2Z0VA 1ZWWA 2FICA 3QWEA 2YKTA 5C5BB 2EFLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X3V A;  4AKV A;  1WDZ A;  3SOG A;  3I2W A;  2RAK A;  1I4T A;  4DCN C;  4NSW A;  3SYV A;  4ATM A;  3HAH A;  4NQI A;  2Q12 A;  2ELB A;  1X03 A;  3HAJ A;  1I4D A;  2D1L A;  3ACO A;  4WPC A;  3LLL A;  3DYT A;  4DYL A;  1Y2O A;  2X3X A;  3OK8 A;  2X3W A;  1X04 A;  4BNE A;  1URU A;  3HAI A;  2C08 A;  2RAI A;  3CAZ A;  2Z0N A;  2D4C A;  2V0O A;  3PLT A;  4I1Q A;  3G9G A;  3QNI A;  2EFK A;  1I4L A;  4FZS A;  3M3W A;  2Z0O A;  4WPE A;  5C5B A;  4H8S A;  3Q0K A;  4AVM A;  3Q84 A;  1I49 A;  2RAJ A;  2Q13 A;  3QE6 A;  3ABH A;  2Z0V A;  1ZWW A;  2FIC A;  3QWE A;  2YKT A;  5C5B B;  2EFL A; 
#chains in the Genus database with same CATH topology
 3I2W A;  2RAK A;  4FZP A;  3BVW A;  4IW0 A;  2ALW A;  1I4D A;  4JWI A;  1QX1 A;  1ZYL A;  4AZC B;  4JNF A;  3QNI A;  4FZS A;  2GF4 A;  4KIK B;  2Z0V A;  3QWE A;  1I4T A;  3HAH A;  4H6I A;  4PO2 A;  2YL8 A;  1SU6 A;  2PY6 A;  2RAI A;  3FD9 A;  3BUD A;  2QKW A;  3I04 A;  2O0I 1;  4E3C A;  3CV5 A;  4NSW A;  3SYV A;  1HXK A;  1W9M A;  2FYV A;  3EJT A;  3D50 A;  1Y2O A;  2OO2 A;  1URU A;  3D51 A;  4HYB A;  3I01 A;  3G9G A;  3M3W A;  1DKZ A;  4F00 A;  4R5I A;  4AZB A;  1R5E A;  4R5K A;  3B51 X;  3CVR A;  3D4Y A;  3F7W A;  3BUP A;  1GN9 A;  2F18 A;  4IWO A;  4IM0 A;  4EZX A;  4EZO A;  1SUF A;  2KHO A;  4AVM A;  4EZS A;  5E84 A;  1OAO A;  4AZ7 A;  2EFL A;  3CZN A;  3DDF A;  2N3K A;  2F7O A;  1U00 A;  3CZS A;  4EZY A;  3RV0 A;  3BVX A;  4EZV A;  1I49 A;  4UDX X;  3BUB A;  2X3V A;  2YL9 A;  3D2F A;  2YI8 A;  3EJR A;  2WYI A;  2YLL A;  2Z0N A;  3DX2 A;  2Z0O A;  4AZH A;  4NPH A;  3O3N B;  3BLB A;  3BVT A;  4AKV A;  3EJS A;  3L3O M;  2MI7 A;  2ELB A;  1OA0 A;  3QA8 A;  1O7D C;  3OWG A;  3ERC C;  3OK8 A;  4AZ5 A;  4BNE A;  3LVT A;  3DX0 A;  4EZT A;  3DPQ A;  3ABH A;  1ZWW A;  1E2U A;  4EZN A;  4JN4 A;  2GAF D;  4NQI A;  1MJG A;  3HAJ A;  4AZG A;  3BVU A;  4EZR A;  3DYT A;  1JQK A;  4R5J A;  2OW7 A;  2LM0 A;  2QFF A;  4KIK A;  2V0O A;  4E81 A;  3RPM A;  3T48 A;  3ER8 C;  4JWC A;  1O7D B;  3T4A G;  3RV1 A;  3BUQ A;  1X03 A;  1UPX A;  3KAV A;  4WPC A;  2PMR A;  1HTY A;  2YIV X;  4D8J A;  5FLE X;  2GA9 D;  4HR1 A;  3DX4 A;  2RT6 A;  2EFK A;  2LXY A;  5C5B A;  3DX1 A;  2RAJ A;  2ND1 A;  4IWQ A;  1QWU A;  3UIT A;  1SU8 A;  2F1A A;  1GNL A;  3D2E A;  4R5L A;  1HWW A;  3KDR A;  3I39 X;  1I4L A;  3A98 A;  4EZZ A;  2ND0 A;  1E1D A;  1PS3 A;  2YIA A;  2F7Q A;  2YL5 A;  4EZW A;  3LLL A;  3DPO A;  3D4Z A;  5FIG A;  1E9V A;  3HAI A;  1TQU A;  4JWD A;  4JNE A;  5TKY A;  4HY9 A;  4WPE A;  1TQW A;  2Q13 A;  4G6Q A;  2JNS A;  2F7P A;  2F1B A;  1OA1 A;  2Z8Y A;  4FZO A;  3EJQ A;  2OBM A;  2YL6 A;  3CAZ A;  2WIN M;  4IWP A;  2YLA A;  4I1Q A;  3B53 X;  3VEA A;  4AZI A;  1SU7 A;  2X5C A;  3LMF A;  1R33 A;  3ZED A;  1TQV A;  2Q12 A;  2D1L A;  3BUI A;  3O3O B;  3T47 A;  4DYL A;  4AZC A;  4JWE A;  2X3W A;  1X04 A;  3B52 X;  3BVV A;  3T46 A;  4F01 A;  3CKD A;  4HR1 B;  3T49 A;  2FIC A;  5C5B B;  3L3P A;  4ATM A;  3ER9 B;  2YI9 A;  3DDG A;  4B9Q A;  4EZP A;  2X3X A;  3VKH A;  2ZXQ A;  1R34 A;  3EJU A;  3DPP A;  1DKX A;  4IM3 A;  1LQ7 A;  4JL9 A;  1YWM A;  3D52 A;  2WYH A;  5KBP A;  1TQS A;  1WDZ A;  1TQT A;  3SOG A;  2OZN B;  4EZQ A;  4R5G A;  3ACO A;  3O3M B;  3EJP A;  3VEB A;  1GNT A;  2D4C A;  4JLC A;  4M0M A;  2NCZ A;  4UDY X;  2OW6 A;  4H6H A;  2JNK A;  4EZU A;  4H8S A;  3Q0K A;  3Q84 A;  2QXL A;  2YKT A;  4DCN C;  2YIB A;  1QWN A;  2EX3 B;  3C7N A;  1DKY A;  4IM2 A;  2OBL A;  3KAW A;  3GI7 A;  2C08 A;  2F7R A;  3DX3 A;  3PLT A;  4FM3 A;  2EWF A;  3OHX M;  4AZ6 A;  3QE6 A;  3QNJ A; 
#chains in the Genus database with same CATH homology
 2X3V A;  4AKV A;  1WDZ A;  3SOG A;  3I2W A;  2RAK A;  1I4T A;  4DCN C;  4NSW A;  3SYV A;  4ATM A;  3HAH A;  4NQI A;  2Q12 A;  2ELB A;  1X03 A;  3HAJ A;  1I4D A;  2D1L A;  3ACO A;  4WPC A;  3LLL A;  3DYT A;  4DYL A;  1Y2O A;  2X3X A;  3OK8 A;  2X3W A;  1X04 A;  4BNE A;  1URU A;  3HAI A;  2C08 A;  2RAI A;  3CAZ A;  2Z0N A;  2D4C A;  2V0O A;  3PLT A;  4I1Q A;  3G9G A;  3QNI A;  2EFK A;  1I4L A;  4FZS A;  3M3W A;  2Z0O A;  4WPE A;  5C5B A;  4H8S A;  3Q0K A;  4AVM A;  3Q84 A;  1I49 A;  2RAJ A;  2Q13 A;  3QE6 A;  3ABH A;  2Z0V A;  1ZWW A;  2FIC A;  3QWE A;  2YKT A;  5C5B B;  2EFL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...