1ZYLA

Crystal structure of hypothetical protein yihe from escherichia coli
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
325
structure length
325
Chain Sequence
SAFTFQTLHPDTIMDALFEHGIRVDSGLTPLNSYENRVYQFQDEDRRRFVVKFYRPERWTADQILEEHQFALQLVNDEVPVAAPVAFNGQTLLNHQGFYFAVFPSVGGRQFEADNIDQMEAVGRYLGRMHQTGRKQLFIHRPTIGLNEYLIEPRKLFEDATLIPSGLKAAFLKATDELIAAVTAHWREDFTVLRLHGDCHAGNILWRDGPMFVDLDDARNGPAVQDLWMLLNGDKAEQRMQLETIIEAYEEFSEFDTAEIGLIEPLRAMRLVYYLAWLMRRWADPAFPKNFPWLTGEDYWLRQTATFIEQAKVLQEPPLQLTPMY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein yihE
publication title Crystal structure of a novel prokaryotic Ser/Thr kinase and its implication in the Cpx stress response pathway.
pubmed doi rcsb
source organism Escherichia coli
total genus 93
structure length 325
sequence length 325
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01636 APH Phosphotransferase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1zylA02
1.20.1270.170 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 1zylA03
3.30.200.70 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1zylA01
2CDZA 3IONA 3CE3A 3OW3A 3QTUA 3WF7A 3TN8A 4ONAA 4Y72A 3WYYA 5FTQA 4FKLA 3VQHA 2R2PA 4F70A 3O71A 4QMXA 5ICPA 4RFYA 2FSTX 2GNJA 2VGOA 1PXJA 3OG7A 4GIIA 3WE8A 4EK5A 4F1MA 3EWHA 3LMGA 4MVFA 4PL5A 2OXDA 3POOA 3SD0A 2WU6A 4YC3A 2IVSA 2QOIA 3OMVA 4GMYA 5DR2A 3FUPA 4L7FA 3W2QA 4EQCA 3ERKA 4EZ5A 4O27B 4JRNA 1WCCA 4RLKA 2CMWA 3P7BA 5IUIA 1Y91A 3VF8A 3S4QA 3PXKA 4C3FA 3FHRA 4BDDA 3Q53A 4FTMA 3BEAA 4M7IA 1FOTA 2YCRA 3NRMA 3P0MA 5L3AA 4RX8A 4DH7A 5FWKK 2UVYA 4I6QA 1J91A 3KK9A 4PMTA 5EI8A 4BDKA 3DTCA 2IVTA 3S00A 3QQKA 4KB8A 4E1ZA 2R7BA 4NT4A 5KMJA 4QP4A 3IW5A 3Q4ZA 4YC6A 5CASA 3CPBA 2KULA 4LL0A 4TYIA 1YXXA 2Y4IB 3DA6A 5AV3A 2YISA 5AEPA 5I4NA 4I41A 2VWXA 2X7GA 3EQDA 3TJDA 4E4NA 3G90X 4L7SA 4USEA 4LOOA 3HKOA 4CXAA 3KXZA 4KA3A 4O1PA 3VAPA 4CRSA 1MUOA 1OPLA 1GZOA 3UJGA 5CT7A 2O2UA 1YXVA 2XF0A 4MTAA 1Q8ZA 4D5KA 5LCJA 4FX3A 4QTEA 3W18A 5AA8A 5C8KA 4MAOA 2Y4PA 3NNWA 3EQRA 5E8YA 3DB8A 3LCOA 3NUUA 3BBWA 4BDJA 4UXQA 1ZZ2A 3Q52A 1APME 4W4YA 3C4EA 3H9OA 3Q9YA 1LPUA 1ZYLA 4EH4A 4ZSEA 1KE8A 1ZY5A 2JAVA 4FKJA 4GFOA 3R02A 5EOBA 5TT7A 5HNIX 3MW1A 4TTHB 2CPKE 2JAMA 4J53A 2J0MB 3C9WA 3R7VA 4IVBA 3LFFA 3QD3A 2O0UA 3T9IA 4KBKA 2XEYA 4K0YA 2F49A 4PMPA 4N6ZA 3M1SA 3NYOA 3UG1A 4I0RA 3HA6A 3FQEA 1Q61A 1KE6A 4IVDA 2ITPA 2WMRA 4FIJA 4OW8A 1GZ8A 4JQ8A 2EXCX 4O0VA 3MJ1A 2GFSA 2HWPA 3O0GA 3GCUA 4TPTA 4D4VA 5AM7A 5EYKA 4UB7A 2ZOQA 3WZJA 4AA5A 4EWHA 3F7ZA 4F9YA 4D2VA 4FKGA 3OW4A 5HVJA 3LFNA 3QRTA 3REPA 4E20A 5CYIA 4IDVA 2CN5A 1JBPE 3ORXA 4GRBA 4CSVA 3ACKA 1Q8TA 1XWSA 3MTLA 4A4XA 2BRBA 4FNZA 4L3JA 3R8VA 4XG8A 3V6SA 4EUUA 4KBCA 2JKMA 4FOBA 2I0VA 3WARA 5BVNA 5FM3A 5KO1A 4YZNA 2BRNA 1V0BA 1R78A 4AS0A 3VHEA 4ZTLA 3GC9A 3R83A 4ZLOA 2I0HA 4RLLA 1JKLA 4TYJA 4WSQA 3TZ8A 4CMTA 4QMOA 1H24A 1TQIA 4RWKA 2ZDUA 4PTEA 5A14A 4AXAA 2HZNA 2R3PA 3FL5A 3TACA 3ZSGA 2BZJA 5ETAA 4RZVA 4RFMA 3OCBA 3D2KA 3OXIA 1JKKA 3I79A 4AGCA 4S32A 4CFUA 3G6GA 3MY5A 4XOZA 3DKOA 4FV4A 5LWNA 3PG3A 4QQCA 4XLVA 3DLSA 4XHKB 3ZBXA 4YSMA 4EOPA 3PJCA 2XJ2A 4G3CA 3UPXA 3PLSA 4IXPA 4IZ7A 2WU7A 3GCPA 2ITQA 2XK9A 4YBJA 4ZEGA 2A2AA 3TCPA 4FYOA 1GY3A 1Q41A 4NFNA 4BDEA 1Z5MA 2R3FA 3PJ3A 3R1SA 3FMEA 4KNBA 4IBMA 5KZIA 3KRXA 3O7LB 4J7BA 3RWPA 3SC1A 3ZSIA 4B7TA 4QTAA 4F1OA 5CAQA 2CKEA 4ZTSA 5CQWA 5C26A 5IEXA 1NA7A 2PSQA 2JDSA 4UMQA 5CXHA 3QC4A 2OKRA 3F7WA 3FYJX 3R1QA 2WXVA 3V5PA 4BN1A 4UYAA 3EL8A 3T3UA 4YO6A 3QKMA 3FLNC 1JVPP 5TR6A 1KV1A 1REKA 2J0JA 1A9UA 4AE6A 1F5QA 5EDQA 4IAIA 2OWBA 2XCKA 3CTQA 3MH2A 3S2PA 4R8QA 1OKVA 3MVHA 4TT7A 4AGWA 5L4QA 4LM5A 3VF9A 3R7IA 1Q8YA 4PNIA 3C4CA 3L8SA 4WT6A 1OKZA 4JAIA 4QMVA 4IACA 4QQ5A 3OUNB 4R1VA 3L8PA 4ANLA 2OICA 3ORMA 2RKUA 4KKHA 4TNDA 2Q0BA 4QMUA 4EQUA 5EDRA 2BTRA 5CI7A 3PIZA 2X8DA 1Q4LA 4PF4A 5B0XA 3U51A 3BYSA 2YM6A 1VJYA 1GZKA 2RFEA 5IA2A 1XQZA 5DVRA 3ANRA 2JD5A 2PZIA 1U4DA 2Y9QA 5AP1A 4EL9A 5JGBA 1Y6AA 3VW6A 3RCDA 1OPKA 4RVTA 5D7AA 4G6OA 3RINA 3QFVA 4Y95A 3EIDA 2QOQA 1S9IA 3VUIA 5L2TA 3FXXA 1SMHA 5ANOA 5DI1A 2HAKA 4ZSGA 5BVWA 3TIZA 3RAHA 4PTGA 3R00A 4KRDA 3CJFA 3MB7A 3ENHA 2YCQA 5EW9A 5HCYA 2QD9A 4E93A 4W4VA 4E73A 3CC6A 3UPZA 2WEIA 3C51A 3MFRA 2VX3A 4KSQA 4XBRA 4ZJVA 2ZAZA 1QPEA 4KKGA 2Z2WA 4WG3A 5H3QA 4DLJA 3BBTB 5CF5A 1H1PA 2Y6MA 3DB6A 2SRCA 3IQ7A 2JKOA 3DQWA 3OXTA 3Q60A 5IA4A 2CCIA 4NTSA 1R0PA 3R2BA 4FKWA 3V5WA 4BCQA 4F4PA 1STCE 1MRUA 5CTPA 3R73A 4ERWA 3NUYA 1JOWB 3F3WA 3ZMMA 2PUUA 2QOCA 4RQVA 2ZVAA 3SA0A 5HKMA 3OEZA 3EFLA 4O0RA 2OF2A 1YXSA 3ORNA 3QKLA 4FI1A 3C1XA 3LCKA 4IFCA 2GNFA 5TKDA 3RPVA 3SAYA 5IDNA 1JKTA 4PL3A 5H9BA 3TKUA 2FSOX 3O8TA 1CMKE 2YIWA 1FPUA 1SNXA 2B52A 4NJ3A 5GZAA 3JYAA 3KRWA 3QQGA 2ZM4A 3QD4A 4HZSA 4O21A 3TZ9A 2FB8A 4NK9A 2R3QA 3ZLYA 4CV8A 3FJQE 3LM0A 3ZXZA 5JFXA 4BCKA 5F20A 2QHNA 2UUEA 2OJIA 2XK6A 5BUEA 5FXRA 1YOLA 4J97A 4ZOGA 3BCEA 4MF0A 4U6RA 1B6CB 4LMUA 4PMSA 1YVJA 5AJQA 2NPQA 4IAKA 5IA3A 5AA9A 3FKLA 4DH8A 3RPYA 3NCGA 3RMFA 4UZHA 4BICA 4G3DA 4BCIA 5L2SA 3KCKA 2C3KA 4GU6A 3NYXA 4ITJA 2PL0A 3W8QA 5JZJA 1DS5A 3NNVA 4YJRA 5DIAA 3DK3A 4DCEA 2PMNX 1H0VA 2ESMA 2HZ4A 4U0IA 1OIUA 2J5FA 3ZUVA 4D4YA 4V0GA 4Y5HA 2VTSA 4L6QA 4W8DA 4YJUA 5L6WL 3SXSA 2WKMA 4Z55A 3KU2A 1O6YA 5K0KA 3I6UA 5GJGA 3RK9A 1T45A 3FHIA 3EN5A 3QXPA 2WQNA 5LVNA 4QP8A 4BFMA 3QQLA 4NKSA 2PVKA 3WF8A 2AC5A 3NW5A 4AOJA 3VUTA 2BAJA 5EM5A 3PP1A 2DS1A 3HGKA 4EOJA 4FKQA 1OGUA 3TNPC 4CFWA 4YR8A 3EQCA 5FEEA 3E62A 2XM8A 3F5PA 3P23A 4LQMA 4YTCA 3FLZA 5K9IA 3QU0A 4I24A 4MYGA 4EBWA 3U6HA 1YXTA 2W96B 4DITA 2X1NA 3CS9A 3DCVA 3O17A 5I9WA 3W16A 4X7QA 2R9SA 4AX8A 1Y57A 3E7OA 3I5ZA 2Y4IC 4PPCA 4F6UA 1MRVA 3BU5A 4FKTA 3S0OA 1J1BA 5I0BA 3EQGA 3ZU7A 4QMYA 2H6DA 3PJ8A 2C5YA 2YM8A 5CF4A 5J9YA 3RKBA 1JSUA 4JG8A 3RGFA 4X6RA 3AMYA 1JNKA 4XCUA 1IR3A 2BDFA 4WBOA 4JR3A 4XP3A 4MQ1A 1K3AA 1WFCA 4LI5A 4IB0A 2HENA 3ROCA 2AYPA 5JFWA 2V5QA 2YDKA 2JITA 3K5UA 4PX6A 3UQCA 4U44A 5LMKA 4XH6A 5BVEA 2FSMX 4ZSAA 1WBOA 1H25A 2G2IA 1OI9A 4FSRA 4CZTA 1Z57A 3I4BA 4C4EA 4JXFA 2X8IA 3HMMA 4X2NA 3L8VA 3UC3A 4F9BA 2J9MA 1OUYA 1ZRZA 5ITAA 4LUDA 4OTFA 5CAPA 2W1CA 3LJ2A 3HVCA 3PRFA 5G1XA 4I5PA 2F2UA 5HICA 3PXRA 4CFMA 2JDTA 5HBJA 1RE8A 2C69A 1KE9A 2QHMA 3ZO4A 4IAYA 3PIYA 3F3ZA 3O50A 4UMRA 3DDPA 3KN5A 4GEOA 5CEMA 4XEYA 3RTPA 4TZRA 2PTKA 2QLUA 1OIRA 2VTQA 4K1BA 4I94A 3TNHA 4IEBA 4BCFA 2WOUA 2BUJA 2HXQA 2ZYBA 2X2MA 4DFZE 1FINA 3BE2A 3QYZA 4Y83A 4ENXA 5AP0A 3OY1A 5BMSA 4G9CA 2JKKA 1M2PA 2ONLC 2GSFA 4YNOA 5J87A 4U3ZA 3CCNA 4QTBA 2RFSA 3FXZA 4DG0E 4FTOA 4F09A 4K6ZA 1XKKA 4DGMA 3HRBA 2XK3A 4YTHA 3IK3A 1TQPA 4GIHA 1JAMA 3MY1A 4DG2E 4E3CA 5IH6A 4I6BA 4YPDA 2HXLA 2UZEA 4YJPA 4CTBA 2PY3A 2PMOX 3KRJA 1UU8A 3C4XA 3NW6A 3P78A 5FG8A 3VO3A 5IUHA 3F5UA 5AWMA 3SKCA 5AP6A 1VYZA 3ZONA 2BZKB 4IANA 4C38A 1WZYA 2J0IA 3QX2A 4L46A 4S30A 4ITHA 3KF7A 3QQUA 4RA4A 3RZBA 4C35A 4J98A 4R7IA 4Z7GA 4XOYA 2XYNA 5E8UA 1XH4A 4FNXA 2G1TA 3I60A 3FZRA 3BU3A 4FGBA 4KWPA 1QPJA 3BV3A 5FTOA 2BVAA 3KXGA 4FUXA 4JT3A 2IW8A 2PZ5A 3UQGA 4EWQA 3I1AA 1BKXA 3A8XA 2Z7QA 4NM0A 3FLYA 2C5NA 4J71A 1YDTE 3NUNA 5ANKA 4BCGA 3Q3BA 3HV4A 4IX5A 2ZV9A 5DGZA 2RG6A 2WQOA 4J95A 5BNJA 4FUYA 3PWYA 4LOQA 3U87A 2C47A 2GTMA 4Q9SA 3AXWA 3OWKA 4UV0A 2A4LA 4I23A 5LWMA 1U5QA 3NUPA 3GNIB 4UEUA 4ZSLA 4AUAA 1XH8A 3UIUA 3KRLA 4BB4A 2QU5A 3TUBA 2IZUA 5E92A 2VX0A 3QZGA 3TJCA 2JIVA 3PE1A 4ANBA 3RPSA 4FV7A 2FO0A 2EWAA 2HZIA 3FYKX 4GG5A 4ANOA 1B39A 2A1AB 4O0SA 5CZIA 3ZZWA 4DN5A 1YDRE 2OZAA 4BTMA 4HVSA 3M42A 3WILA 3TTIA 2W06A 3MV5A 2FA2A 5CVHA 4N6YA 2OU7A 2Y6OA 5D7VA 2BZHB 1PYEA 5M57A 4MF1A 3K3IA 1GIHA 4E4LA 3LW0A 3Q04A 3H30A 3AD6A 4D1XA 4NZWB 3FQHA 1XHAA 5JK3A 3LXPA 4O6EA 4X2JA 4F7SA 4BBEA 4Y85A 4TN6A 5DOSA 4D0XA 5M53A 5CAOA 3G9NA 5DRBA 1FGIA 3QRUA 4BDIA 3RM6A 3TV7A 1YOJA 1DI8A 5IEYA 4IB3A 3ORZA 4HYSA 4RVKA 1UNGA 3EFWA 5DLSA 3ZO3A 4C3RA 5KHXA 4HGEA 4X3FA 2PK9A 5CEPA 5HO8A 3DS6A 4FA2A 3R0TA 1UWHA 4DHFA 3FLSA 2C4GA 1FMKA 5IA1A 3TIYA 3AMBA 4G34A 5DHJA 4BZOA 5E1SA 2VTRA 4WOVA 2XIYA 5EKNA 2R3MA 2QONA 4FV6A 3FI3A 2OJGA 4YZ9A 5B7VA 5BQ0A 2QO2A 5LJJA 5E8TA 1H07A 1OM1A 1WBPA 4IHPA 4JDIA 4NKAA 3TT0A 2IN6A 3GT8A 3HLLA 3SDJA 4TYGA 3ZBFA 2WMQA 4DFLA 3U9CA 4AZVA 3GENA 2NP8A 3E8DA 3Q6UA 1OKYA 4IDTA 4KBAA 4EHVA 4FSUA 2DWBA 3EFJA 5LARA 2VWVA 2WEVA 4EK3A 4TL0A 2J2IB 4AZSA 2VWYA 4QOXA 4C4FA 2X6DA 2P3GX 5CVFA 4FKVA 4RX5A 4AN9A 1PMUA 2JDOA 4A7CA 3I0QA 2B55A 2UZVA 3CKXA 4EK6A 2CGUA 2OO8X 4XS2A 5E1EA 2VTIA 4NIFB 2YM3A 3F3UA 3BWJA 3EZVA 3F6XA 2ZV2A 1LEZA 4IC8A 1ATPE 4ALVA 3BGQA 4AE9A 5EM7A 4G9RA 3FWQA 4M8TA 3RZFA 3A4PA 1UA2A 4G2FA 4WNPA 3DKCA 5FBOA 3CTJA 2YHVA 4FG8A 5LMBA 1LUFA 4GYIA 4MXXA 4QRCA 2JEDA 1Q3DA 3FMLA 2H96A 4QQJA 5EHOA 3O7LD 5CEOA 4IM3A 4FV8A 5HLNA 5A54A 2XIKA 3D0EA 3R8PA 2QOFA 3TZMA 3VS4A 5DBXA 2WHBA 3TXOA 4KS7A 3R30A 4U3YA 5JMSA 3TI1A 4EC8A 5CY3A 4GFGA 3WZDA 3A7GA 3OUKA 2W17A 2R3NA 4BI1A 3EQIA 5FLFA 4RMZA 3A8WA 3IPHA 4P90A 4F0IA 1V0OA 4EORA 1OECA 5L8LA 2C6OA 1CSNA 4B8LA 3NGAA 4BDFA 2GPHA 4GT3A 5GZ9A 3PVBA 4RWJA 3ORKA 2B9FA 3NZ0A 3U4WA 3QTZA 4BDCA 4L01A 5IKWA 1XH6A 3FMNA 3LE6A 1R39A 4PV0A 4F7NA 1E1VA 1IEPA 4HYHA 5CU4A 3TTJA 4U8ZA 4XG2A 4OTIA 4Q5EA 4GT4A 3DKGA 3GGFA 3GVUA 4QYEA 4MCVA 4D2RA 3DXNA 4D9UA 3P4KA 4CKRA 4GUEA 4S2ZA 1R3CA 2WPAA 2XCHA 3FY2A 4R6VA 5AR3A 3WF9A 1YI6A 4L44A 2QR7A 4XG6A 5KMNA 3QKKA 3C4WA 4O2ZA 3LJ0A 5A6NA 3PSDA 2HOGA 4ZZNA 1JSVA 2ZB1A 4RIYA 1ZYDA 4DLIA 4M67A 5H8EA 4IMYA 5AR4A 1J1CA 2VWZA 2YABA 3GFWA 2J51A 2XNGA 3HMOA 5C9CA 4MHAA 3D5WA 4QQTA 5DMZA 3HP5A 4HPUE 4HGLA 2UW8A 3VUGA 4UBAA 1P5EA 3OS3A 4QYHA 3CGOA 2XJ0A 3MJ2A 3PZEA 4RPVA 5D9HA 5J95A 1H4LA 3HMNA 3R63A 3FBVA 2XIRA 4IVAA 3KFAA 1M2RA 1PW2A 3SW4A 5BVOA 4M69A 5HNGA 4E6AA 5M4IA 2F7EE 2XKFA 2V7OA 3BHVA 4G1WA 1W7HA 3HX4A 5JKGA 5C03A 3CEKA 2VTTA 1BX6A 4AGUA 3CD8A 4YHFA 1BL7A 1LP4A 3DY7A 3A7IA 4GT5A 3BI6A 4X3FB 4EK8A 2YDJA 5HORA 3QZHA 1SVEA 3HMIA 1G5SA 3UMXA 2WGJA 2VRXA 3LM5A 3QX4A 2W7XA 4MXOA 1W98A 4O6LA 1LR4A 2GTNA 3E87A 4FT0A 4FTAA 4ZTQA 4O0TA 5K3YA 4EOIA 3IOKA 3MSSA 3A7HA 1VZOA 1W8CA 3UO4A 4FIGA 4FVQA 2PVLA 4GFMA 2O3PA 3PPJA 2XIZA 2XK4A 3GP0A 5DWRA 2GFCA 1B38A 3MB6A 2A19B 5AUWA 2GMXA 4QNAA 3THBA 3IGOA 5E8XA 4FZ7A 4EBVA 5KNJA 3E5AA 4M84A 3E8NA 4BIBA 1P14A 5CENA 3OCTA 3HUCA 5E7RA 2EXMA 3BV2A 3RWQA 1J3HA 5DT4A 3NCZA 2ZDTA 4OT6A 3VJOA 4KAOA 5BYYA 4H58A 5AUZA 3D14A 1YHVA 4KIKA 4GS6A 4JBPA 3QTWA 4RA5A 4BDHA 4F9WA 3MVLA 4BIEA 4IC7A 4YJOA 2I6LA 2RG5A 3PY3A 4JIKA 3KL8A 4OTQA 4WNMA 5DT3A 2B54A 3V6RA 4CV9A 1PJKA 2C0TA 4YURA 2XBAA 4L9IA 3KF4A 4XV1A 3QZIA 4PP9A 4FKSA 2PE1A 2BRMA 2WIPA 2XKCA 3PG1A 5FRIA 2YN8A 1TKIA 4YZBA 3VBYA 4DEGA 3BHTA 3PVUA 2VAGA 3DKFA 4EYMA 3RP9A 1ZAOA 3QD2B 3GU4A 5AAEA 2ITZA 1OL7A 4MWIA 4GK2A 4MBLA 1FQ1B 3L8XA 3T9TA 3KQ7A 4O0YA 3V8WA 3JVSA 4FTIA 3ZXTA 3VJNA 4XRLA 2BIKB 3IDPA 3MFSA 3VBXA 2HZ0A 4CYJA 5ANJA 4WNOA 3NEWA 5DT0A 4ZAUA 2A0CX 4JDHA 4W4XA 3W2CA 5IH4A 4ANNA 3F5GA 4FNYA 4ZTNA 2XRWA 2CGWA 2R3IA 3E92A 4A4LA 4HZRA 3UQFA 2Z7LA 3GQLA 3DLZA 4I5HA 1P2AA 1R0EA 4XJ0A 3QUPA 5CI6A 5FDXA 5CXZA 3RAIA 3PJ1A 4HVHA 1QPCA 4MNEA 4CCBA 3R8ZA 3W10A 1BI7A 5D12A 4G3FA 4D55A 2XYUA 1KE5A 4X2KA 3WZKA 2VV9A 4RBLA 2ERZE 2BRHA 4DGNA 4OGRA 5IH5A 3QCSA 3U6IA 5GHVA 4EH6A 1GAGA 1Q24A 3IKAA 4FODA 3GCVA 5E8VA 1U54A 2O65A 2PVNA 5KKRB 3QLFA 3F61A 4KIOA 5D1JA 3IDBA 4I6FA 4BC6A 4E8AA 1YI3A 4USDA 4BYIA 2X8EA 3N51A 3E7VA 4RIYB 3IW6A 5FGKA 2QCSA 3AC2A 2YAAA 5F9EA 3BHHA 5K4IA 3D9VA 3FL4A 4IQ6A 3ELJA 4AWIA 3P86A 3CTHA 4EH3A 1KWPA 3FC2A 5JGAA 4TRLA 3JUHA 3LXKA 4YUQA 4LRMA 3TUCA 3F66A 3LCSA 1MP8A 3VS2A 2HY0A 5A4LA 3EB0A 3F88A 3LIJA 2QI8A 3CY2A 4RIXA 4B8MA 3F82A 2OIBA 5L2QA 3KEXA 5DR9A 3KCFA 5ANIA 2WMVA 2OG8A 4MH7A 2VTHA 3U8WA 5L8KA 3L9MA 4M69B 4JOAA 1PKDA 2C6IA 3DAEA 4S31A 2H34A 1KE7A 4AA0A 2GS7A 4L3LA 3CIKA 3UVQA 3PY1A 4M14A 3UOLA 4CZYB 3DBCA 4QP2A 4E4XA 4UWBA 3NUSA 4FG7A 1KV2A 1GIIA 3LJ1A 3OBJA 4JX7A 3GOPA 5A4TA 3HV5A 3GBZA 4PP7A 4AAAA 4CMOA 2F7XE 1ERKA 2VWBA 4I4EA 4L45A 3FPQA 5DPVA 4ZY4A 2OJ9A 1OL1A 3K5VA 4FV3A 2X7OA 2QOBA 3EL7A 4YBKA 4IAFA 1W83A 4LGGA 4QTCA 4BTKA 3MY0A 3V51A 5TF9A 2JDVA 3VUMA 3BIZA 3KXMA 2UW4A 2G01A 4BTJA 3GCQA 4CMUA 3ORIA 2WMWA 1SYKA 4OAVB 3DJ7A 1S9JA 3PZHA 3DJ6A 4FV1A 2UV2A 2W4OA 4EK4A 4E5AX 5ETCA 4EOLA 2IZRA 2PVRA 5D41A 4NM5A 5M4FA 5AV2A 4OTPA 5AM6A 4B4LA 4U5JA 4YHTA 4EOMA 1ZOHA 1PMEA 2QLQA 5AP3A 3EH9A 3VRZA 5HEZA 1FGKA 2BDWA 3DZOA 4JL9A 4KIKB 3UOJA 3DBDA 1UKIA 4L3PA 1FVVA 2BZIB 4RJ5A 4D28A 1M17A 4UXLA 4FSNA 5KMIA 2ITOA 4H3QA 1PYXA 2W0JA 3H3CA 2VWIA 4L42A 3R8UA 4AA4A 3TL8A 4GK3A 3IO7A 3DU8A 5HZNA 3VS3A 2O64A 2UZTA 2YACA 4IAZA 4E6CA 3OBGA 2GNIA 2W1GA 3GU5A 3MA3A 4JQ7A 2WFYA 3PPZA 3Q32A 3V8TA 3G0EA 3BGZA 4EH5A 3QYWA 1ZYSA 4FTUA 2E2BA 4YGAA 1TQMA 5EOLA 3VHKA 4TWCA 5KHWA 4YTFA 4NU1A 4D9TA 4G3GA 5EH0A 1UVRA 2WELA 3RHXA 4XG9A 4GG7A 4FIEA 4TWPA 4ASXA 2ITWA 1XBAA 4DH3A 4ZZOA 5LMAA 4EHZA 3PSCA 3FZOA 4BGQA 2OJJA 3JVRA 2X6EA 4BGHA 3QHWA 4FIFA 4H39A 4LOPA 4ID7A 5AADA 3Q4UA 5HNBA 2ITVA 2VTOA 4GL9A 5I3RA 3HYHA 3LPBA 5AUVA 4MNEB 3R8MA 1ZYCA 4RVLA 2DQ7X 5HO6A 4E6DA 1ZWSA 4EOKA 2W5AA 1BL6A 2VTAA 3DNDA 2XJ1A 4NJDA 5E8ZA 3V5LA 3QWJA 4AN2A 3L9NA 1GIJA 1YI4A 2EVAA 2YAKA 1U54B 3RI1A 4BCNA 5K5NA 4IADA 1CM8A 2I0EA 1BYGA 2EU9A 3EN9A 4K2RA 4GW8A 4MD8E 3UZTA 3KC3A 1M14A 5EHYA 3S3IA 3KRRA 3M2WA 3KMWA 4X3FC 4YO4A 2R3GA 3IOPA 4ACHA 5HOAA 3Q2MA 3F9NA 1PMVA 4AFEA 2E9NA 2VD5A 3QQHA 2IZSA 2XNBA 4GH2A 4YJTA 4BYJA 2OW3A 2BPMA 2DUVA 5L2IA 5IA5A 3UNZA 4FG9A 3HRCA 5AP4A 1WBTA 2UW9A 3FI4A 2OXYA 4RIXB 3BYMA 3D7ZA 2AC3A 5F1ZA 3UOKA 3EQHA 5H8BA 3ZZEA 4HVIA 1XO2B 2GQGA 5M55A 2C5VA 3I5NA 4C58A 3U6JA 1Y8GA 2C6MA 4GU9A 4M3QA 3ZC6A 4CFVA 1YDSE 2ZV8A 2ZV7A 3QTXA 2NRUA 2WMBA 4FC0A 4PTCA 4RFZA 4FKPA 3LAUA 3ZLWA 4JAJA 3NS9A 5A3XA 1XH5A 3AG9A 4HGSA 1V0PA 3ZUTA 5IEVA 4F9CA 4UMTA 4HYIA 1Q99A 1QL6A 4BKYA 4YMJA 2P2IA 2PZPA 3ENMA 4MK0A 4CRLA 4G16A 3VUDA 1H26A 4FKOA 1L3RE 2F57A 3OROA 2ETMA 4I92A 4DEDA 4EEVA 5CANA 5C8NA 3B8QA 5CU0A 5JH6A 5K4JA 3NLBA 2PZYA 4OTDA 3QZFA 4IB1A 1YWVA 4WD5A 3VNTA 4ACCA 1DAWA 4WG4A 4IWDA 2IVUA 3DBEA 2P0CA 4C4GA 4XNEA 2WB8A 5HIBA 3HDMA 3D15A 2ITNA 3DAJA 3BX5A 4L67A 5JT2A 3DAKA 1DM2A 2HIWA 3PE2A 5JGDA 1ZXEA 4IJ9A 4RX9A 4ITIA 3R8LA 5HE3A 2XNEA 2GNLA 3QRJA 2B1PA 4BVUA 3B2WA 1TVOA 3LZBA 2UZDA 3AMAA 3CP9A 4II5A 4YTIA 4E7WA 3PXYA 3P5KA 4U80A 4FMQA 4EH2A 3DGKA 3MS9A 1FMOE 3NSZA 5HX6A 4PL4A 1OPJA 3DZQA 4FZAB 3LFSA 1BUHA 4NH1A 3L9PA 5E90A 2VUWA 4FKIA 3ZRMA 2R3JA 3GOKA 4EH8A 3R2YA 2J0KA 2XP2A 4CKJA 3D83A 5IPJA 5C1QB 2QODA 3ORLA 2EB3A 3Q5ZA 3VS6A 2GS6A 3A7JA 4E26A 2HELA 3VC4A 4R3PA 4LGHA 4UWYA 3PIXA 3BU6A 3VULA 3LQ8A 3QTIA 4FT3A 3OWJA 1XH9A 3UGCA 4FZFB 3VVHA 3AC8A 3A2CA 3FZSA 3H9RA 4G17A 1ZMVA 4XG3A 2X9FA 5KKRC 4ACDA 4CFFA 2FVDA 4L68A 3RNYA 5F4NA 2UVZA 3BYOA 4ANSA 2ERKA 4PPAA 5KMOA 5FXSA 4MXAA 4A9UA 4W8EA 4RIWA 3A60A 3HRFA 1JLUE 2X4ZA 3F3TA 3BLHA 2RFNA 3HZTA 4ANQA 4EKLA 2R4BA 2W5HA 3BHUA 5JFVA 4BIDA 1U59A 2YIQA 3PA4A 2O8YA 3GEQA 4A9TA 4G5PA 2HWOA 4MWHA 4BKZA 2BRGA 4NIFA 3NYNA 5B2KA 5CAVA 1SM2A 4MBIA 4DGLC 5EYMA 4C0TA 4H3BA 1UU3A 4WSYA 5EI6A 4B99A 3MYGA 2J5EA 5AMNA 5A4QA 1CKJA 4C4HA 5BVDA 4TYHA 2BR1A 3A62A 3ALOA 3IW4A 4M15A 4N70A 2WTKB 4BDBA 4BDAA 3FMJA 4JBQA 4NSTA 5ETIA 3H4JA 5LVOA 4LGDA 5HG8A 4DGGA 4EHGA 2OH4A 3BE9A 3FSKA 2C30A 3HDNA 4KIPA 2QO9A 4RVMA 3W2PA 2WD1A 5IA0A 2QOKA 3MA6A 4G5JA 3OT3A 4IX3A 4P7EA 1KOAA 1H1RA 4FK6A 4N4SA 4AT4A 4EJNA 2YCSA 3R21A 3COKA 1AGWA 1MQBA 1WVWA 2UZUE 2UW0A 3ACJA 3N9XA 4CLIA 5T3QA 1W84A 3Q96A 4C62A 5AAFA 4D5HA 4BCOA 4FIHA 2HY81 1T46A 3E3PA 3FZTA 4CLJA 2XVDA 5ETFA 4JR7A 2ZMCA 2EXEA 5EFQA 5HO7A 3D4QA 2NRYA 3DOGA 2BIYA 3PWDA 3PYYA 5D10A 3GC8A 3WYXA 4UN0C 2CHLA 2VZ6A 4Z16A 1SZMA 3A7FA 4L43A 1YRPA 5AUXA 4MXZA 4G31A 2H8HA 1OIQA 4FT9A 3UIBA 4NTTA 4ERKA 5FQDC 2IZTA 2R3RA 4AP7A 3EKNA 3QD0A 4AF3A 1DAYA 4OR5A 1BI8A 2F9GA 2B9JA 4KRCA 4X0MA 2WQEA 3QCYA 4FKUA 4EI4A 2G9XA 1YHWA 3E8CA 5GJFA 3T3VA 2UZWE 2JGZA 1HOWA 1WBWA 3CBLA 5HTIA 4U79A 2VNYA 3PVWA 3D7TA 3G9LX 5HG5A 3KXHA 1CKIA 5M4UA 1O6LA 4YC8A 2QO7A 3PVGA 2E9UA 4GVAA 3O2MA 5J7HA 3WF5A 1IRKA 3KVWA 2R5TA 2E9OA 4PWNA 3UVPA 2WTDA 1XBBA 3UBDA 1Q8WA 5HE2A 4WRSA 4ALWA 3TKHA 3C0GA 4IZYA 5CALA 2X2LA 3R28A 3PXFA 4ZTHA 5HHWA 1H27A 5IDPA 2FUMA 4F0GA 3Q9XA 1I44A 4RX7A 3UP2A 3FMMA 4A9SA 4QMQA 5FD2A 2X39A 5CSPA 5KMMA 2VTJA 3RBWA 3FPMA 4BDGA 2E9PA 3WZEA 4MBJA 2OH0E 5HVKA 2YWPA 4M13A 4QMNA 5M4CA 3COHA 1WVYA 4YZMA 1MRYA 5GNKA 4K33A 3C4ZA 4B6LA 2CGVA 2XNOA 4AG8A 5AR2A 2WAJA 4ASEA 4DAWA 2XK8A 1VEBA 1YWNA 3OVVA 5EI2A 3R7OA 5A9UA 5IUGA 2V0DA 2I0YA 1H08A 3GU8A 3PSBA 3SOAA 2OBJA 4Z9LA 2R7IA 5AP5A 4OBOA 2B9IA 2C6EA 3OTVA 3EN6A 4E5BA 2YIXA 4JLCA 4D2SA 4NM3A 1Z9XA 4M68A 2VX1A 1QCFA 2JBOA 2EUFB 2J50A 3DJ5A 3R7GA 3POZA 4BL1A 3QRIA 2LGCA 4JBVA 5J5SA 3ZSHA 5ACBC 4V05A 1SVHA 3H0ZA 5CU6A 3QXOA 4EOOA 4J8MA 1YXUA 2FYSA 3DDQA 1GZNA 4ZTMA 3NIEA 3NDMA 1F3MC 3AGMA 5CWZA 2VTNA 1PHKA 5I9YA 4EH9A 3TEIA 5AR8A 4RQKA 4MXCA 4MKCA 4RJ3A 4RIWB 4YPSA 3MFTA 4FL2A 1PXPA 3PFQA 3Q4CA 4FT7A 3FAAA 4BWKA 4E4MA 1IA8A 4FSWA 4WHZA 5CZHA 3PA5A 5AV0A 4C8BA 1IG1A 3GI3A 4LV5A 4XV9A 4C4IA 4ZY5A 1E9HA 1U46A 2ZM1A 4OAUC 4XMOA 4TWOA 4BCMA 1HCKA 5TE0A 2GU8A 3HV3A 4JQEA 3LFBA 4QT1A 3P9JA 3GC7A 2C6KA 4BI0A 4QMTA 4TYHB 1AQ1A 2VO7A 3G51A 4FOCA 3UTOA 3VBWA 3S1HA 4QMWA 4UZDA 3RK5A 5CSVA 1M7QA 5AP2A 2IW6A 4LRJA 5HE0A 4WUAA 2CSNA 4APPA 1PXKA 4R5YA 3SVVA 2OFVA 3DK6A 4YZDA 3R01A 4UALA 4UWCA 3BGPA 4QPSA 5JQ5A 3KKVA 4RC2A 2XUUA 3BQRA 5HE1A 4M0ZA 1X8BA 4QP6A 2R0IA 3P7CA 3ZO1A 3PPKA 4C02A 3WE4A 4GSBA 3DK7A 4BZNA 4O22A 4U43A 2QKWB 4FV0A 3PXQA 3AC5A 2WNTA 4UX9A 4WUNA 4CVAA 5HTBA 2GHGA 3KA0A 4NCTA 3C5UA 2WTIA 4MD7E 1H1QA 4IM0A 2JIUA 3V5QA 4R3RA 3HMPA 4FTLA 2WOTA 1YWRA 4GK4A 4AU8A 3NWWA 4DEEA 5AIKA 3E8EA 2UW3A 4FIIA 4YZCA 3AT4A 2VTLA 1DI9A 5AV4A 3TWJA 4L52A 4BI2A 3G6HA 2XEZA 5AAGA 4I6HA 1QPDA 3E64A 3OWPA 5A4CA 1H1WA 1NVSA 5L8JA 2AUHA 3QCQA 4Z7HA 4FTJA 3TV6A 4FK3A 2R3OA 3F2NA 5LQFA 3ZS5A 1WVXA 3ZEWA 5KX8A 1G3NA 3D7TB 4BZDA 4E5WA 4U9AA 2PVYA 4JX3A 5E8WA 4KIQA 3ODZX 4QMSA 2XKDA 3ZRLA 4YLJA 3R7EA 1UNHA 4JJRA 3W8LA 2PE2A 4AW2A 4JG6A 4RT7A 4H1MA 5CT0A 4I5CA 5H8GA 2PVHA 2R3HA 2R3KA 2WTCA 3MIYA 4QMMA 5HGIA 3W2SA 5EK7A 4ACMA 4UMUA 2OF4A 2BROA 4X2FA 4RG0A 4DFNA 3UO6A 5FEQA 3ZH8A 4U40A 5I9ZA 4YJNA 5KZ0A 3ZUUA 4W9XA 4ACGA 4LFIA 4CD0A 3OCGA 3I0OA 3AD5A 4C37A 4ZZMA 2O5KA 3BEGA 5FXQA 3BZ3A 2FGIA 2JDRA 2QURA 4ZP5A 1EH4A 3ZHPC 2WMUA 3R6XA 4HVDA 1NVQA 4TNBA 4X3JA 2JC6A 1UNLA 2ITUA 3CGFA 4CTCA 3RAWA 5HIEA 4L8MA 5DH3A 5I5ZA 4JDJA 4A4OA 5IMEA 3RPRA 5CEKA 3O23A 3R1NA 3QCXA 3PA3A 2C1AA 2W9ZB 4DEBA 3TZ7A 2X4FA 5BVKA 3RM7A 5HU9A 2WTKC 4H1JA 1OITA 3BLRA 3R1YA 3C0IA 3F69A 4PMMA 3VS7A 2IWIA 3MTFA 3W55A 4QMPA 2OFUA 4GJ2A 4EOSA 4LUEA 3RVGA 3CY3A 4JDKA 4CEGA 4D2TA 3QUEA 5BPYA 3HV7A 4AZFA 4K11A 3ODYX 2YJRA 4QD6A 1XJDA 4FZ6A 4F7JA 3CQEA 4TXCA 4AOTA 1WMKA 1YKRA 4NEUA 5AUYA 5I3OA 2YDIA 2BILB 4C33A 5AUTA 3BWFA 3OF0A 3OWLA 3IGGA 2QKRA 4FSYA 4QTDA 4Y46A 2ITYA 2XIXA 4BHZA 3SXFA 1ZY4A 3E93A 5HX8A 4OLIA 4C59A 2GCDA 3AGLA 4JI9A 1UV5A 4BCPA 4I3ZA 2YITA 3PY0A 4OBPA 3DT1A 3I81A 2R3LA 3HEGA 2VO3A 5DA3A 1RQQA 4CZUA 3I7CA 2C5XA 5C8MA 4P2KA 5BVFA 1PXMA 2VTMA 2OIDA 4OTRA 3QLGA 2BAQA 4QYYA 2CLQA 3UO5A 1F0QA 5FM2A 3LFQA 4L00A 3RPOA 4U7ZA 3FSFA 3G2FA 4XP0A 3QUDA 5EKOA 2UW6A 4Y5QA 4F6SA 4YJVA 3NAYA 3UNKA 2KTYA 3AOXA 3BLQA 4FVRA 1Q62A 2BKZA 5E8SA 2C6DA 3ZO2A 1KOBA 3UZPA 4AZTA 3VW8A 2YEXA 3UDBA 4ZLYA 3DTWA 2WQBA 2XBJA 3EMGA 4L53A 5BMMA 3P7AA 2UZNA 4AW1A 4J52A 1HCLA 4M97A 2F7ZE 1MQ4A 2UVXA 3EKKA 4FV5A 3OP5A 5CQUA 3FMDA 4DFXE 3K54A 3W2RA 5CF8A 2F2CB 5L6PA 4DEHA 2W1HA 4OT5A 3KULA 3R7UA 5IZFA 4U97A 2P55A 4F64A 3ORPA 5DN3A 4XLIA 1PKGA 1ZARA 4K18A 4C36A 2BALA 4OTGA 1NXKA 1OUKA 5JFSA 5HD7A 5E91A 2RL5A 1PY5A 3PUPA 2DYLA 3VUHA 3HA8A 5HESA 5HG7A 2QNJA 5LMKC 4QMLA 2WTWA 4ZJJA 2G15A 4M12A 4USFA 5J9LA 3CKWA 4MQ2A 2GNHA 3Q9WA 5B2LA 4HNFA 1RW8A 4P4CA 3V5TA 4UMPA 3F3VA 2XA4A 4NWMA 3ITZA 4XG7A 4BF2A 1IASA 5GZ8A 3VRYA 1OL5A 5FP6A 4KS8A 5M44A 1UWJA 3O8PA 4PDPA 2VGPA 4W4WA 3WIGA 5A46A 2YLFA 3BPRA 3R22A 5HIDA 2PE0A 4RWLA 4WA9A 5JSMA 4D1SA 1OVEA 4DH1A 3WI6A 2PMLX 3FKOA 4FTTA 2R64A 4HCUA 5LOHA 1VYWA 2LAVA 4GJ3A 4K9YA 4LV8A 1JPAA 3LQ5A 3OXZA 2XNPA 1W0XC 2HYYA 4RIOA 1YW2A 3TV4A 4CCUA 2C6TA 3ULIA 4KABA 3LLTA 4RRVA 3W1FA 3JY0A 4FBXA 4PUZA 4JG7A 3EFKA 4AT5A 2VU3A 5AV1A 3SX9A 3ZLSA 2XH5A 2ZB0A 5CS6A 1V1KA 2QQ7A 3QL8A 4FV9A 4RSSA 5CSWA 4J1RA 4R7HA 4NUSA 3QTRA 2YLEA 4YLLA 4DGOA 3OZ6A 4FSMA 4TW9A 4FTQA 3KXNA 2WMXA 2WMTA 4IZ5A 3TNWA 4RC3A 3PTGA 2YCFA 1SNUA 3VBTA 3LXLA 4HVGA 2Q0NA 3FXWA 3WF6A 4F63A 3TNIA 1K2PA 2C3JA 4I0SA 4R1YA 3U4UA 2WTJA 3VBVA 4XBUA 3GU7A 4IJPA 3QTSA 2W1ZA 4UY9A 3E88A 3LXNA 2W4JA 4HW7A 2ITTA 3KB7A 5FEDA 3DFCB 4PRJA 4HGTA 3O96A 4WIHA 3E3BX 4P5QA 3FLQA 5DEYA 5KBRA 3QGYA 1PXNA 3ALNA 3OOMA 4E6QA 1UU7A 1O6KA 3AT3A 3SXRA 4GCJA 4O0WA 2P2HA 2W1DA 5EYDA 4IW0A 1H00A 3D2IA 2OZOA 2HW6A 4X6QC 2WMSA 5G6VA 3ZFMA 2Y0AA 4ZIMA 4WBBB 4LYNA 2IVVA 3MGYA 2X0GA 4QO9A 3NAXA 4DTKA 2CLXA 1W82A 5JRQA 4ANMA 2G2FA 3JS2A 4YJQA 4YNEA 5HCXA 5BUJA 1PMNA 1P4OA 3MPAA 3VQUA 2V22A 1CTPE 2IJMA 3LCTA 3C0HA 2XNNA 5AUUA 5AR5A 4EQMA 2CJMA 3FLWA 2J6MA 3FV8A 5J1WA 1CDKA 4FYNA 4QYFA 3PXZA 1ZYJA 5EYCA 5KMKA 5D11A 5HCZA 4DH5A 4EZ7A 2OSCA 3ZLXA 1JKSA 5LXMA 4G3EA 3KULB 2OJFE 2OK1A 3CD3A 1WAKA 2XKEA 3QQFA 2ETRA 4D2WA 3SOCA 4FSQA 3SLSA 3UP7A 4D4SA 3ZRKA 4G6NA 4IZAA 4JVGA 4IE9A 2C6LA 3QQJA 4O91A 3VBQA 4WRGA 3ETAA 5DFPA 3QC9A 4FZDB 3WZUA 3COIA 4EOQA 5AX9A 3FQSA 3R9OA 1PXIA 4NFMA 2PWLA 4YJSA 2I40A 3H10A 4F6WA 2YFXA 4CNHA 4EZ3A 3AQVA 2NO3A 4D58A 4PNKA 1FVTA 5CF6A 5JN2A 1JWHA 2B9HA 2PZRA 3BYVA 3R9DA 4EYJA 1Y8YA 3G33A 2GNGA 4EKKA 5J1VA 1H8FA 3R9NA 2R0UA 5F94A 4RZWA 1OKWA 4G6LA 3AD4A 4CKIA 5IU2A 2RF9A 5K0XA 2UZOA 5HBHA 3FZ1A 2ZMDA 3FMHA 3ANQA 4FTCA 2C3LA 5EHLA 3MH1A 1E1XA 3ZEPA 5CAUA 4LMNA 2PMIA 3B8RA 2Z8CA 3OT8A 2WO6A 4AGDA 4BWPA 2G2HA 4BRXA 3UIXA 5HD4A 4ZS0A 2W1EA 4O2PA 1YQJA 2YERA 3QAME 3V04A 3AC4A 1Q97A 2VO6A 4XV2A 1WBVA 2QOLA 2C0IA 4MD9E 3F2AA 5CNOA 4FTNA 4XYFA 2A27A 4F7LA 3WIKA 2J90A 1ZOGA 2J7TA 3VWAA 1H0WA 4TYEA 4C7TA 3EQFA 4EUTA 3EZRA 2C3IB 3GCSA 4EC9A 2VWWA 1YHSA 4AZWA 3EQPA 3CR0A 3MH0A 2BFYA 2GHLA 2YA9A 2YJSA 2P4IA 3EYHA 4FKRA 4U42A 3BKBA 5AR7A 5ACKA 3VN9A 4C34A 3O51A 4AN3A 4B0GA 2C68A 3RALA 3V5JA 4PDSA 2C0OA 4XRJA 3UG2A 4PDOA 4MNFA 3BELA 4F0FA 1ZZLA 5KMLA 2WIHA 2YM5A 4PPBA 4O1OA 3W2OA 1O9UA 2XNMA 4FSTA 4DG3E 3ZDIA 3EYGA 4M66A 4R3CA 4K77A 4I21A 4ASDA 5M56A 3L1SA 3OHTA 1M7NA 4BWXA 5HU3A 1NY3A 2XRUA 2P33A 2CGXA 2H9VA 4BGGA 5J8IA 3BYUA 4I4FA 4WKQA 4AW5A 2XZSA 3PP0A 4I0TA 4K8AA 3H0YA 3QA8A 4A06A 4WNKA 3GFEA 4BCJA 3PJ2A 3D5UA 4NCTC 4O0XA 2BAKA 3GQIA 3LFAA 3KY2A 3QALE 5HVYA 3EJ1A 3U9NA 5ANGA 3FE3A 4C3PA 4DBNA 4IM2A 4GVJA 2HW7A 2C5OA 1SVGA 3GXLA 3I7BA 3SRVA 2QU6A 4NW5A 5K5XA 4Q2AA 2B53A 4HNIA 2WMAA 4JNWA 4V01A 3NR9A 2IO6A 3ET7A 3IG7A 4JS8A 5AX3A 3VS5A 2XM9A 3SQQA 3W32A 4DINA 4CT2A 1XH7A 4MXYA 1UU9A 4H3PA 4W9WA 3GUBA 5CSHA 1URWA 2VNWA 4FICA 3MWUA 5HTCA 3ORTA 5LVMA 2GHMA 5CLPA 3LOKA 2FSLX 4FTKA 2X81A 2JIIA 3C50A 4RJ7A 2Y7JA 3NW7A 5T68A 3LFDA 4JIAA 1P4FA 2Z7RA 3D5VA 3WBLA 3ZFYA 3W33A 2VO0A 5HI2A 1XBCA 4C57A 3II5A 4HYUA 4O38A 2QVSE 2ZJWA 3P1AA 4JBOA 4I22A 2UW5A 4KSPA 4QPMA 3UE4A 3EOCA 4FVPA 5CNNA 5FP5A 4CT1A 3E63A 5CEQA 4X2GA 4AZEA 3TG1A 4C2WA 3OTUA 3AC1A 3IS5A 1PXOA 3NNUA 5ANDA 4IVCA 2W1IA 3GC0A 3VS0A 3TUDA 3L9LA 1OL6A 1GJOA 2BTSA 4A07A 4AT3A 5CSXA 3QF9A 4FEQA 3EN4A 5LVPA 4QNYA 3NNXA 3AT2A 3MIAA 4BBMA 1UKHA 3ROYA 4LG4A 4D1ZA 2JBPA 1ZMUA 4XV3A 4NW6A 5BUIA 3SW7A 5DNRA 3UIMA 4I1ZA 4YLKA 4WO5A 1WBSA 3OY3A 5DR6A 2JFMA 4BCHA 1BLXA 2X2KA 4D0WA 4FT5A 3FDNA 4S34A 4V04A 4MX9A 3ZYAA 5H2UA 3TNQB 5T6KA 3EN7A 2PVMA 1BMKA 1OB3A 5JRSA 3RCJA 1R1WA 1CKPA 5J5TA 1OZ1A 3OD6X 4C2VA 3JY9A 2E9VA 2HK5A 5L6OA 3QBNA 4BHNA 2CN8A 1PF8A 3A61A 3ZFXA 4OUCA 4A9RA 4DFYA 2OGVA 1M52A 2BCJA 4AACA 4FSZA 4ZK5A 2WZJA 2O63A 5CEIA 3S95A 2YZAA 5LVLA 4D2PA 5EDPA 5KCVA 4ZLZA 5EM8A 5CU2A 3KMUA 2OXXA 3M11A 2YM7A 2YIRA 3RNIA 4BTFA 2W99B 5I9XA 3NPCA 4AFJA 2VWUA 4R5SA 2XB7A 3C4FA 3P79A 4J99A 3VS1A 2W4KA 3F5XA 1WBNA 4I93A 4PY1A 3OFMA 4I5MA 4ASZA 4QP9A 1URCA 3ZDUA 3DQXA 4CFXA 4U81A 4S33A 3KN6A 3UYTA 5I9VA 1OIYA 4V0GB 2VTPA 3R04A 3CQUA 5IISA 3UC4A 1JQHA 4QP7A 1REJA 2ZM3A 4F08A 3EQBA 3Q4TA 3QWKA 3UMWA 4ZTRA 1PXLA 2PVJA 3K3JA 5HLPA 4AW0A 2I1MA 3LHJA 5FDPA 3ZM4A 3MPTA 3OOGA 3DBFA 4QYGA 4IWQA 2PHKA 4RJ4A 2QOOA 5DRDA 5A4EA 2RGPA 1QMZA 3R9HA 3K2LA 1YOMA 3LVPA 1OMWA 4IH8A 4IX4A 4YSJA 4QPAA 3NYVA 5JZNA 4BBFA 4F65A 4LL5A 3D5XA 3ULZA 4APCA 2BDJA 4Q5HA 3NIZA 1VR2A 4OTHA 3V3VA 4FL3A 3SRVB 3A99A 2WTVA 2WQMA 4B9DA 3BHYA 3MPMA 5DG5A 4KKEA 5EM6A 4YP8A 3MVJA 5TOZA 3MH3A 5HG9A 3MN3A 3HV6A 3ZC5A 4ZXTA 5AP7A 4O0UA 3UVRA 5A6OA 4FR4A 2ETKA 2X7FA 3IECA 4HPTE 2XS0A 3NX8A 1K9AA 4GYGA 2BFXA 4O96A 3Q9ZA 2FH9A 3H9FA 1M2QA 2B7AA 3DBQA 5M51A 2GDOA 1RJBA 4NM7A 4ALUA 2QC6A 3G5DA 3UYSA 2UZLA 4IB5A 1RDQE 3GU6A 5EW3A 3VUKA 5DEWA 4PQNA 2BHHA 3TKIA 1JSTA 3VIDA 5EW8A 5LCKA 2UW7A 5FBNC 3LFCA 3KK8A 3HUBA 3SV0A 4IX6A 4Y73A 2YIYA 2W1FA 3O8UA 2W05A 3RAKA 3GB2A 2HCKA 2V7AA 4EHEA 3I6WA 4P5ZA 5CVGA 5KBQA 3QA0A 3MFUA 2W9FB 2UZBA 2REIA 5BYZA 5B2MA 5C27A 2Z60A 3MDYA 3MI9A 4D4RA 4IFGA 1A06A 3LFEA 2OI4X 3DPKA 3DV3A 3IDCA 4IIRA 4N0SA 3JPVA 5GJDA 4TKSA 5JQ8A 1U5RA 4ARKA 4I20A 3ZCLA 3KVXA 3OC1A 5HLWA 5AIRA 4HCTA 3EHAA 3RK7A 3MVMA 5L2WA 4Q9ZA 4H36A 3R71A 2JKQA 3COMA 5J79A 3T8OA 4ZJIA 5ANEA 3Q5IA 3ZTXA 3HL7A 1GNGA 4KINA 3JXWA 4YHJA 5HBEA 4TY1A 3P08A 4UYNA 4WG5A 2EB2A 2OIQA 4XG4A 2RSVA 4XP2A 4LRKA 4A9YA 4IWPA 4RJ6A 5J9ZA 4U45A 4GV1A 4CYIA 3RHKA 5CU3A 3IW7A 4HCVA 4BKJA 3WOWA 3RJCA 4EONA 4U41A 1LEWA 3CLYA 5IF1A 1KSWA 3FC1X 3G0FA 4YU2A 4Z3VA 1ZOEA 3QRKA 4M0YA 3C7QA 1NVRA 3C13A 2IW9A 3FY0A 3OEFX 3D94A 1FVRA 2V55A 1ZMWA 3UODA 5HQ0A 4QP3A 3FMKA 3CPCA 3A4OX 4CFNA 2F4JA 1H28A 3FKNA 5C01A 5IG1A 1H1SA 4CQGA 2XK7A 3SHEA 1Q8UA 4CQEA 3QHRA 2JFLA 2QR8A 3HECA 2XMYA 5KE0A 4KD1A 2VN9A 5IMXA 3BRBA 4DC2A 2RIOA 4IWOA 4ZSJA 5DE2A 1AD5A 1GOLA 2ITXA 2J0LA 4RJ8A 4ENYA 2RFDA 2BHEA 3LCDA 2BMCA 5F95A 2PVFA 2B4SB 4EH7A 2OZAB 3IW8A 4MEDA 5TO8A 5J7BA 4FF8A 1OL2A 2X9EA 4JRVA 4RGJA 4RWIA 2CCHA 3FZPA 2Z7SA 3B2TA 2V62A 4F1TA 3NUXA 3V01A 1H01A 4QP1A 4OTWA 3KGAA 3MBLA 3UOHA 3AC3A 2ONLA 1XR1A 4XX9A 3QTQA 5KUPA 1I09A 4AQCA 3KXXA 4C61A 4GUBA 4J8NA 4DEIA 3CXWA 4DYMA 4F9AA 2YM4A 2Y8OA 3R7YA 4AOIA 3CQWA 5CX9A 2JLDA 5EG3A 1ZLTA 4RC4A 5I9UA 3ZOSA 1Y6BA 2QOHA 3Q6WA 4OBQA 3CJGA 5JEBA 5BX0A 1Q5KA 2QG5A 4XUFA 3QGWA 4X21A 2W5BA 4FNWA 4ZY6A 2ACXA 2C1BA 2GS2A 3HNGA 3DNEA 3V8SA 3FI2A 4HOKA 4IAAA 4C4JA 3HP2A 4HJOA 4F99A 3OCSA 4FV2A 4J96A 4DEAA 4TWNA 4QMZA 3BQCA 1Q3WA 3DFAA 3KMMA 4FTRA 4Y8DA 4FL1A 3UNJA 2J4ZA 3PRIA
chains in the Genus database with same CATH superfamily
2CDZA 3IONA 3CE3A 3OW3A 3QTUA 3WF7A 3TN8A 4ONAA 4Y72A 3WYYA 3ER9B 5FTQA 4QDEA 4FKLA 3VQHA 2R2PA 4F70A 2F7OA 3O71A 4QMXA 5ICPA 4RFYA 2FSTX 2GNJA 2VGOA 1PXJA 5C5BB 3OG7A 4GIIA 3WE8A 4EK5A 4F1MA 3EWHA 3LMGA 4MVFA 4PL5A 2OXDA 3POOA 3SD0A 2WU6A 4EJ7A 4YC3A 2IVSA 2QOIA 3OMVA 4GMYA 5DR2A 3FUPA 4L7FA 3W2QA 4EQCA 3ERKA 1W2DA 4EZ5A 4O27B 4JRNA 1WCCA 4RLKA 2CMWA 3P7BA 5IUIA 1Y91A 3VF8A 3S4QA 3PXKA 4C3FA 3FHRA 4BDDA 3Q53A 4FTMA 3BEAA 4M7IA 3D50A 1FOTA 4AXCA 2YCRA 3NRMA 3P0MA 2D4CA 5L3AA 2EFKA 4RX8A 4DH7A 5FWKK 2UVYA 1HWWA 4EZOA 4I6QA 1J91A 3KK9A 4PMTA 5EI8A 4BDKA 3DTCA 2IVTA 3S00A 3QQKA 4KB8A 4E1ZA 2R7BA 4NT4A 5KMJA 4QP4A 3IW5A 4AVMA 3Q4ZA 4YC6A 5CASA 3CPBA 2KULA 4LL0A 4TYIA 1YXXA 2Y4IB 3DA6A 5AV3A 2YISA 5AEPA 5I4NA 4I41A 2VWXA 2X7GA 3EQDA 3TJDA 4E4NA 3G90X 4L7SA 4USEA 4LOOA 1YWMA 4H05A 3HKOA 4CXAA 3KXZA 4KA3A 4O1PA 3VAPA 4CRSA 1MUOA 1OPLA 1GZOA 3UJGA 5CT7A 2O2UA 3O3OB 1YXVA 2XF0A 4MTAA 1Q8ZA 4D5KA 5LCJA 4FX3A 4QTEA 3W18A 5AA8A 5C8KA 1G8SA 4MAOA 2Y4PA 3NNWA 3EQRA 5E8YA 3DB8A 3LCOA 3NUUA 2MI7A 3BBWA 3CVRA 4BDJA 4UXQA 1ZZ2A 3Q52A 1APME 4W4YA 3C4EA 3H9OA 3Q9YA 1LPUA 1ZYLA 3LQ3A 4EH4A 4ZSEA 1KE8A 1ZY5A 2JAVA 4FKJA 4GFOA 3R02A 5EOBA 5TT7A 5HNIX 3MW1A 2OW7A 4TTHB 2CPKE 2JAMA 4J53A 2J0MB 3C9WA 4JMQA 3R7VA 4IVBA 3LFFA 3QD3A 2O0UA 3T9IA 4KBKA 1XMLA 2XEYA 4K0YA 2F49A 4PMPA 4N6ZA 3M1SA 3NYOA 3UG1A 4I0RA 3HA6A 3FQEA 1Q61A 1KE6A 4IVDA 2ITPA 2WMRA 4FIJA 4OW8A 1GZ8A 4JQ8A 4FZSA 2EXCX 4O0VA 3MJ1A 2GFSA 2HWPA 3O0GA 3GCUA 4TPTA 4D4VA 5AM7A 5EYKA 4UB7A 2ZOQA 3WZJA 4AA5A 4EWHA 3F7ZA 4F9YA 4D2VA 4FKGA 3OW4A 5HVJA 3LFNA 3QRTA 3REPA 4E20A 4E81A 1I4TA 5FUTA 5CYIA 4IDVA 2CN5A 4WPEA 3BL7A 1JBPE 3ORXA 4GRBA 4CSVA 3ACKA 1Q8TA 1XWSA 3MTLA 4A4XA 2BRBA 4FNZA 4L3JA 3R8VA 4XG8A 3V6SA 4EUUA 4KBCA 2JKMA 4FOBA 2I0VA 3WARA 5BVNA 5FM3A 5KO1A 4YZNA 2BRNA 1V0BA 1R78A 4AS0A 3VHEA 4ZTLA 3GC9A 3R83A 4ZLOA 2I0HA 4RLLA 1JKLA 4TYJA 4WSQA 3TZ8A 4CMTA 4QMOA 1H24A 1TQIA 4RWKA 2ZDUA 4PTEA 5A14A 2YLLA 4ZS4A 4DFUA 4AXAA 2HZNA 2R3PA 3FL5A 3TACA 3ZSGA 1I4LA 2BZJA 4O82A 5ETAA 4RZVA 4RFMA 3OCBA 3D2KA 3OXIA 1JKKA 3I79A 4AGCA 4S32A 4CFUA 3G6GA 3MY5A 4XOZA 3DKOA 2CKPA 3EJTA 4FV4A 5LWNA 3PG3A 4QQCA 4XLVA 3KAWA 3DLSA 4XHKB 3ZBXA 4YSMA 5M09A 4EOPA 3PJCA 2X5CA 2XJ2A 4G3CA 3UPXA 3PLSA 4IXPA 4IZ7A 2WU7A 3GCPA 2ITQA 2XK9A 4YBJA 4ZEGA 2A2AA 3TCPA 4FYOA 3OWGA 1GY3A 1Q41A 4NFNA 4BDEA 1Z5MA 2R3FA 3PJ3A 3R1SA 3FMEA 4KNBA 4IBMA 5KZIA 3KRXA 3O7LB 4J7BA 3RWPA 3SC1A 3ZSIA 4B7TA 4QTAA 4F1OA 5CAQA 2CKEA 1HTYA 2CKQA 4ZTSA 5CQWA 5C26A 5IEXA 1NA7A 2PSQA 2JDSA 4UMQA 5CXHA 3G15A 3QC4A 4DTBA 3NVKI 2OKRA 3F7WA 3FYJX 3R1QA 2WXVA 3V5PA 4BN1A 4UYAA 3EL8A 3T3UA 4YO6A 3QKMA 3FLNC 1JVPP 5TR6A 1KV1A 1REKA 2J0JA 1A9UA 4AE6A 1F5QA 5EDQA 4IAIA 2OWBA 2XCKA 3CTQA 3MH2A 3S2PA 4R8QA 1OKVA 3MVHA 4TT7A 4AGWA 5L4QA 4LM5A 3VF9A 3R7IA 1Q8YA 3DPPA 4PNIA 3C4CA 3L8SA 3GI7A 2AEGA 4WT6A 1OKZA 4JAIA 4QMVA 4IACA 4QQ5A 3OUNB 4R1VA 3L8PA 4ANLA 2OICA 3ORMA 2RKUA 4KKHA 4TNDA 2Q0BA 4QMUA 4EQUA 5EDRA 3UITA 1IAHA 3T4AG 2BTRA 3W0OA 5CI7A 3PIZA 3I2WA 4PO2A 2X8DA 1Q4LA 4PF4A 5B0XA 3U51A 3BYSA 2YM6A 1VJYA 1GZKA 2RFEA 3UDTA 5IA2A 1XQZA 5DVRA 3ANRA 2JD5A 2PZIA 1U4DA 2ALWA 2Y9QA 5AP1A 4EL9A 5JGBA 1Y6AA 3VW6A 3RCDA 1OPKA 4RVTA 5D7AA 4G6OA 3RINA 3QFVA 4Y95A 3EIDA 2QOQA 1S9IA 3VUIA 5L2TA 3FXXA 1SMHA 5ANOA 5DI1A 2HAKA 4ZSGA 5BVWA 3TIZA 3RAHA 4PTGA 3R00A 4KRDA 3CJFA 3MB7A 3ENHA 2YCQA 5EW9A 5HCYA 3CKDA 2QD9A 4E93A 3DPQA 4W4VA 4E73A 3CC6A 3UPZA 2WEIA 4O7SA 3C51A 3MFRA 2VX3A 4KSQA 4XBRA 4ZJVA 2ZAZA 1QPEA 4KKGA 2Z2WA 4WG3A 5H3QA 4DLJA 3BBTB 5CF5A 1H1PA 2Y6MA 3DB6A 2SRCA 3IQ7A 2JKOA 3DQWA 3OXTA 3Q60A 5IA4A 2CCIA 4NTSA 1R0PA 3R2BA 4FKWA 3V5WA 4BCQA 4F4PA 1STCE 1MRUA 1E1DA 5CTPA 3R73A 4ERWA 3NUYA 1JOWB 3F3WA 3ZMMA 2PUUA 2QOCA 4RQVA 2ZVAA 3SA0A 5IQIA 5HKMA 3OEZA 3EFLA 4JN4A 4O0RA 2OF2A 1YXSA 3ORNA 3QKLA 4FI1A 3C1XA 4M0MA 3LMHA 1O7DB 3LCKA 1KUTA 4IFCA 2GNFA 5TKDA 3RPVA 3SAYA 5IDNA 1JKTA 4PL3A 5H9BA 3TKUA 2FSOX 3O8TA 1CMKE 2YIWA 1FPUA 1SNXA 2B52A 4NJ3A 5GZAA 3JYAA 3KRWA 3QQGA 2ZM4A 3QD4A 4HZSA 4O21A 3TZ9A 2Z02A 4ATMA 2FB8A 3QNJA 4NK9A 2R3QA 3ZLYA 4CV8A 3FJQE 3LM0A 3ZXZA 5JFXA 4BCKA 5F20A 2QHNA 2UUEA 2OJIA 2XK6A 5BUEA 5FXRA 1YOLA 4J97A 4ZOGA 3BCEA 4MF0A 4U6RA 1B6CB 4LMUA 4PMSA 3BVUA 1YVJA 5AJQA 2NPQA 4IAKA 5IA3A 2Q13A 5AA9A 3FKLA 4DH8A 3RPYA 3NCGA 3RMFA 4UZHA 2YL8A 4BICA 4G3DA 4BCIA 5L2SA 3KCKA 2C3KA 4GU6A 3NYXA 4ITJA 2PL0A 3W8QA 5JZJA 1DS5A 2GQRA 3NNVA 4YJRA 5DIAA 3DK3A 4DCEA 2PMNX 1H0VA 2ESMA 2HZ4A 4U0IA 1OIUA 1W2CA 2J5FA 3ZUVA 4D4YA 4V0GA 4Y5HA 5TKYA 2VTSA 4L6QA 4W8DA 4YJUA 5L6WL 3SXSA 2WKMA 4Z55A 3KU2A 1O6YA 5K0KA 3I6UA 5GJGA 3RK9A 1T45A 3FHIA 3EN5A 3QXPA 2WQNA 5LVNA 4QP8A 4BFMA 3QQLA 4NKSA 2PVKA 3WF8A 2AC5A 3NW5A 4AOJA 3VUTA 2BAJA 5EM5A 3BVWA 3PP1A 2DS1A 3HGKA 4EOJA 4FKQA 1OGUA 3TNPC 4CFWA 4YR8A 3EQCA 5FEEA 3E62A 2XM8A 3F5PA 3P23A 4LQMA 4YTCA 3FLZA 5K9IA 3QU0A 4I24A 4MYGA 4EBWA 3U6HA 1YXTA 2W96B 4DITA 2X1NA 3CS9A 3DCVA 3O17A 5I9WA 3W16A 4X7QA 1ND4A 2R9SA 4AX8A 1Y57A 3E7OA 3I5ZA 2Y4IC 4PPCA 4F6UA 1MRVA 3BU5A 4FKTA 3S0OA 1J1BA 5I0BA 3EQGA 3ZU7A 3PLAE 4QMYA 2H6DA 3PJ8A 2C5YA 2YM8A 5CF4A 5J9YA 3RKBA 1JSUA 4JG8A 3RGFA 4X6RA 2F7PA 3AMYA 1JNKA 2Z0OA 5KBPA 4XCUA 1IR3A 2BDFA 4WBOA 3BUIA 4JR3A 4XP3A 4MQ1A 1K3AA 1WFCA 4LI5A 4IB0A 2HENA 3ROCA 2AYPA 5JFWA 2V5QA 4O4BB 2YDKA 2JITA 4NYEA 3K5UA 4PX6A 3UQCA 4U44A 5LMKA 4XH6A 5BVEA 2FSMX 4ZSAA 2WINM 1WBOA 1H25A 2G2IA 2RAJA 1OI9A 4FSRA 4CZTA 4AZIA 1Z57A 3I4BA 4C4EA 2CNVA 4JXFA 2X8IA 3HMMA 4X2NA 1IA9A 3L8VA 3UC3A 4F9BA 5M07A 2J9MA 3D4ZA 1OUYA 1ZRZA 4EZNA 4ZMFA 5ITAA 4LUDA 4OTFA 5CAPA 2W1CA 3LJ2A 3HVCA 3PRFA 5G1XA 4I5PA 2F2UA 5HICA 3PXRA 4CFMA 2JDTA 5HBJA 1RE8A 2C69A 1KE9A 2QHMA 3ZO4A 4IAYA 3PIYA 3F3ZA 3O50A 4UMRA 3DDPA 3KN5A 4GEOA 5CEMA 4XEYA 3RTPA 4TZRA 2PTKA 2QLUA 1OIRA 2VTQA 4K1BA 4I94A 3TNHA 4IEBA 4BCFA 2WOUA 3CZNA 2BUJA 2HXQA 4AXEA 2ZYBA 2X2MA 4DFZE 1FINA 3BE2A 3QYZA 4Y83A 4ENXA 5AP0A 3OY1A 5BMSA 4G9CA 2JKKA 1M2PA 2ONLC 2GSFA 4YNOA 5J87A 4U3ZA 3CCNA 4QTBA 2RFSA 3FXZA 4DG0E 4FTOA 4F09A 4K6ZA 1XKKA 4DGMA 3HRBA 2XK3A 4YTHA 3IK3A 1TQPA 4GIHA 1JAMA 3MY1A 4DG2E 4E3CA 5IH6A 4I6BA 4YPDA 1WDZA 3HAIA 2HXLA 2UZEA 4N57A 4YJPA 4CTBA 2PY3A 2PMOX 3KRJA 1UU8A 3C4XA 3NW6A 3P78A 5FG8A 3VO3A 5IUHA 3F5UA 5AWMA 3SKCA 5AP6A 1VYZA 3ZONA 2BZKB 2YI9A 4IANA 2YL5A 4C38A 1WZYA 2J0IA 3QX2A 4L46A 4S30A 4ITHA 3KF7A 3QQUA 4RA4A 3RZBA 4C35A 4J98A 4R7IA 3SG9A 4Z7GA 4XOYA 2XYNA 5E8UA 1XH4A 4FNXA 2G1TA 3I60A 3FZRA 3BU3A 4O7ZA 4FGBA 4KWPA 1QPJA 1R34A 3BV3A 5FTOA 2BVAA 3KXGA 4FUXA 4JT3A 2IW8A 2PZ5A 3UQGA 4EWQA 3I1AA 3P5JC 1BKXA 3A8XA 2Z7QA 4NM0A 3FLYA 1OAOA 2C5NA 4J71A 1YDTE 3NUNA 5ANKA 4BCGA 3Q3BA 3HV4A 4O7RA 4IX5A 2ZV9A 5DGZA 2RG6A 2WQOA 4J95A 5BNJA 4FUYA 3PWYA 4LOQA 3U87A 2C47A 2GTMA 4AZHA 4Q9SA 3AXWA 3OWKA 4UV0A 2A4LA 4I23A 5LWMA 1U5QA 3NUPA 3GNIB 4UEUA 4ZSLA 4AUAA 1XH8A 3RPMA 3UIUA 3KRLA 4BB4A 2YL9A 2QU5A 3TUBA 2IZUA 5E92A 2VX0A 3QZGA 3TJCA 2JIVA 3PE1A 4ANBA 3RPSA 4FV7A 2FO0A 2EWAA 2HZIA 3FYKX 4GG5A 4ANOA 1B39A 2A1AB 4O0SA 5CZIA 3ZZWA 4DN5A 1YDRE 2OZAA 4BTMA 4HVSA 3M42A 1LQ7A 3WILA 2XAMA 3TM0A 3TTIA 2W06A 3MV5A 2PY6A 2FA2A 5CVHA 4N6YA 2OU7A 2V0OA 2Y6OA 5D7VA 2BZHB 1PYEA 5M57A 4MF1A 3K3IA 1GIHA 4E4LA 3LW0A 3Q04A 3H30A 4B9QA 3AD6A 4D1XA 4NZWB 3FQHA 1GNLA 1XHAA 5JK3A 3LXPA 3QNIA 4AXFA 4O6EA 4X2JA 4F7SA 1SU7A 4BBEA 4Y85A 3DYTA 4TN6A 5DOSA 4D0XA 5M53A 3FD9A 5CAOA 5FIGA 3G9NA 5DRBA 1FGIA 3QRUA 4BDIA 3RM6A 3TV7A 1YOJA 1DI8A 5IEYA 4IB3A 3ORZA 4HYSA 4RVKA 1UNGA 3EFWA 5DLSA 3ZO3A 4C3RA 5KHXA 4HGEA 4X3FA 2PK9A 5CEPA 5HO8A 3DS6A 4FA2A 5FTGA 3R0TA 1UWHA 4DHFA 4I6LA 3FLSA 2C4GA 1FMKA 5IA1A 3TIYA 3AMBA 4G34A 5DHJA 4BZOA 5E1SA 2VTRA 4WOVA 2XIYA 5EKNA 2R3MA 2QONA 4FV6A 3FI3A 4MUQA 2OJGA 4O7TA 4YZ9A 5B7VA 5BQ0A 2QO2A 5LJJA 5E8TA 1H07A 1OM1A 1WBPA 4IHPA 4JDIA 4NKAA 3TT0A 2IN6A 3GT8A 3HLLA 3SDJA 4TYGA 3ZBFA 2WMQA 4DFLA 3U9CA 4AZVA 3GENA 2NP8A 3E8DA 3Q6UA 1OKYA 4IDTA 4KBAA 4EHVA 4FSUA 2DWBA 3D52A 3EFJA 5LARA 2VWVA 2WEVA 4EK3A 4TL0A 2J2IB 4AZSA 2VWYA 4QOXA 4C4FA 2X6DA 2P3GX 3L3OM 5CVFA 4FKVA 4RX5A 4AN9A 1DKYA 1PMUA 4DHZA 2JDOA 4A7CA 3I0QA 2B55A 2UZVA 3CKXA 4EK6A 2CGUA 2OO8X 4XS2A 5E1EA 2VTIA 4NIFB 2YM3A 3F3UA 3BWJA 3EZVA 3F6XA 2ZV2A 1LEZA 4IC8A 1ATPE 4ALVA 3M3WA 3BGQA 4AE9A 5EM7A 4G9RA 3FWQA 4M8TA 4HY9A 3RZFA 3A4PA 1UA2A 4JWCA 4G2FA 4WNPA 3DKCA 5FBOA 3CTJA 2YHVA 4FG8A 5LMBA 1LUFA 4GYIA 4MXXA 4QRCA 2JEDA 1Q3DA 3FMLA 2H96A 4QQJA 5EHOA 3HAVA 4O81A 3O7LD 5CEOA 4IM3A 1TZDA 4FV8A 5HLNA 5A54A 2XIKA 3D0EA 3R8PA 2QOFA 3TZMA 3VS4A 5DBXA 2WHBA 3TXOA 4KS7A 3R30A 4U3YA 5JMSA 3DX1A 3TI1A 4EC8A 1FBNA 5CY3A 4GFGA 3WZDA 1QWUA 3A7GA 3OUKA 2W17A 2R3NA 4BI1A 3EQIA 5FLFA 4RMZA 3A8WA 3IPHA 4P90A 4F0IA 1V0OA 4EORA 1OECA 5L8LA 2C6OA 1CSNA 4B8LA 3NGAA 1G8JA 4BDFA 2GPHA 4GT3A 5GZ9A 3PVBA 4RWJA 3ORKA 2B9FA 4O4DA 3NZ0A 3U4WA 3QTZA 4BDCA 4L01A 5IKWA 1JQKA 5EQYA 1XH6A 3FMNA 3LE6A 1R39A 4PV0A 4F7NA 1E1VA 1IEPA 4HYHA 5CU4A 3TTJA 4U8ZA 4O7LA 4XG2A 4OTIA 4Q5EA 4GT4A 3DKGA 3GGFA 3GVUA 4QYEA 2YIBA 4MCVA 4D2RA 3DXNA 4D9UA 3D2EA 3P4KA 4CKRA 4GUEA 4S2ZA 1R3CA 2WPAA 2XCHA 3FY2A 4R6VA 5AR3A 3WF9A 1YI6A 4L44A 2QR7A 4XG6A 5KMNA 3QKKA 3C4WA 4O2ZA 2XAOA 3LJ0A 5A6NA 3PSDA 2HOGA 4ZZNA 1JSVA 2ZB1A 4RIYA 1ZYDA 3D2FA 4DLIA 4AZGA 4M67A 5H8EA 4IMYA 4H6HA 5AR4A 3R9RA 4DT9A 4EZRA 1J1CA 2VWZA 2YABA 3GFWA 2J51A 2XNGA 3HMOA 5C9CA 4MHAA 3D5WA 4QQTA 5DMZA 3HP5A 4HPUE 4HGLA 2UW8A 3VUGA 1TQUA 4UBAA 2F7QA 1P5EA 3OS3A 4QYHA 3CGOA 2XJ0A 3MJ2A 3PZEA 4RPVA 5D9HA 5J95A 1H4LA 3HMNA 3R63A 3FBVA 2JNKA 3T48A 2XIRA 4IVAA 3KFAA 1M2RA 1PW2A 3SW4A 4R77A 5BVOA 4M69A 1SU8A 4AKVA 5HNGA 4E6AA 4UDYX 4QDVA 5M4IA 2F7EE 2XKFA 2V7OA 3BHVA 4G1WA 1W7HA 2X0PA 3HX4A 5JKGA 5C03A 3CEKA 3ZEDA 4DT8A 2VTTA 1BX6A 4AGUA 4EZTA 4EZXA 3CD8A 4YHFA 3DPOA 1BL7A 2PULA 1LP4A 3DY7A 3A7IA 4GT5A 3BI6A 4X3FB 4EK8A 2YDJA 5HORA 3QZHA 1SVEA 3HMIA 1G5SA 3UMXA 2WGJA 2VRXA 3LM5A 3QX4A 2W7XA 4MXOA 1W98A 4O6LA 1LR4A 2GTNA 2NYAA 3E87A 4FT0A 4FTAA 4ZTQA 4O0TA 5K3YA 4EOIA 3IOKA 3MSSA 3A7HA 2Z0VA 1VZOA 1W8CA 3UO4A 4FIGA 4FVQA 3O3NB 2PVLA 4GFMA 1XMMA 2O3PA 3HAJA 3PPJA 1SUFA 2XIZA 2XK4A 3GP0A 5DWRA 2GFCA 1B38A 3MB6A 2A19B 5AUWA 2GMXA 4QNAA 3THBA 3IGOA 5E8XA 4FZ7A 4EBVA 5KNJA 3DX0A 3I01A 3E5AA 4M84A 3E8NA 4BIBA 1P14A 5CENA 1GNTA 3OCTA 3HUCA 5E7RA 2EXMA 3AKJA 3BV2A 3RWQA 1J3HA 5DT4A 3NCZA 2ZDTA 4OT6A 3VJOA 4KAOA 5BYYA 4H58A 5AUZA 3D14A 1YHVA 4KIKA 4GS6A 4JBPA 3QTWA 4RA5A 4BDHA 4F9WA 3OK8A 3MVLA 4BIEA 4IC7A 3ID6C 4EZUA 4YJOA 2I6LA 2RG5A 3PY3A 4JIKA 3KL8A 4OTQA 4WNMA 5DT3A 2B54A 3V6RA 4CV9A 2YKTA 1PJKA 2C0TA 4YURA 2XBAA 4L9IA 3KF4A 4XV1A 3QZIA 4PP9A 4FKSA 2PE1A 2BRMA 2WIPA 2XKCA 3PG1A 5FRIA 2YN8A 1TKIA 4YZBA 3VBYA 4DEGA 3BHTA 3PVUA 2VAGA 3DKFA 4EYMA 2KHOA 3RP9A 1ZAOA 3QD2B 3GU4A 5AAEA 5FLEX 1OGYA 2ITZA 1OL7A 4MWIA 4GK2A 4MBLA 1FQ1B 3L8XA 3T9TA 2OBMA 3KQ7A 4O0YA 3V8WA 4GKHA 3JVSA 4FTIA 3ZXTA 3VJNA 4XRLA 2BIKB 3IDPA 3MFSA 3VBXA 2HZ0A 4CYJA 5ANJA 4WNOA 3NEWA 5DT0A 4ZAUA 2A0CX 4JDHA 4W4XA 3W2CA 5IH4A 4ANNA 3F5GA 4R5GA 4AAYA 4FNYA 4ZTNA 2XRWA 3W0NA 2CGWA 2R3IA 3E92A 3T47A 4A4LA 4HZRA 3UQFA 2Z7LA 3GQLA 3DLZA 4I5HA 1P2AA 1R0EA 4XJ0A 3QUPA 5CI6A 5FDXA 5CXZA 3RAIA 3PJ1A 4HVHA 1QPCA 4MNEA 4CCBA 2EX3B 3R8ZA 3W10A 1BI7A 5D12A 4G3FA 4D55A 2XYUA 1KE5A 4X2KA 3WZKA 2VV9A 3N4VA 4RBLA 3B52X 2ERZE 2BRHA 4DGNA 4OGRA 5IH5A 3QCSA 3U6IA 5GHVA 4EH6A 1GAGA 1Q24A 3IKAA 3ERCC 4FODA 3GCVA 5E8VA 1U54A 2O65A 2PVNA 5KKRB 3QLFA 3F61A 4KIOA 5D1JA 5C4LA 3IDBA 4I6FA 4BC6A 4E8AA 4FRFA 1YI3A 4USDA 4BYIA 2X8EA 3N51A 3E7VA 4RIYB 3IW6A 5FGKA 2QCSA 3AC2A 2YAAA 5F9EA 1PRYA 3BHHA 5K4IA 4EZPA 3D9VA 3FL4A 4IQ6A 3NFGB 3ELJA 4AWIA 5IQCA 3P86A 3CTHA 4EH3A 1KWPA 3FC2A 5JGAA 4TRLA 3JUHA 3LXKA 4YUQA 4LRMA 3TUCA 3F66A 3LCSA 1MP8A 3VS2A 2HY0A 5A4LA 3EB0A 3F88A 3LIJA 2QI8A 3CY2A 4RIXA 4B8MA 3F82A 4FZPA 1R33A 2OIBA 5L2QA 3KEXA 5DR9A 3KCFA 5ANIA 2WMVA 3BUDA 2OG8A 4MH7A 2VTHA 3U8WA 5L8KA 3L9MA 4M69B 4JOAA 1PKDA 2C6IA 3DAEA 4S31A 2H34A 1KE7A 4AA0A 2GS7A 4L3LA 3CIKA 3UVQA 3PY1A 4M14A 2LM0A 3UOLA 4CZYB 3DBCA 2RAKA 4QP2A 4E4XA 4UWBA 3NUSA 4FG7A 1KV2A 1GIIA 3LJ1A 3OBJA 4JX7A 3GOPA 5A4TA 3HV5A 3GBZA 4PP7A 3PFYA 4AAAA 4CMOA 2F7XE 1ERKA 2VWBA 4I4EA 4L45A 3FPQA 5DPVA 4ZY4A 2OJ9A 1OL1A 3K5VA 4FV3A 1ZWWA 2X7OA 2QOBA 3EL7A 4YBKA 4IAFA 1W83A 4LGGA 4QTCA 4BTKA 3MY0A 3V51A 5TF9A 2JDVA 3VUMA 3BIZA 3KXMA 2UW4A 2G01A 4BTJA 3GCQA 4CMUA 4LDTA 3ORIA 2WMWA 3MESA 1SYKA 4OAVB 3DJ7A 1S9JA 3PZHA 3DJ6A 4FV1A 2UV2A 2W4OA 4EK4A 4E5AX 5ETCA 4EOLA 2IZRA 2PVRA 3CSVA 5D41A 4NM5A 5M4FA 5AV2A 4OTPA 5AM6A 4O7WA 4B4LA 4U5JA 4YHTA 4EOMA 1ZOHA 1PMEA 2QLQA 5AP3A 3EH9A 3VRZA 5HEZA 1FGKA 2BDWA 3DZOA 4JL9A 4KIKB 3UOJA 3DBDA 1UKIA 4L3PA 1TQVA 1FVVA 2BZIB 4RJ5A 4D28A 1R5EA 1M17A 4UXLA 1X03A 4FSNA 5KMIA 2ITOA 4H3QA 1PYXA 2W0JA 3H3CA 2VWIA 4L42A 3R8UA 4AA4A 3NUAA 2B0QA 3TL8A 4GK3A 3IO7A 3DU8A 3DX2A 5HZNA 3VS3A 2O64A 2UZTA 2YACA 4IAZA 4E6CA 3OBGA 2GNIA 2W1GA 3GU5A 3MA3A 4JQ7A 2WFYA 2CNUA 3PPZA 3Q32A 3V8TA 3G0EA 3BGZA 4EH5A 3QYWA 1ZYSA 4FTUA 1URUA 2A98A 2E2BA 1TQMA 4YGAA 5EOLA 3VHKA 4TWCA 5KHWA 4YTFA 4NU1A 4D9TA 4G3GA 5EH0A 1UVRA 2WELA 3RHXA 1OBDA 4XG9A 4GG7A 4FIEA 4TWPA 4ASXA 2ITWA 1XBAA 4DH3A 4ZZOA 5LMAA 4EHZA 3PSCA 3FZOA 4BGQA 2OJJA 3JVRA 4O7NA 4PDYA 2X6EA 4BGHA 3QHWA 2NNWB 4FIFA 4H39A 4LOPA 4ID7A 5AADA 3Q4UA 5HNBA 4EZQA 2ITVA 2VTOA 4GL9A 5I3RA 3HYHA 3LPBA 5AUVA 4MNEB 3R8MA 3PUFC 1ZYCA 4RVLA 2DQ7X 5HO6A 4E6DA 1ZWSA 4EOKA 2W5AA 1BL6A 2VTAA 3DNDA 2LXYA 2XJ1A 4NJDA 5E8ZA 3V5LA 3QWJA 4AN2A 3L9NA 1GIJA 4AZCA 1YI4A 2EVAA 2YAKA 1U54B 3RI1A 4BCNA 5K5NA 4IADA 1CM8A 2OW6A 3W0MA 2I0EA 2GA9D 2F1BA 1BYGA 2EU9A 3EN9A 4K2RA 1J7LA 4GW8A 4MD8E 3UZTA 2I7QA 3KC3A 1M14A 5EHYA 3S3IA 3KRRA 3M2WA 3KMWA 4X3FC 4YO4A 2R3GA 3IOPA 4ACHA 5HOAA 3Q2MA 3F9NA 1PMVA 4AFEA 2BKKA 2E9NA 2VD5A 3QQHA 2IZSA 2XNBA 4GH2A 4YJTA 4BYJA 1GN9A 1PS3A 2OW3A 2BPMA 2DUVA 5L2IA 5IA5A 3UNZA 4R5KA 4FG9A 3HRCA 5AP4A 1WBTA 2UW9A 3FI4A 2OXYA 4RIXB 3BYMA 3D7ZA 2AC3A 3TDVA 5F1ZA 3UOKA 3EQHA 5H8BA 5EQEA 3ZZEA 4BR3A 4HVIA 1XO2B 2GQGA 5M55A 2C5VA 3I5NA 4C58A 3U6JA 5IQGA 1Y8GA 2C6MA 4GU9A 4M3QA 3ZC6A 4CFVA 4FEUA 1YDSE 2ZV8A 2ZV7A 3QTXA 2NRUA 2WMBA 4FC0A 4PTCA 4RFZA 2ZFYA 3W0SA 4FKPA 3LAUA 3ZLWA 4JAJA 3NS9A 5A3XA 1XH5A 2PUIA 2PMRA 3AG9A 4HGSA 1V0PA 3ZUTA 5IEVA 4F9CA 4UMTA 2OZNB 4R78A 2YZLA 4HYIA 1Q99A 1QL6A 4BKYA 4YMJA 2P2IA 2PZPA 3ENMA 4MK0A 4CRLA 4G16A 3VUDA 1H26A 4FKOA 1L3RE 2F57A 3OROA 2ETMA 4I92A 4DEDA 4EEVA 5CANA 5C8NA 3B8QA 5CU0A 5JH6A 5C4KA 5K4JA 3NLBA 2PZYA 4OTDA 3QZFA 4IB1A 1YWVA 4WD5A 3VNTA 4ACCA 1DAWA 4WG4A 4IWDA 2IVUA 3DBEA 2P0CA 4C4GA 4XNEA 2WB8A 5HIBA 3HDMA 3D15A 2ITNA 3DAJA 1U00A 3BX5A 4L67A 5JT2A 3DAKA 1DM2A 2HIWA 3PE2A 5JGDA 1ZXEA 4JNFA 4IJ9A 4RX9A 4ITIA 3R8LA 5HE3A 4HR1A 2XNEA 4DYLA 2GNLA 3QRJA 2B1PA 4BVUA 3B2WA 1TVOA 3LZBA 2UZDA 3AMAA 3CP9A 4II5A 4YTIA 4E7WA 3PXYA 3P5KA 4U80A 3D51A 4JNEA 4FMQA