1ZYLA

Crystal structure of hypothetical protein yihe from escherichia coli
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
325
structure length
325
Chain Sequence
SAFTFQTLHPDTIMDALFEHGIRVDSGLTPLNSYENRVYQFQDEDRRRFVVKFYRPERWTADQILEEHQFALQLVNDEVPVAAPVAFNGQTLLNHQGFYFAVFPSVGGRQFEADNIDQMEAVGRYLGRMHQTGRKQLFIHRPTIGLNEYLIEPRKLFEDATLIPSGLKAAFLKATDELIAAVTAHWREDFTVLRLHGDCHAGNILWRDGPMFVDLDDARNGPAVQDLWMLLNGDKAEQRMQLETIIEAYEEFSEFDTAEIGLIEPLRAMRLVYYLAWLMRRWADPAFPKNFPWLTGEDYWLRQTATFIEQAKVLQEPPLQLTPMY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein yihE
publication title Crystal structure of a novel prokaryotic Ser/Thr kinase and its implication in the Cpx stress response pathway.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
total genus 93
structure length 325
sequence length 325
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01636 APH Phosphotransferase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1zylA02
1.20.1270.170 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 1zylA03
3.30.200.70 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1zylA01
4PX6A 4PP9A 5HBEA 5C27A 3JUHA 3SQQA 2GHLA 2G01A 3R02A 1ZOHA 1Q62A 1F3MC 3GP0A 4CYIA 5CEPA 5CT7A 3HMOA 3QQHA 4AA0A 1IASA 2BILB 4FKOA 3OMVA 4NIFA 5TO8A 4CZUA 3IW8A 4E73A 5HX6A 5ICPA 2O2UA 4U42A 4D9UA 3U6JA 4ANBA 4QNAA 2WGJA 4FICA 2QLUA 4ALUA 3BE2A 4FK3A 4KS8A 5AX9A 3R7YA 5E8TA 3QZFA 1XO2B 3GBZA 3UIXA 1WBNA 3KN5A 3MPMA 4RJ4A 4X2GA 4QQJA 5E90A 4YBJA 2XNEA 1JWHA 3DAJA 2HYYA 2UZBA 2JAVA 3BEAA 5FEQA 3Q3BA 4Z9LA 1FMOE 3KULB 3KKVA 4ZSLA 5FEDA 2XRUA 4CCUA 3E3PA 5AIRA 5JGDA 1QCFA 4XCUA 5CVGA 1L3RE 5F95A 1Q61A 1GAGA 2PE0A 3LQ5A 4IVCA 4FI1A 3FKLA 1OPKA 3UMWA 1ZYLA 3EB0A 3GC7A 1ZZ2A 3HV4A 1YWRA 4RC4A 1PKGA 3KB7A 5CEMA 1BI7A 2OIDA 2VWVA 5JFWA 4G1WA 5A14A 3QFVA 4AOJA 4BTMA 1MRVA 4G17A 2PY3A 3CY2A 3QC4A 3E8DA 2VTHA 4MXYA 3BCEA 5L8LA 4FKWA 5DT0A 5LQFA 4O0YA 4IM2A 4YHJA 5BYZA 3WF5A 3EQDA 2UVYA 3LXNA 4M3QA 3TG1A 3CD8A 4BHNA 4FV9A 4D5KA 4AN2A 3LZBA 3QWKA 2ITUA 2R3JA 3BZ3A 3BYVA 3HKOA 4FNXA 4KB8A 2E9OA 4PPAA 4XV9A 4ZZNA 4AW1A 3R9HA 3GCPA 1WMKA 4FSYA 4DFZE 3BLQA 3TUDA 4JDHA 3BHTA 4JBQA 1QPJA 3Q6UA 3DK7A 3IDBA 3HRCA 4IE9A 3KXMA 2XEYA 5J7BA 5FTQA 3O23A 3Q2MA 3RM7A 2ONLA 2VTTA 5IG1A 2VTQA 4DFYA 2R3GA 4AN3A 2WMSA 3TL8A 5IEVA 3IPHA 4FV6A 1H28A 3A4PA 2OIQA 2W1DA 2R3MA 4QMLA 3EQHA 4IEBA 2I40A 3PG1A 2CGXA 2JKKA 3PA3A 4U44A 5CY3A 1Q8UA 4CQGA 5C03A 5LMKC 4O0WA 1OL1A 4AZSA 3EH9A 2ITNA 3SAYA 3BI6A 1W98A 2ZMDA 4FSWA 4JS8A 4MWHA 5LCKA 2OH0E 3EOCA 4G3GA 3WZDA 1UU3A 1OGUA 2YDIA 3ZO4A 2W9ZB 4B9DA 1OKWA 2CHLA 2OU7A 3OC1A 3FQEA 1WCCA 4BHZA 2PSQA 5E8ZA 2BRGA 2VGPA 3L9MA 4ZTSA 4Z3VA 3R71A 1OL2A 3BYMA 3D5UA 1PMEA 3G9NA 2OICA 4WHZA 4XG6A 5KHWA 4II5A 5AUYA 1BLXA 4AOIA 4BBFA 3R8UA 4RX9A 2ITYA 1UU8A 3BBTB 3LFQA 5EHYA 4CD0A 4RLLA 3N9XA 4C8BA 4Y85A 3PZEA 4L42A 5DN3A 2QU5A 4NKSA 2R3QA 4A4XA 4U3ZA 3WARA 4HW7A 4O2ZA 2WXVA 5M56A 3IQ7A 1PXIA 4OBPA 1KE6A 3MY1A 3H30A 4IACA 4PPBA 4YNEA 4Q5EA 1FVRA 4A4OA 1OL5A 2WMWA 3ACKA 4YGAA 3FZSA 3V01A 4FIEA 3FI4A 4QMMA 2IN6A 3KU2A 4GUBA 3UPZA 1WAKA 2HAKA 2QONA 3ACJA 1H4LA 3G0FA 4MBIA 5CZHA 2Z8CA 2XYNA 5GJGA 1OIUA 2VNYA 5HVYA 1OPJA 4DEHA 3R83A 4Y73A 4TL0A 5C8KA 4HGEA 5HU3A 4G16A 3E3BX 2HZNA 3POOA 4JQ7A 3V6SA 4RJ5A 3FC2A 4EWHA 5HIBA 1OVEA 2F49A 2WO6A 4HGTA 1Q24A 2QKRA 4AW0A 2PVRA 1YRPA 5AR2A 3OBGA 3QCXA 4U6RA 2J5EA 2XF0A 4IFCA 2H96A 3ZZEA 2EUFB 3IKAA 4LOQA 2XNNA 4AT5A 4EHZA 2O3PA 4FKRA 4HYUA 4UMUA 4TYJA 2Z7SA 2A19B 2QODA 3MVLA 2A27A 5CSVA 2PUUA 3D9VA 2J4ZA 3PSCA 5CQUA 4YZCA 5LJJA 4F1OA 3R2YA 1PW2A 3LCSA 4FYOA 4KD1A 5LOHA 3LM5A 4EK5A 4ALWA 5FXQA 3DBQA 2WD1A 4WNMA 1V0OA 3A7HA 3THBA 3SRVA 5T6KA 3E92A 3QLFA 4XBRA 2XM9A 4M69B 2G9XA 5HE2A 4RJ3A 4M13A 3D4QA 5IA5A 5DT3A 4BBMA 1OIYA 4J1RA 4QMVA 3W2OA 3DY7A 3LCDA 3LJ0A 4HGSA 2X4ZA 4K9YA 4QYHA 3SXFA 4AS0A 4W4WA 4LL0A 4EOQA 4NEUA 1P14A 4QT1A 4FNZA 3VQHA 3EIDA 3HV5A 4AZTA 5J5SA 4FV8A 1U5QA 2JKMA 3NNUA 2QOIA 4KNBA 4QP7A 5CU3A 5K5XA 2C0OA 3FZ1A 4ZLYA 4EBWA 4M68A 1XWSA 4HCTA 4I94A 4GFMA 4OLIA 3QAME 4U45A 3F88A 1H1QA 3C0HA 2OFVA 3QALE 2XJ2A 3CTJA 4M97A 4E5WA 2SRCA 1V0PA 4W4YA 5BUJA 4ZSEA 4FKJA 4ACGA 4KBKA 4RQKA 3GCQA 3ZEWA 3QX2A 3I5ZA 4AZEA 1DAYA 4CT1A 3NCGA 5DE2A 3QYZA 3RK9A 4LG4A 1NVQA 4BC6A 3ZHPC 4DYMA 5ANOA 5TOZA 3VO3A 3EKKA 4AX8A 3BV2A 2YDKA 2P0CA 3IGGA 1F5QA 1U59A 1BL7A 5E7RA 4D4VA 2C5NA 2NRYA 3QTZA 4MQ1A 4MX9A 3CJFA 4J99A 4IZYA 5CNOA 1O6KA 4GYGA 5D7AA 2WEVA 3RGFA 4BFMA 2HK5A 2BHEA 5GJDA 3HRFA 1PXMA 3QGYA 2CN5A 3WIGA 3F82A 2HY81 1H1PA 2Y6OA 3R8ZA 3BU3A 5F1ZA 2YM8A 1M14A 2OF2A 5HE0A 4XRLA 3NW7A 3QGWA 4PDSA 5AP0A 5AV0A 1PXOA 2C1AA 4D4RA 3U8WA 4XLIA 5KMMA 4V05A 4NM5A 4EOKA 2XNMA 5D10A 4FSUA 4F9WA 2B9HA 1XH8A 3ORXA 1XR1A 2VTAA 2OKRA 2R3PA 3ZRLA 4APCA 4EH2A 5BNJA 3HUCA 2B4SB 2QQ7A 3RK7A 4S2ZA 2VTPA 4TWNA 3P78A 4ERWA 2C5YA 4FT0A 5CF5A 3ORPA 4W8EA 2GNFA 4A9TA 4C2VA 4DG0E 1WZYA 4JLCA 2O0UA 3HA8A 3PY0A 5AUZA 4IB5A 3BYUA 3KXNA 1YOMA 4FZDB 3OXZA 4L46A 5CU0A 3K5UA 3MFRA 2GMXA 2R3NA 2W99B 5F9EA 3UOHA 3PP1A 3DJ6A 4X3JA 3WE8A 4BDDA 1ZYSA 1MQ4A 5AWMA 3KMWA 4IAZA 1GZOA 4USDA 4BZNA 3FKNA 2WMBA 4XJ0A 3VWAA 3DU8A 4RGJA 4TWOA 4FT3A 4IX6A 3UG2A 2XCHA 4BDJA 2V0DA 2C4GA 2WTJA 2GNIA 1B38A 4X3FB 3QCYA 5EH0A 4I0SA 4G5JA 5CI7A 2XS0A 1FPUA 5FG8A 1KOBA 2XRWA 2OBJA 3MWUA 4HPTE 3I1AA 3FMNA 3FY0A 2VTSA 1R1WA 3BQRA 2WTKB 4G34A 3MN3A 3ZCLA 2J7TA 1CKJA 5AM7A 5ETIA 4BDEA 4C3PA 3MDYA 2NO3A 4F7SA 3H10A 5FGKA 3QQFA 3NEWA 2XZSA 3IOKA 3W33A 2WIHA 3RBWA 4F08A 2VWZA 3Q32A 3R6XA 2VWXA 2P4IA 2BVAA 3FUPA 1CKPA 1IA8A 3OT3A 4RWLA 4WBOA 2PVYA 4W8DA 1JAMA 4UYAA 1JVPP 3CY3A 3FYKX 1AD5A 4MH7A 3PE2A 2PMNX 4PRJA 2AUHA 2UZLA 2BRMA 5EOBA 2BDFA 2CGVA 2GNLA 2GTNA 3DT1A 4IC7A 3VNTA 4QD6A 4QOXA 4AN9A 3PXZA 5KMJA 4KS7A 3OTUA 2O8YA 3MY0A 4L8MA 3NUPA 1W82A 4CFFA 1I44A 4M12A 3KXGA 4FV7A 3RAKA 5CNNA 4JR3A 1OL7A 3OOMA 3T8OA 3ORNA 5AP1A 4F7JA 3C51A 3ITZA 2JAMA 4BI0A 4ZS0A 2YJRA 1MQBA 4X2FA 4RIOA 2FYSA 2J5FA 4RA5A 1LEZA 1DM2A 3F3WA 2VAGA 4QNYA 4XUFA 4QMXA 1WBPA 3OD6X 3OG7A 3TV6A 1BX6A 3RM6A 3A99A 3GB2A 3O96A 4G9CA 3A8XA 3DCVA 3BU5A 3DQXA 4EH6A 4BIBA 2ITOA 2QURA 2BZIB 5IA1A 3HMMA 4WG4A 2HWOA 3BBWA 2VU3A 3V8SA 2EB2A 4EBVA 3F5PA 2C3LA 2WMRA 2UZNA 4PNIA 5CSHA 4USFA 4QQ5A 1M2QA 3TJDA 4DHFA 4EUUA 2EB3A 1H1WA 3FPMA 2R64A 5KKRB 2XK3A 1XJDA 5HIDA 4EKLA 4JX7A 3FE3A 5E1SA 3U9NA 3ZUUA 3AT2A 3UOJA 1Z5MA 3TNPC 3WYYA 2UW6A 2QOLA 1OKVA 5AAEA 2UW0A 2W0JA 1U54A 3RZFA 5HORA 2X8DA 5K4IA 3ROYA 3FC1X 3CTQA 4YHTA 2Y0AA 2VWIA 3TZMA 4I0RA 2WFYA 3QU0A 5A4TA 4IWOA 3CIKA 4RWJA 3DXNA 3G9LX 2EXCX 4XOYA 2F9GA 5H9BA 2BUJA 2HELA 3R7VA 3EFLA 4D2WA 4H3PA 5AR4A 2C3KA 4BGQA 1J3HA 5FEEA 4HVHA 1G3NA 4XMOA 4FTLA 5CANA 2R3HA 4ZY5A 2W4KA 4NWMA 5HEZA 5J9YA 3PIZA 3E93A 4JR7A 3ORIA 3O51A 3AGLA 3U9CA 2QOKA 3OBJA 4TN6A 3SOAA 2YLEA 1NY3A 2C6DA 5CT0A 1MP8A 2XK9A 4N6ZA 5KBRA 3GGFA 3R8LA 3GCUA 3E87A 3KRLA 4LUDA 2B54A 3FSFA 3DQWA 4XP3A 5I9XA 4R3CA 4FTIA 3ZLWA 3NW6A 3ZOSA 4TNBA 3E62A 1APME 4IB1A 3LXKA 4PL5A 5IH6A 2RFEA 3QKKA 5LVOA 3ZUTA 2FSOX 1ZZLA 4F0FA 1UNLA 1RDQE 3F69A 2YCRA 3OEFX 2W5BA 4H3QA 4ITJA 4JT3A 4O21A 4WNPA 5J87A 4YPDA 3SC1A 4CMTA 5LMBA 4BCOA 3MTLA 3ZXZA 1TQMA 5JZNA 5LVMA 4IAIA 4OW8A 5AV1A 4Y72A 3DBFA 2QOQA 3EHAA 5ETAA 5KZ0A 5I0BA 1U46A 2VO7A 4BZDA 1M2PA 5KMIA 2JDRA 2VWYA 3HDMA 5AP2A 3RINA 4AG8A 4KIKB 1VJYA 4M14A 1UVRA 1ZRZA 4ANOA 1Q5KA 4Y8DA 2X7GA 5JRQA 1XHAA 4MXXA 1GY3A 4O22A 4FV0A 2GTMA 3JY9A 4EKKA 1URCA 3COKA 4OBOA 1OI9A 3LMGA 2F2UA 3FXZA 4X3FC 4D1XA 2BALA 4MD8E 4F6WA 3UQFA 4CYJA 3JXWA 4JBPA 2RL5A 4XOZA 5DGZA 3ZYAA 3NPCA 4R7HA 3ZXTA 1J91A 1Y6BA 3GC0A 2G2IA 1JKTA 2O63A 4G3DA 3VUMA 2DS1A 2WHBA 2CLQA 2UZEA 2V62A 2VWBA 2W06A 2YIRA 3P4KA 3P08A 5G1XA 4N70A 4C4EA 4CFXA 5M44A 4FIIA 1XQZA 3WIKA 4D1ZA 3CTHA 2RFSA 2HXLA 4BDHA 5J8IA 2GS6A 3B8RA 3UP2A 2JDTA 5H3QA 4FR4A 3PY1A 1R0EA 4BWKA 4EH3A 2CN8A 1Y8GA 5TR6A 3FI2A 1H07A 3VRYA 4D2TA 3ERKA 3E7VA 3DBDA 2FGIA 4IX3A 4TY1A 4O96A 5A9UA 2J2IB 3AT4A 3UOKA 4Y5QA 4OAVB 4FG9A 4LOPA 1UNGA 4F9YA 4GCJA 3GCVA 4I21A 2W4JA 2WAJA 4Y95A 3MH0A 3RNYA 3R21A 4FSZA 4A9SA 1JSTA 2BZJA 2JGZA 4KKHA 4LV8A 4FIHA 4MNFA 4ANSA 5I3OA 1PXJA 4DH7A 2WU6A 2X8IA 3KXZA 3PIYA 4O6EA 3R63A 4CNHA 4I6FA 4TW9A 2BTSA 4YJNA 3F3VA 4FKTA 3ROCA 5BVEA 3R01A 3EWHA 2JIIA 3BEGA 5AJQA 1H24A 4OUCA 1DAWA 2E9UA 3SLSA 2XK6A 3V5QA 3QUPA 5EYDA 4CRSA 3BGZA 2QOFA 1OIQA 3WBLA 2OF4A 3BE9A 2IVTA 4ACDA 4IW0A 5E8SA 3IDPA 4O1OA 3MBLA 2JKOA 3H0YA 4RBLA 2WB8A 3DZOA 4I0TA 5DT4A 3ZLSA 3EQIA 4UALA 2ZJWA 4RIYB 3ORZA 1K9AA 4XHKB 4L52A 4FTRA 2UZTA 4BI2A 3S3IA 2GPHA 4TWCA 4D2VA 2C5VA 5IMXA 3TUCA 4D4YA 3CE3A 4AXAA 2RFNA 1OPLA 4MTAA 1URWA 1HCKA 4RWIA 1ZLTA 4PUZA 5A4EA 1VR2A 3I81A 2WOUA 3P7AA 3CKWA 4LRMA 3UBDA 4V0GB 4YSMA 1Q99A 1OKYA 3D15A 2VTOA 5EFQA 5J79A 4WNOA 5KKRC 4EH8A 5JQ5A 3HMPA 5K3YA 3VF8A 3RPVA 4ZJVA 3QCQA 1XBBA 5AA9A 1SVGA 1ZARA 3QRJA 4NIFB 1VZOA 1XBCA 2Y8OA 3GC8A 4K77A 4RRVA 2UW3A 1SNXA 3B2WA 3A7GA 4BCGA 4EH7A 4HVDA 3AD5A 4CLJA 3PE1A 3P9JA 3R7UA 4WOVA 3TEIA 2XYUA 5HIEA 5DFPA 2YISA 4L67A 4NU1A 3AD4A 2G15A 1ZAOA 3F9NA 2OO8X 4DH3A 3IK3A 1Y6AA 3TZ9A 4I5MA 1YHVA 4JVGA 4C38A 5E8YA 4RFYA 3FL5A 3PWDA 5BX0A 4B99A 3VUTA 2VX0A 4QTEA 2G2FA 3UOLA 2F57A 4GMYA 5AV4A 2P2IA 3DNEA 1WBWA 2FVDA 1GZ8A 3R0TA 3VUDA 4BCJA 4W4VA 1OUYA 1PMVA 4X6QC 3WF6A 3ZSHA 5FP5A 2Z7LA 2BTRA 4BYIA 5JGAA 4GS6A 2W7XA 5AUVA 3IO7A 2OH4A 1CM8A 4NM3A 4FTTA 4RZVA 1IR3A 3AC4A 2VX1A 4TYHA 5IDNA 1STCE 5K0XA 4EONA 2AC5A 3DBEA 3QLGA 4U7ZA 5JGBA 5CEKA 4E3CA 5C1QB 4E93A 2C3JA 3E63A 2ACXA 2PWLA 3U51A 4U80A 4DFLA 3EYHA 2UZDA 4ACCA 4EZ5A 3L8VA 4FODA 3ZLXA 2C6TA 4MQ2A 2C1BA 4GIHA 3FQHA 3RPOA 2C0IA 3KXHA 3AGMA 4C58A 4FKVA 3VS6A 4E4MA 4PMSA 3OY1A 4FZFB 3WZJA 2OJFE 3KRRA 2H34A 3RWPA 2P33A 2Y4IC 4AA5A 3PPKA 4XG8A 3R2BA 5IUIA 2AYPA 5IKWA 3TNHA 4FK6A 4BCHA 3CLYA 3Q4CA 3RWQA 4G3EA 1PHKA 4ENXA 1QPDA 4U9AA 5HD7A 2BFYA 4C4HA 5CI6A 5LXMA 2A1AB 4Y83A 3LJ1A 3EN7A 2LGCA 3P7CA 4CFVA 3L8SA 3W2CA 2J51A 4CV9A 3UE4A 5HVJA 5EI2A 2GHGA 3IW5A 4C0TA 3AC5A 5KBQA 4C02A 2R7IA 3K2LA 2PVHA 2DWBA 2F7ZE 2ZDUA 4LFIA 1K2PA 4A9UA 5EDQA 3UVQA 5M57A 4O38A 3EFJA 4X2NA 4Q2AA 1H25A 3I7BA 4KKEA 4R7IA 2BZHB 1REKA 2C5XA 4L53A 4J95A 2DUVA 1O9UA 4G6LA 4D4SA 4QPSA 4EUTA 2E9PA 4OAUC 3DGKA 4RPVA 3U6HA 4MAOA 3DOGA 3C4ZA 3R00A 3DTCA 4J97A 5GNKA 2QHNA 3NCZA 4UB7A 4ZTNA 4JIKA 3NR9A 3FMMA 4NCTA 4YJTA 3UNKA 4FUXA 4OBQA 3R7OA 5D1JA 4NTTA 5LARA 4AZWA 2C68A 4DFNA 1XH7A 2E9VA 1ZYJA 3C9WA 5BVFA 2ITZA 3GCSA 4WO5A 1T45A 4GIIA 4YR8A 5KUPA 1H1SA 2GFCA 3WF9A 4H58A 4JRVA 5C8NA 4XX9A 3RK5A 5FQDC 4RFZA 2BKZA 4J8MA 4BN1A 4CT2A 3KF4A 2R4BA 2PZRA 3KXXA 3MSSA 4I20A 5IF1A 2QCSA 3PVGA 4UMTA 3W10A 1ZYDA 3R1YA 5A3XA 1QMZA 2OJJA 2VRXA 3LOKA 4L9IA 4QYGA 1OMWA 4XV3A 4EEVA 3G6GA 4AGUA 4BKJA 2QVSE 1YXUA 2GCDA 5EW3A 2HIWA 4U41A 3D83A 2WMTA 4OTHA 4BRXA 2R7BA 4AGWA 3KL8A 5CAVA 1XH4A 2G1TA 3FLQA 5BVOA 3IONA 3VBQA 3CC6A 2ZV9A 3RHKA 5HU9A 2O5KA 3ENHA 5EM7A 1LP4A 5FRIA 4TWPA 1M52A 2R3KA 1Q8YA 5CU6A 1YOJA 2JLDA 5J9ZA 3RAIA 5JN2A 3SVVA 2B52A 1ATPE 4MXOA 4XYFA 3ZFYA 4QMQA 3BU6A 3EN6A 4RQVA 4TYIA 4I24A 4HCUA 4B6LA 2KULA 2C6KA 4JDKA 5HBHA 1A9UA 3VULA 4GT3A 3RALA 4D0XA 4NM7A 3W2SA 3SXSA 2VD5A 4CZTA 5ACBC 3ANQA 5CQWA 3HRBA 2Y4PA 4I92A 2OZOA 3NUNA 3UP7A 5IZFA 1YQJA 4FTUA 4ZSGA 3KRWA 4CMOA 4C37A 2QO7A 4RJ8A 3GVUA 1CKIA 4NT4A 3EL8A 4B7TA 4D0WA 5DIAA 3Q9ZA 2W1FA 3HUBA 4DEDA 4UWCA 5A4LA 5L8KA 5EKOA 2QU6A 5B7VA 5J95A 3EQRA 4BICA 4IDVA 2XVDA 3F5XA 4FZ7A 4GU9A 4C3FA 1UNHA 3W8LA 4ZTLA 5HG7A 4UXQA 4RIXA 1F0QA 3I6UA 5L2SA 5HZNA 1MRUA 5IA3A 4QTAA 3VJOA 3FQSA 4M66A 4X7QA 4F1TA 4I1ZA 2OFUA 4AQCA 1CDKA 5KHXA 4FIJA 4L3LA 1JNKA 3BLRA 4QTCA 1PY5A 1SVHA 1YDTE 4QP3A 1X8BA 3Q9YA 2WQMA 4OTPA 5GZ8A 4JDJA 5EDPA 4RA4A 3WZUA 4XBUA 4Z7GA 2X7FA 2JIUA 1JLUE 2YA9A 3QZHA 1QL6A 3EN9A 4I4FA 1KE9A 3D7TB 3DDQA 2XB7A 2Q0BA 2XEZA 4NM0A 5E8VA 1H0VA 3AG9A 4XEYA 3MIYA 5FM3A 2R3IA 3QCSA 3VRZA 3K3IA 4EOMA 3VBVA 3KFAA 2BAKA 2ZM3A 4BKZA 3KRJA 4RFMA 4UX9A 5FDXA 3VUIA 2XNPA 2YIWA 3O2MA 3OT8A 4QRCA 2YFXA 5AM6A 4DGNA 2PE1A 2ZOQA 3QTQA 4U3YA 4F70A 4PP7A 4PPCA 4QMYA 2ONLC 4OT5A 4QMWA 4D5HA 4EZ7A 4JOAA 1IEPA 4BDKA 4IC8A 2C6IA 3NWWA 5GHVA 2IO6A 4FSQA 3WE4A 4CZYB 2OGVA 4HCVA 4WIHA 5AR3A 2WNTA 3C4FA 5D7VA 3O7LB 3G90X 1YWNA 3IW6A 3R7IA 4F6SA 3KEXA 2YIQA 5F4NA 3LW0A 1VYZA 3SOCA 3W18A 2VGOA 2CKEA 1UKIA 2HXQA 4C2WA 2WMAA 4NZWB 3RHXA 2XK8A 2JDSA 2UZOA 4FTKA 2PZPA 3BHUA 1HCLA 4YC6A 1RJBA 4F7LA 2UW4A 5ITAA 4GT4A 3TI1A 4NFNA 1IG1A 3FI3A 4DTKA 2I6LA 3E8CA 3HMNA 3OZ6A 3KN6A 1Y8YA 3MH1A 2J6MA 3RKBA 4QP4A 5DOSA 4AGDA 1P4FA 3E8EA 4E20A 3PUPA 4DLJA 3Q4UA 3NYNA 3NNVA 4DC2A 4OTQA 4J96A 4BYJA 5J5TA 3DAEA 3SKCA 4U79A 4R6VA 3P5KA 4O27B 3ZO2A 3Q5ZA 3KCFA 4MK0A 3RMFA 1ZMWA 3HMIA 3OFMA 3RAWA 3T9TA 3FY2A 4PF4A 4FKIA 5LVLA 3L8PA 1RW8A 4GG7A 4NKAA 3I60A 2W5HA 5IH5A 1JQHA 3F5GA 3VS1A 2JEDA 3C4EA 4ASEA 1YDSE 2W5AA 2ZMCA 3VBWA 4D55A 4FTOA 3VVHA 5ANEA 4BCKA 4NSTA 3G5DA 4JRNA 4YJPA 2NPQA 4QP1A 5HE3A 4F7NA 4WT6A 3AC8A 3AXWA 3OCBA 4H1JA 4ZZOA 5AEPA 5KCVA 3PRIA 4BWXA 1BI8A 4YJRA 4IQ6A 1UWHA 4IZ5A 3RI1A 1ZMVA 3NDMA 3A60A 3MI9A 3ZC5A 4D1SA 4EOJA 3OCTA 1XH6A 3AD6A 2UVZA 2WQOA 4F0GA 3U4WA 4IWPA 4PMTA 2BDWA 1JSVA 3REPA 3ZONA 4QMTA 3PJCA 3DBCA 2GNJA 4P2KA 3FJQE 3UQCA 5DVRA 2YHVA 5TT7A 2OJGA 1PXPA 3R04A 2IW8A 3C0GA 2OIBA 1BL6A 3COIA 4FG8A 5EOLA 5AP5A 3L9NA 4F6UA 2XBAA 4AP7A 1Z9XA 3ULIA 4ZP5A 1Y57A 2J50A 4DH1A 4BTJA 3QTXA 2CLXA 2IJMA 4JQ8A 2QO2A 1PKDA 5HQ0A 5FXSA 1GNGA 3FHRA 4I3ZA 4AT3A 3OCGA 4NJDA 4YJUA 4JX3A 3T3UA 5CWZA 3BHVA 4FNWA 3D2KA 5AR8A 3F6XA 2IZTA 3QL8A 4FTCA 3LE6A 4N0SA 3V5PA 4EOOA 4F9AA 4X2KA 2YCQA 4YPSA 3CBLA 3MB7A 3OEZA 1T46A 3I7CA 3MVMA 3OROA 5EDRA 5KZIA 3EQCA 1YVJA 3UIMA 3A7JA 4R3RA 4DITA 3RPSA 2X0GA 5FLFA 3MJ1A 5M55A 2IZSA 5JFXA 3CQEA 5I3RA 3VBYA 4CQEA 4PTGA 4C4IA 3U4UA 4FTQA 3S2PA 2QO9A 3PWYA 3QD2B 4MF1A 4I6HA 4FTNA 2Z60A 5L2IA 5DEYA 3C50A 4YO6A 4YU2A 2H6DA 5FTOA 3FDNA 2E9NA 1OB3A 2XIKA 5CXHA 3F61A 1JKLA 2O65A 3EJ1A 2OSCA 1ZMUA 2PVJA 4KABA 4XNEA 3ORKA 2J90A 4TKSA 4UMQA 3ZO1A 3HP5A 3QYWA 4J53A 2OI4X 3RAHA 2VUWA 3ZLYA 4XRJA 3RCDA 2ETMA 5HGIA 2J0LA 5GZ9A 4YSJA 4C4GA 5AUTA 1H0WA 2QR8A 4BGGA 4TXCA 1WVWA 4I5HA 3Q96A 4AA4A 4PMMA 5JFSA 2CPKE 4IB0A 3COHA 2WTWA 4LRKA 5LVNA 4RVTA 4WSYA 5DI1A 5E92A 5CAUA 4GSBA 2QC6A 1W7HA 3UIUA 4O6LA 3UYSA 3CPBA 5L6WL 4EH9A 4F4PA 1G5SA 3MTFA 4B4LA 4FL1A 4ARKA 2UZWE 3Q4ZA 4UXLA 2QOBA 3MH2A 5FWKK 1O6LA 2BRNA 5C9CA 1H01A 4GFOA 4EK8A 2WMQA 2HENA 3C4WA 3TKUA 2XCKA 4MBLA 1B6CB 2PMIA 4YMJA 4FNYA 2XNGA 4EYMA 3R1QA 4FSMA 5BMSA 2GNHA 4FTAA 5L8JA 2J0MB 3HX4A 3HP2A 4MD9E 5JZJA 3RVGA 3QKMA 4OT6A 3TZ7A 1GIIA 2F7XE 3MVJA 1MUOA 5BPYA 3H9RA 1KV1A 5CSXA 3A2CA 3LFBA 3ZO3A 4C33A 4V01A 3MPTA 3OOGA 4F99A 1ZYCA 3F7ZA 4ERKA 5CAQA 4RX7A 1PYXA 1J1CA 5L2TA 3QX4A 4L3PA 3S0OA 1YDRE 2G2HA 3R1SA 2QR7A 2J9MA 4IAAA 4Q9SA 3KQ7A 3LFAA 3VHEA 3VS5A 3VUGA 4BDGA 5AP3A 3U6IA 4QMPA 3BRBA 2V7OA 3MA3A 4FKUA 4PWNA 4XP2A 3MYGA 3QHWA 5CU4A 3VS7A 4CRLA 5A4CA 2C6EA 4HGLA 1YI4A 3DV3A 2R3RA 4TNDA 1H27A 3F66A 4DFXE 3R8VA 5IPJA 2R5TA 4IX5A 4CFUA 5AP6A 2FUMA 4IX4A 3FMJA 3DK3A 5ANIA 4WNKA 3HV3A 3ZDIA 4WKQA 4DEIA 4X3FA 4QQCA 4XG3A 3FMKA 3KK9A 3LJ2A 3FLSA 4FT5A 4JJRA 3PJ2A 5ETFA 3FMHA 3DJ5A 3QBNA 3KVWA 4KIOA 4KIPA 3UNZA 3MFTA 3N51A 2FA2A 3DNDA 3DB8A 2BFXA 4S34A 3CCNA 4MXAA 3AMYA 5L2WA 2ITXA 2X1NA 3VUHA 4ZLZA 2UZVA 3VAPA 4DLIA 4G9RA 5A4QA 5HVKA 2YCSA 3SW7A 3ORTA 3SDJA 3WYXA 3CGOA 3DPKA 5CEQA 4AOTA 4TYEA 3D2IA 3UNJA 4A7CA 3JPVA 3P79A 1JSUA 2C0TA 2PMLX 3PXFA 5HCYA 3MW1A 4FSTA 4IDTA 2C3IB 4OTIA 5ANKA 3BV3A 5AAFA 5CAOA 1ZOGA 4D9TA 2YM3A 5KMLA 2OXDA 3TZ8A 1PF8A 4KAOA 5CALA 4JQEA 5HE1A 5IEXA 3LFFA 5I4NA 3OWPA 4H1MA 2X2KA 5HCZA 5FP6A 4ID7A 4BZOA 2PZ5A 1Y91A 3IECA 3GU5A 5HOAA 4ZIMA 5M4FA 4AE9A 3LQ8A 5IISA 3RCJA 3QQGA 1NA7A 4G3FA 5CF4A 2PVKA 3EKNA 3H9FA 4D2PA 4AGCA 5M4UA 3LPBA 4GJ2A 2VWUA 3PZHA 4UV0A 4FC0A 3FZTA 3ZRKA 1Q4LA 3BELA 3BWJA 3CXWA 3M11A 3NIEA 4NW5A 3QUDA 2I0EA 4HNIA 4W9XA 4R5SA 5HCXA 3TACA 4BL1A 5L4QA 1SNUA 4RIWB 5HG5A 2Y4IB 2QNJA 1V0BA 1I09A 5M4CA 5ANGA 2BZKB 2WQEA 4YZ9A 4FUYA 4AU8A 4U40A 2YM5A 4X21A 3UQGA 4E6DA 4ZTHA 3ZDUA 2Y9QA 2IZUA 3NYOA 4DAWA 4Y46A 5F94A 3QTWA 2PHKA 5H8GA 4BI1A 4D2RA 3F7WA 4U8ZA 4EI4A 4IVAA 3G51A 4WSQA 4AW2A 2RF9A 5IMEA 4GH2A 3ZUVA 4WG3A 4YZMA 4IWDA 5IEYA 2YIXA 4RZWA 4G6NA 3LFNA 2XMYA 3QUEA 5AR5A 1OIRA 4X6RA 1GZNA 1SVEA 3K5VA 3UVPA 4FT7A 3QC9A 4GW8A 4ZSJA 5CAPA 3AC2A 2GQGA 2JFLA 3MB6A 4UN0C 4BBEA 2HZ4A 3TNIA 3ZMMA 3G0EA 5EW8A 5HTBA 3TNQB 4F09A 3SHEA 2ZB0A 3F3ZA 5A54A 1M2RA 1NXKA 3D5XA 3PJ3A 4C61A 2OXXA 4B8MA 4IHPA 2UV2A 2YIYA 3EN4A 4E4NA 4E26A 1KSWA 4FL2A 2YM7A 4FIFA 4QYYA 5K4JA 2OW3A 4FX3A 3MS9A 4TPTA 4MNEB 4I5CA 2WKMA 4F9BA 3WZEA 5GZAA 3LCTA 4P4CA 3FMLA 3S00A 3AMAA 1MRYA 4DG2E 2Y6MA 4EQMA 5IA2A 2NRUA 2HZ0A 3A7IA 4QYEA 5DR6A 3WF8A 2ETKA 3R9OA 4Z55A 4MXZA 4AFEA 4A9YA 4RVKA 5I5ZA 4FVRA 4EQUA 4O0SA 2QOCA 3SW4A 3DLZA 5HTIA 3TIYA 2OZAB 4PV0A 4LL5A 2FH9A 4CFNA 3VW6A 4IBMA 4QMOA 4C34A 4IM3A 4BDIA 2ITWA 5GJFA 4EL9A 5DMZA 5JT2A 1OM1A 4HOKA 4LGHA 5CF8A 3PVUA 1PYEA 5L2QA 2X39A 5ACKA 3ANRA 3V5JA 2C6LA 4QMUA 3NYXA 3QD3A 4BCMA 3P1AA 5KMNA 4ACHA 3EZVA 1AGWA 3UDBA 4C4FA 4USEA 4MF0A 4DG3E 4M84A 5H8EA 1UWJA 4ITIA 3E7OA 5ANJA 2HW7A 5FDPA 4BDCA 5J1WA 2VTIA 5CENA 3ELJA 4ENYA 4WUNA 4O2PA 4ONAA 1LPUA 3R1NA 2GSFA 3VBXA 3FZPA 4AACA 4IM0A 4DH5A 2PVMA 4EOPA 3QTSA 1REJA 2GU8A 4RJ6A 4WBBB 2VTNA 1V1KA 5EW9A 5AMNA 3RNIA 4WA9A 4IZAA 4A4LA 3DTWA 3PRFA 3WOWA 4E7WA 2ESMA 5HESA 3KMMA 4LRJA 4UYNA 3DFCB 4PNKA 2YCFA 3A62A 4JXFA 5A6NA 3O50A 3VN9A 3UO4A 2RG5A 2B55A 2XM8A 4CMUA 5CX9A 3NRMA 5IUHA 4MKCA 3HZTA 5TF9A 3CGFA 5EM8A 2IVSA 2ITTA 2WTCA 4IADA 3OP5A 5HG8A 5I9ZA 4ZTRA 5B2KA 1KV2A 3TKHA 1JBPE 4ITHA 4A06A 3ORLA 3D5VA 1OZ1A 3L8XA 3MJ2A 3W2PA 3CKXA 4FEQA 3E88A 3FYJX 2ERZE 4MVFA 4EYJA 5JEBA 4J7BA 2ITVA 2BAQA 4LM5A 3KCKA 1W0XC 2JDOA 4OTFA 1H1RA 1WVXA 3R9NA 2IW6A 3UG1A 4BGHA 3P0MA 5C01A 3TTJA 3BHYA 5HLWA 3A4OX 2YERA 4PMPA 1Q8TA 4FV2A 4BIEA 1Q3DA 1W8CA 3KA0A 3MY5A 3VIDA 4J8NA 4F63A 5EM6A 3QRIA 3G33A 4QMSA 5TE0A 5AIKA 3PG3A 3QQLA 3R7GA 4M0ZA 3KRXA 3F3UA 4M7IA 2BPMA 3NLBA 1FMKA 4GG5A 3C5UA 1LEWA 4ANMA 2X6DA 1FOTA 2GDOA 3PSDA 4TYGA 4DGMA 3TTIA 4RIYA 5ANDA 3RP9A 3Q04A 4EZ3A 5B2LA 2YITA 3RPYA 4O1PA 3C4XA 3QKLA 4IB3A 3TCPA 4GK2A 1UV5A 2J0KA 2W05A 1HOWA 3FMEA 1WBTA 5AAGA 5J7HA 4E4LA 3OXIA 4JAJA 1NVSA 2REIA 4ZK5A 2LAVA 3II5A 5EHLA 1VEBA 1WBOA 4JBVA 2DQ7X 3MH3A 4V0GA 5HG9A 3HDNA 4Q5HA 4XG2A 4DGGA 1UU9A 5T68A 4CXAA 3PXQA 1TVOA 3M2WA 4RJ7A 5LMKA 4JG7A 2WQBA 3PTGA 4FA2A 2CGUA 4YP8A 5D9HA 5EK7A 4RMZA 5IA0A 4CTCA 2PZIA 4YHFA 4ZEGA 2FSMX 3IGOA 3FAAA 3QXPA 2GS2A 3PJ1A 4CEGA 2ZVAA 4QMZA 4AAAA 5HTCA 2YWPA 1UKHA 4Z7HA 5KMOA 4JG8A 3PIXA 3PLSA 3HGKA 2FSLX 4DEEA 4IXPA 4JBOA 4E6CA 2C6MA 3M42A 3Q52A 2R0UA 3QD0A 4C4JA 1TKIA 3FLNC 4O0UA 1DI8A 4OTWA 2QD9A 3HV7A 5I9UA 3VW8A 3TV7A 4DEBA 4EK3A 1PMNA 3OXTA 4L00A 5K9IA 3GOPA 4K6ZA 5DBXA 2RG6A 2VTMA 3MV5A 4CLIA 1YXTA 2R9SA 3MIAA 4F64A 4FF8A 1FINA 3I5NA 3QTUA 3ZM4A 4UMRA 4R1VA 5LVPA 2VO0A 4YLJA 5JFVA 1IRKA 1WBSA 3F2AA 3L9LA 5AUXA 5M51A 2PL0A 4ZOGA 3D7ZA 5CEIA 4RIXB 2OXYA 3BX5A 2B9IA 3BGPA 5EHOA 3TKIA 3QD4A 1S9JA 1BUHA 3K3JA 4KKGA 5FM2A 5H2UA 3KMUA 1Q97A 2VNWA 5FBOA 5TKDA 5JMSA 3UZTA 3OW3A 3D94A 4FKLA 2ZAZA 4LMNA 3VQUA 3OWLA 4S32A 1E9HA 3IW4A 4RC2A 5CEOA 3MA6A 3EFKA 4MHAA 3HLLA 5AUWA 3QRTA 3O7LD 4CFMA 2V22A 1YKRA 4QP2A 2JITA 2X6EA 3HNGA 1GIHA 3EYGA 4I5PA 5KX8A 3OHTA 3AT3A 3R22A 4L6QA 3BYOA 3KY2A 4ASDA 3ORMA 1PMUA 2IZRA 3NSZA 4YO4A 4ZTQA 2PVLA 3HL7A 2BDJA 2VX3A 1YI6A 5EG3A 4I41A 5DG5A 4E6AA 1DS5A 5G6VA 3W55A 2R2PA 2CGWA 4BTKA 4YNOA 4WD5A 4E1ZA 4O0XA 3TT0A 4FIGA 3A8WA 3QZIA 5HBJA 5JK3A 3KULA 4TT7A 2GFSA 2WQNA 3DKCA 2XKEA 5L6PA 1OITA 5HNGA 2WTVA 4IJ9A 4LGGA 2C47A 2XKDA 4RX5A 1PXNA 1SZMA 1DI9A 5H8BA 1KE5A 2OJ9A 3SRVB 3FLYA 3GNIB 5FBNC 4AF3A 4E4XA 4AT4A 2PVNA 2YACA 1OKZA 2XNBA 5CYIA 5E1EA 4RT7A 2BRBA 2ZB1A 4IFGA 2ETRA 4HZSA 2VTJA 4FV4A 5IH4A 5J9LA 4UZDA 4YBKA 3E64A 3QQKA 3DA6A 3GT8A 4I4EA 4U0IA 2V7AA 4U81A 1LUFA 2HOGA 3HYHA 3M1SA 3OS3A 3P7BA 4NFMA 5CTPA 3QF9A 4EQCA 4PQNA 2JBOA 5HHWA 4NCTC 2XJ1A 3PPJA 4FKGA 4WRGA 5CASA 3FL4A 4UY9A 1Z57A 5T3QA 3MGYA 2WOTA 4H3BA 4E5BA 4YURA 4N4SA 3DKGA 1ZY4A 2WTIA 4P90A 4L45A 3O0GA 2JDVA 2WMUA 2UVXA 3ZH8A 5EYCA 3V6RA 3D5WA 4K1BA 2XKCA 2ZYBA 4Q9ZA 2V55A 5KNJA 1VYWA 1XH5A 5HO6A 4GUEA 4XH6A 2VZ6A 3EZRA 4GFGA 4R1YA 3UGCA 2HZIA 1BKXA 4W4XA 5BYYA 3G2FA 3DLSA 3BPRA 3S1HA 4FKQA 4KA3A 2ZDTA 4P7EA 3FHIA 3FKOA 4QTDA 3ODZX 4L01A 5LWMA 1GIJA 5D11A 3VBTA 3CEKA 2IVVA 5HNIX 4IVBA 1H08A 3H3CA 5JSMA 5AP4A 2W1GA 3LFDA 3AMBA 1YHSA 3ZZWA 4RLKA 2VWWA 2IVUA 3FXXA 3S95A 3LM0A 4E6QA 1KE8A 3QZGA 3COMA 3KK8A 4FKSA 4EHEA 5CU2A 1R0PA 5CSPA 4YLKA 2FO0A 1FVTA 1KE7A 2W1HA 2XP2A 5K0KA 5DH3A 2BRHA 5HNBA 5AV2A 4DCEA 3O71A 2UW9A 1YXXA 4YJVA 4ZTMA 3VF9A 4EOLA 1KWPA 4GK3A 4I6BA 4RG0A 4M8TA 3L1SA 4YZDA 3V3VA 1M17A 4NUSA 2UW8A 4MCVA 3GFEA 2E2BA 2WEIA 4OTRA 3Q9XA 1M7NA 3FLZA 1SYKA 3JVSA 5IDPA 4IAYA 2ITPA 4FGBA 5AX3A 2JD5A 3NUXA 3SD0A 1E1XA 4FTJA 4BIDA 5IU2A 2VO3A 3PA4A 1BMKA 4FSRA 1B39A 5JRSA 3BIZA 2VV9A 4G2FA 3NX8A 5I9YA 2YM4A 2W1IA 3VS0A 2UUEA 3W32A 2XK7A 3JVRA 2BR1A 5BQ0A 4O0TA 5K5NA 2NP8A 3VHKA 2YJSA 4CCBA 3AOXA 3OY3A 5EI6A 3R8PA 5M53A 3C1XA 2H9VA 3R7EA 4KBAA 1YW2A 2QHMA 4UBAA 3I0OA 3AC1A 4K0YA 4F9CA 3SA0A 3TV4A 4IAFA 5AADA 1O6YA 3T3VA 3OW4A 4J98A 3LFSA 2QKWB 4JDIA 2BMCA 2ZV7A 3B8QA 3D7TA 2X2LA 3D14A 3JS2A 2BROA 3NW5A 5F20A 4E5AX 3KC3A 4YTCA 1GJOA 3QQJA 4YJSA 1WBVA 2Z7RA 3NYVA 3ZBFA 3Q53A 5L3AA 2X9FA 4HYSA 1XH9A 3NUUA 2GHMA 3QA8A 4OTDA 1OL6A 2PMOX 4ZY4A 4EK4A 4LV5A 2VTRA 4XLVA 2RSVA 3JYAA 4GU6A 3DKOA 1Q3WA 3FSKA 1JKKA 4LQMA 3ZU7A 4QP9A 4BB4A 5E91A 4PY1A 3BYSA 4YC3A 4F1MA 5FD2A 4NTSA 4RX8A 4ZAUA 2B53A 4FV3A 4BCNA 4I22A 4C7TA 3VS3A 2VTLA 2QOHA 4IANA 2OK1A 4XG7A 5DPVA 2YM6A 4BWPA 2R0IA 4BCFA 5BVWA 4ALVA 3ALOA 4GK4A 5J1VA 2CMWA 5HLNA 4F0IA 1ZY5A 2DYLA 4K33A 3MVHA 5ETCA 5CSWA 1FQ1B 3GUBA 2OJIA 3F5UA 2X4FA 4NH1A 3MPAA 4OTGA 5CLPA 1Q8WA 3F2NA 3LCKA 4GJ3A 5AP7A 3CP9A 4M69A 5AA8A 5L6OA 3ALNA 5AV3A 2C5OA 3SXRA 2F4JA 2XNOA 3C13A 4TRLA 2IW9A 4KBCA 5HO8A 2XKFA 5D12A 4BDAA 3EMGA 3JY0A 3UIBA 2YAAA 3NAXA 3E5AA 4EHVA 3CPCA 2ZM4A 4HYHA 3PP0A 2PK9A 3PFQA 5BVNA 2W96B 3AC3A 4IIRA 4RVLA 3NUSA 3GC9A 4FT9A 4IH8A 5BUEA 3CR0A 3IW7A 3K54A 3NS9A 3ZS5A 3C4CA 4X0MA 4JAIA 3O17A 4JIAA 2EXMA 4IZ7A 3TUBA 1U5RA 2JKQA 2W17A 3PJ8A 4PDOA 4ANLA 5HLPA 4KSPA 3B2TA 3TWJA 5DWRA 3QRUA 3GFWA 5DA3A 4ANNA 3OVVA 4BTFA 4S30A 3WI6A 3WZKA 4ACMA 5B2MA 4YZNA 3UODA 1ERKA 4GEOA 4AZVA 5B0XA 4WG5A 1PXLA 1R78A 4HZRA 4JG6A 4KIQA 4AZFA 3C0IA 5HKMA 2R3FA 4PL3A 4LUEA 2WIPA 2WU7A 2Z7QA 4RSSA 2Z2WA 1U54B 4EOSA 3P86A 5HICA 4L68A 2PZYA 2GS7A 3FV8A 2P3GX 3S4QA 3ZFXA 4XP0A 2A2AA 1LR4A 3R30A 4EC8A 3W2RA 3I4BA 4YUQA 3CQWA 5JKGA 2JFMA 3QTIA 4PTEA 4B0GA 2WELA 4O0RA 4PDPA 3GU4A 4FZAB 5BUIA 5CF6A 2XIYA 2XH5A 4FOCA 4HJOA 3UJGA 3VS4A 3HA6A 2JC6A 2FB8A 4JI9A 3QWJA 4NW6A 5DEWA 3TNWA 2O64A 3FZRA 3KVXA 3LAUA 3GU6A 3VUKA 2ERKA 3V5TA 5M4IA 4L7FA 4C57A 3LIJA 3UTOA 3QTRA 3ET7A 4RVMA 4GV1A 2EWAA 4BKYA 2QI8A 4CKRA 4U5JA 4I93A 4GT5A 4XV2A 4EORA 3OF0A 4M15A 4C59A 5KMKA 3UPXA 5JH6A 3PXYA 4LGDA 3CJGA 3WF7A 3CQUA 4G3CA 4U97A 3ZRMA 4RC3A 3FMDA 2J0JA 1R3CA 4GYIA 1WVYA 4YC8A 5C8MA 4BDBA 3Q6WA 4K11A 3GEQA 3OUKA 4RWKA 4Z16A 3A61A 3OUNB 4ZJIA 5LCJA 2ITQA 3EN5A 4BCQA 3CS9A 4BDFA 2JBPA 4AE6A 4YTIA 2Q0NA 1RE8A 5DR2A 2RIOA 3ZSGA 1CMKE 4J52A 1E1VA 2W1CA 2X8EA 4OGRA 4XG9A 3V8WA 3EQFA 3UO6A 4EH4A 3V5LA 4HVGA 4XG4A 4D2SA 2FSTX 3FWQA 3V5WA 2UW7A 1J1BA 3OTVA 1SM2A 4FZ6A 4CSVA 3VC4A 4ZSAA 1H8FA 5BMMA 4HPUE 4O0VA 4ASXA 5FXRA 5EKNA 3ODYX 1P2AA 4S31A 4FSNA 3Q9WA 4TZRA 1KOAA 1H26A 4UZHA 4DEGA 4GL9A 4FVPA 4ZY6A 2RKUA 2RFDA 3VS2A 3DZQA 5I9VA 3UC4A 2WMXA 3GI3A 4O91A 1YHWA 3IDCA 2YN8A 4MYGA 2XIZA 3FPQA 1YWVA 5I9WA 3QA0A 4D58A 3BKBA 4W9WA 3GU7A 3FXWA 3TJCA 1NVRA 3C7QA 3F3TA 4FYNA 5LWNA 4AW5A 4EOIA 4QPAA 3NNXA 4UWBA 4FKPA 4I6QA 1U4DA 2QG5A 3NAYA 2F2CB 4K8AA 5EM5A 3ZSIA 1YOLA 3ENMA 3I6WA 4GVAA 4I23A 3Q60A 4DBNA 4L44A 5EI8A 2W9FB 3UVRA 3UYTA 3T9IA 2CSNA 4MXCA 4M0YA 4H39A 4LOOA 2X81A 3PXRA 4ZLOA 2A4LA 2RGPA 4WUAA 2B9FA 2C6OA 5IA4A 1P5EA 2HCKA 5C26A 3DK6A 2J0IA 3MFSA 4YJQA 5AR7A 4FBXA 2XK4A 1ZWSA 3R28A 4L7SA 4UWYA 3BWFA 3VJNA 4BF2A 4QQTA 4YTFA 3TXOA 1GOLA 1RQQA 3GU8A 3LLTA 1QPCA 4FG7A 5CXZA 3GOKA 4QO9A 1UU7A 4ZJJA 3LCOA 2YABA 5JQ8A 1CTPE 4CVAA 2ZV2A 1PJKA 3W16A 3ULZA 2I0HA 3CD3A 2KTYA 2XA4A 4E8AA 3AQVA 3IG7A 3QQUA 3FLWA 4X2JA 4BCIA 4CKJA 3W1FA 4C3RA 4DEAA 3ZBXA 5E8WA 2QLQA 2XIXA 5EYKA 2P55A 1JKSA 2BCJA 2CDZA 3ZEPA 2YLFA 4MD7E 2W1ZA 4PTCA 5DHJA 3FZOA 4EWQA 1GZKA 1SMHA 5E8UA 4ANQA 4DGOA 3EQPA 1QPEA 3V04A 1FGIA 1H00A 2YDJA 4FMQA 2R3OA 3RTPA 2VO6A 5HO7A 3GXLA 4KRDA 3H0ZA 3RJCA 1OECA 2QOOA 2W4OA 3IS5A 4H36A 1ZXEA 2XBJA 1JPAA 2F7EE 3UZPA 5BVKA 1PXKA 2UZUE 3RZBA 3E8NA 4K18A 4MEDA 3RPRA 4HVIA 3Q4TA 2EU9A 4HVSA 5DRDA 3D0EA 4QYFA 2PVFA 3UMXA 3R8MA 3PXKA 4FTMA 4YZBA 4AWIA 3POZA 2Y7JA 3KGAA 3BHHA 3HECA 3QRKA 2WTKC 4WRSA 3W2QA 4D28A 4MBJA 3O8UA 4KRCA 3W8QA 3DAKA 2CJMA 4DGLC 4UEUA 3ZC6A 3HV6A 5AUUA 4V04A 4FVQA 5A46A 1BYGA 4FV5A 4AFJA 2BAJA 4ASZA 4APPA 4NK9A 2BIKB 3GQLA 4C36A 1P4OA 2I0YA 3OCSA 2GNGA 4NJ3A 4C62A 3V8TA 4GVJA 1YXVA 5IUGA 3Q5IA 5HI2A 3QXOA 2B1PA 2XIRA 4IWQA 5LMAA 4LI5A 3WILA 3MFUA 4TYHB 1YXSA 4LMUA 3I79A 3HVCA 3LXPA 4JNWA 3IOPA 4DN5A 2H8HA 4FL3A 3SV0A 3SX9A 4DINA 3LXLA 2C69A 4AUAA 5CZIA 5BVDA 2HW6A 4LYNA 4Y5HA 2UW5A 4C35A 4BVUA 3OWJA 3DS6A 3NGAA 1Q8ZA 4M67A 5DLSA 3PA5A 2I1MA 1Q41A 2WMVA 2ZV8A 3DB6A 3GQIA 2EXEA 3PY3A 2C30A 4KIKA 4R5YA 4RIWA 4CTBA 3U87A 4EK6A 3DDPA 4ZZMA 2EVAA 2PE2A 2ZM1A 1FVVA 4QPMA 4GRBA 3ZFMA 3ZTXA 3BQCA 4KINA 4UMPA 5HX8A 1A06A 2BIYA 4TTHB 5CVFA 3PPZA 2X2MA 2VN9A 3NNWA 2XJ0A 3ETAA 4ZXTA 1OUKA 3HEGA 3LFCA 3LVPA 2V5QA 2YEXA 1ZOEA 1EH4A 4P5ZA 5HD4A 2PTKA 3G6HA 3OWKA 2OG8A 1FGKA 5D41A 3NZ0A 2X9EA 2CCHA 1S9IA 2WPAA 5E8XA 5CS6A 1XBAA 4XS2A 1R39A 2B7AA 3O8TA 4YTHA 4EJNA 2JIVA 3H4JA 2B9JA 4QP8A 2WTDA 3DFAA 3EQBA 4A07A 2P2HA 4FV1A 5DR9A 4QTBA 4CV8A 3NIZA 4PL4A 4U43A 3EFWA 3EQGA 3L9PA 4A9RA 2WZJA 3BLHA 1W83A 4BCPA 4EH5A 2A0CX 3PVBA 1AQ1A 4G6OA 4F65A 4IMYA 1XKKA 2XUUA 3TN8A 4KWPA 2BHHA 2W1EA 4OR5A 4IAKA 1CSNA 3UC3A 5EYMA 3PSBA 3DJ7A 2YAKA 3QHRA 4HYIA 4DH8A 5A6OA 3P23A 3EL7A 4MNEA 4EHGA 2IWIA 2AC3A 4B8LA 2HWPA 3LHJA 4R3PA 3TIZA 4CKIA 3NUYA 3R73A 4KSQA 3PYYA 4EC9A 4QMNA 1UA2A 3PVWA 4G31A 3FBVA 4R8QA 5DRBA 1K3AA 3A7FA 4HNFA 4J71A 3R9DA 2YZAA 3V51A 2CCIA 2OZAA 1TQIA 4P5QA 2HY0A 4QP6A 2I0VA 4YJOA 4YLLA 3GENA 5CVHA 5KE0A 4FOBA 3KF7A 1WFCA 3O8PA 4G5PA 3H9OA 4S33A 4IJPA 4N6YA 4CFWA 3LFEA 4MWIA 3UO5A 1JOWB 1YI3A 4K2RA 2OWBA 3BGQA 3DKFA 3I0QA 4L3JA 5KO1A 1TQPA 1M7QA 4IVDA 4JL9A 4XV1A 2R3LA 4L43A 1W84A 2X7OA 5DNRA
chains in the Genus database with same CATH superfamily
4PX6A 4PP9A 5HBEA 1TQUA 3QWEA 4DCAA 5C27A 3JUHA 3SQQA 2GHLA 2G01A 3R02A 4PO2A 1ZOHA 1Q62A 1F3MC 3GP0A 4CYIA 5CEPA 5CT7A 3HMOA 3QQHA 4AA0A 1IASA 2BILB 4FKOA 3OMVA 4NIFA 5TO8A 4CZUA 3IW8A 4E73A 5HX6A 5ICPA 2O2UA 4U42A 4D9UA 3U6JA 4ANBA 4QNAA 2YI8A 2WGJA 4FICA 2QLUA 4ALUA 1L8TA 3BE2A 4FK3A 3Q2JA 4KS8A 5AX9A 3R7YA 2XAMA 5E8TA 3QZFA 1XO2B 3GBZA 4BNEA 3UIXA 1WBNA 3KN5A 3MPMA 4RJ4A 4X2GA 4QQJA 5E90A 4YBJA 2XNEA 1JWHA 3DAJA 2HYYA 2UZBA 2JAVA 3BEAA 5FEQA 3Q3BA 4Z9LA 1FMOE 3KULB 3KKVA 4ZSLA 5FEDA 2XRUA 4CCUA 3E3PA 5AIRA 5JGDA 3TDVA 1QCFA 4XCUA 2ZXQA 5CVGA 1L3RE 5F95A 4AZCA 1Q61A 1GAGA 2PE0A 3LQ5A 4IVCA 4FI1A 4QDVA 3FKLA 3LVTA 1OPKA 3UMWA 1TQTA 1ZYLA 3EB0A 3GC7A 1ZZ2A 3HV4A 1YWRA 4RC4A 3SOGA 1PKGA 3KB7A 5CEMA 1BI7A 2OIDA 2VWVA 5JFWA 4G1WA 5A14A 3QFVA 4AOJA 4O86A 4BTMA 1MRVA 4G17A 2PY3A 3CY2A 3QC4A 3E8DA 2VTHA 4MXYA 3BCEA 5L8LA 4FKWA 5DT0A 5LQFA 4O0YA 4IM2A 4YHJA 3D2EA 5BYZA 3WF5A 3EQDA 2UVYA 3LXNA 4M3QA 3TG1A 3CD8A 4BHNA 4FV9A 4D5KA 4AN2A 3LZBA 3QWKA 2ITUA 2R3JA 3BZ3A 3BYVA 3HKOA 4FNXA 4KB8A 2E9OA 4PPAA 4XV9A 4ZZNA 4AW1A 3R9HA 3GCPA 1WMKA 4FSYA 4DFZE 2XALA 3BLQA 4I6LA 3TUDA 4JDHA 3BHTA 4JBQA 1QPJA 1QWNA 3Q6UA 3DK7A 3IDBA 3HRCA 4IE9A 3KXMA 3R9RA 4EZYA 2XEYA 5J7BA 5FTQA 3O23A 3Q2MA 3RM7A 2ONLA 2VTTA 4O4BB 5IG1A 4EZXA 2VTQA 4BJJA 4DFYA 2R3GA 4AN3A 2WMSA 3TL8A 5IEVA 3IPHA 4FV6A 1H28A 3W0RA 3A4PA 3DPOA 2OIQA 2W1DA 2R3MA 2PU8A 4QMLA 3EQHA 4IEBA 2I40A 3PG1A 2CGXA 2JKKA 3PA3A 4U44A 5CY3A 1Q8UA 4CQGA 5C03A 5LMKC 4O0WA 1OL1A 4AZSA 3T49A 4FEUA 3EH9A 2ITNA 3SAYA 3BI6A 1W98A 2ZMDA 4FSWA 4JS8A 4MWHA 5LCKA 2OH0E 3EOCA 4G3GA 3WZDA 1UU3A 1OGUA 2YDIA 3ZO4A 2W9ZB 4B9DA 1OKWA 2CHLA 2OU7A 3OC1A 3FQEA 1WCCA 4BHZA 2PSQA 5E8ZA 2BRGA 2VGPA 3L9MA 4ZTSA 4Z3VA 3R71A 4EZSA 1OL2A 3BYMA 3D5UA 1PMEA 3G9NA 2OICA 4WHZA 4XG6A 5KHWA 5FTGA 2PY6A 4O7WA 4II5A 5AUYA 1BLXA 4AOIA 4BBFA 3NFFB 4R5GA 3R8UA 1Y2OA 4RX9A 2ITYA 1UU8A 3BBTB 3LFQA 5EHYA 4CD0A 4RLLA 3N9XA 4C8BA 4Y85A 3PZEA 4L42A 5DN3A 2QU5A 4NKSA 2R3QA 4A4XA 4U3ZA 3JR1A 3WARA 4HW7A 1TQWA 4O2ZA 2WXVA 5M56A 5E9EA 3IQ7A 1PXIA 4OBPA 1KE6A 3MY1A 3H30A 4IACA 4PPBA 4YNEA 4Q5EA 1FVRA 4A4OA 3KAWA 1OL5A 2WMWA 3ACKA 4O4DA 4YGAA 5IQAA 2IEWA 3FZSA 3V01A 4FIEA 3FI4A 4QMMA 2IN6A 3KU2A 4GUBA 3UPZA 1WAKA 2HAKA 2QONA 3ACJA 1H4LA 3G0FA 4MBIA 5CZHA 2Z8CA 2XYNA 5GJGA 1OIUA 3PUFC 4DTBA 2VNYA 5HVYA 1OPJA 4DEHA 3R83A 4GKIA 4Y73A 4TL0A 1IAHA 5C8KA 4HGEA 5HU3A 2YL9A 4B9QA 4G16A 3E3BX 2HZNA 3POOA 4JQ7A 3V6SA 2WINM 3B51X 4RJ5A 3FC2A 4EWHA 5HIBA 1OVEA 2F49A 2WO6A 4HGTA 1VLRA 5EQPA 1Q24A 2QKRA 4AW0A 2PVRA 2LM0A 1YRPA 5AR2A 3OBGA 3QCXA 4U6RA 2J5EA 2XF0A 4IFCA 2H96A 3LQ3A 3ZZEA 2EUFB 3IKAA 4LOQA 1DKXA 2XNNA 4AT5A 4EHZA 2O3PA 4FKRA 4HYUA 4UMUA 4TYJA 2Z7SA 1ND4A 2A19B 2QODA 3MVLA 2A27A 5CSVA 2PUUA 3D9VA 2J4ZA 3PSCA 5CQUA 4EZVA 4YZCA 5LJJA 4F1OA 3R2YA 1PW2A 3LCSA 4FYOA 4KD1A 5LOHA 3LM5A 4EK5A 4ALWA 5FXQA 3DBQA 2WD1A 4WNMA 3W0OA 1V0OA 3A7HA 3THBA 3SRVA 2YL5A 5T6KA 3E92A 4EZZA 3QLFA 4XBRA 2XM9A 4M69B 2G9XA 5HE2A 5M07A 4RJ3A 2PULA 4M13A 3D4QA 5IA5A 5DT3A 4BBMA 2D4CA 1OIYA 4J1RA 4QMVA 3W2OA 3DY7A 3LCDA 3LJ0A 4HGSA 2X4ZA 4K9YA 4QYHA 3SXFA 4AS0A 4W4WA 1I49A 2N3KA 4LL0A 4EOQA 4NEUA 1P14A 4QT1A 2ND0A 4FNZA 3VQHA 3EIDA 3HV5A 4AZTA 4FZPA 5J5SA 4FV8A 1U5QA 2JKMA 3NNUA 2QOIA 4KNBA 4QP7A 5CU3A 5K5XA 2C0OA 3FZ1A 1OA0A 4NQIA 4ZLYA 4EBWA 4M68A 1XWSA 4HCTA 4I94A 4GFMA 4OLIA 3QAME 4U45A 3F88A 1H1QA 3C0HA 2OFVA 4QDEA 3QALE 2XJ2A 3CTJA 4M97A 4E5WA 2SRCA 1V0PA 4W4YA 5BUJA 4DFUA 4ZSEA 4DFBA 1E1DA 4FKJA 4ACGA 4KBKA 4RQKA 3GCQA 3ZEWA 3VEBA 3QX2A 3I5ZA 4AZEA 1DAYA 4CT1A 3NCGA 5DE2A 3QYZA 3RK9A 4LG4A 1NVQA 4BC6A 3ZHPC 4DYMA 5ANOA 5TOZA 3VO3A 3EKKA 4AX8A 3U55A 3BV2A 3BL9A 2YDKA 2P0CA 3DX3A 3IGGA 1F5QA 1U59A 1BL7A 5E7RA 3B52X 4D4VA 2OZNB 2C5NA 2NRYA 3QTZA 4MQ1A 4MX9A 3CJFA 4J99A 4IZYA 5CNOA 1NW1A 1O6KA 4GYGA 5D7AA 2WEVA 3RGFA 2NNWB 4BFMA 2HK5A 2BHEA 5GJDA 3HRFA 1PXMA 1ST4A 3QGYA 2CN5A 3WIGA 3F82A 2HY81 1H1PA 2Y6OA 3R8ZA 3DPQA 4DT9A 3BU3A 5F1ZA 2YM8A 1M14A 2OF2A 5HE0A 1X03A 4XRLA 3NW7A 3QGWA 4PDSA 5AP0A 5AV0A 1PXOA 2C1AA 4D4RA 3U8WA 4XLIA 5KMMA 4V05A 4NM5A 4EOKA 2XNMA 5D10A 4FSUA 4F9WA 2B9HA 1XH8A 3ORXA 1XR1A 2VTAA 2OKRA 2R3PA 3ZRLA 4APCA 4EH2A 5BNJA 3HUCA 2B4SB 2QQ7A 4EZTA 4DHIB 3RK7A 4S2ZA 2VTPA 4TWNA 4NL0A 3P78A 4ERWA 2C5YA 4FT0A 5CF5A 3ORPA 4W8EA 2GNFA 4A9TA 4C2VA 4DG0E 1WZYA 4JLCA 2QFFA 2O0UA 3HA8A 3PY0A 5AUZA 3FEGA 4IB5A 3BYUA 3KXNA 1YOMA 4FZDB 3OXZA 4L46A 5CU0A 3DPPA 3K5UA 3MFRA 2GMXA 2R3NA 2W99B 5F9EA 3UOHA 3PP1A 3DJ6A 4X3JA 3WE8A 4BDDA 1ZYSA 1MQ4A 5AWMA 3KMWA 4IAZA 3O5AA 1GZOA 4USDA 4BZNA 3FKNA 2WMBA 4XJ0A 3VWAA 3DU8A 4FZOA 4RGJA 4TWOA 4FT3A 4IX6A 3FD9A 3UG2A 1TQVA 2XCHA 4BDJA 2V0DA 2C4GA 2WTJA 3T47A 2GNIA 1B38A 4X3FB 3QCYA 5EH0A 4I0SA 3KIOC 4G5JA 5CI7A 2XS0A 1FPUA 5FG8A 1KOBA 2XRWA 4AZ5A 2OBJA 4R77A 3MWUA 4HPTE 3I1AA 3FMNA 3FY0A 2VTSA 1R1WA 3BQRA 2WTKB 4G34A 3MN3A 3ZCLA 2J7TA 1CKJA 5AM7A 5ETIA 4BDEA 4C3PA 3MDYA 2NO3A 4F7SA 3H10A 5FGKA 3QQFA 3NEWA 2XZSA 3IOKA 3W33A 2WIHA 3RBWA 4F08A 4R5LA 2VWZA 3Q32A 3R6XA 2VWXA 2P4IA 2BVAA 3FUPA 1CKPA 1IA8A 3OT3A 4RWLA 4WBOA 2PVYA 4W8DA 5IQEA 1JAMA 4UYAA 1JVPP 3DDGA 3CY3A 3FYKX 3BVTA 1X04A 1AD5A 4MH7A 3PE2A 2PMNX 4PRJA 2AUHA 2UZLA 2BRMA 5EOBA 2BDFA 2CGVA 2GNLA 2GTNA 3DT1A 4IC7A 3VNTA 4QD6A 4QOXA 4AN9A 3PXZA 5KMJA 2OLCA 4KS7A 3OTUA 2O8YA 3MY0A 4HY9A 4L8MA 3NUPA 1W82A 4CFFA 1I44A 4M12A 3KXGA 4FV7A 3RAKA 5CNNA 4JR3A 1OL7A 3OOMA 3T8OA 3ORNA 5AP1A 4F7JA 3C51A 3OK8A 3ITZA 3C5IA 4DHZA 2JAMA 4BI0A 4ZS0A 2YJRA 1MQBA 4X2FA 4RIOA 2FYSA 2J5FA 4RA5A 1LEZA 1DM2A 3F3WA 5M09A 2VAGA 4QNYA 4XUFA 4QMXA 1WBPA 3OD6X 3OG7A 3PLTA 3TV6A 1BX6A 3RM6A 3A99A 3GB2A 3O96A 4G9CA 1O7DB 3A8XA 3DCVA 3BU5A 3DQXA 4EH6A 4BIBA 2ITOA 2QURA 2BZIB 5IA1A 3HMMA 4WG4A 3BL7A 2HWOA 3BBWA 2VU3A 3V8SA 2YIAA 2EB2A 1KUTA 1ST0A 3BVVA 4EBVA 2OW6A 3F5PA 2C3LA 2WMRA 2I7QA 2UZNA 4PNIA 5CSHA 4USFA 4QQ5A 1M2QA 3TJDA 4DHFA 4EUUA 2EB3A 1H1WA 3FPMA 2R64A 5KKRB 2XK3A 1XJDA 4PDYA 5HIDA 4EKLA 4JX7A 3FE3A 5E1SA 3U9NA 3ZUUA 3AT2A 3UOJA 1Z5MA 3TNPC 3WYYA 2UW6A 2QOLA 2GAFD 1OKVA 5AAEA 2UW0A 2W0JA 1U54A 3RZFA 5HORA 2X8DA 5K4IA 3ROYA 3FC1X 3CTQA 4YHTA 2Y0AA 2VWIA 3TZMA 4I0RA 2WFYA 3QU0A 5A4TA 4IWOA 3CIKA 4RWJA 3DXNA 3G9LX 2EXCX 4XOYA 2F9GA 5H9BA 2BUJA 2HELA 3R7VA 3EFLA 4D2WA 1HTYA 4H3PA 5AR4A 2C3KA 4BGQA 1J3HA 5FEEA 4HVHA 1G3NA 4XMOA 3CKDA 4FTLA 5CANA 2R3HA 4ZY5A 2W4KA 4NWMA 5HEZA 5J9YA 3PIZA 3E93A 1R5EA 3LMFA 4R5IA 4JR7A 3ORIA 3O51A 3AGLA 4FRFA 2QOKA 3U9CA 3OBJA 4TN6A 3SOAA 2YLEA 1NY3A 2C6DA 5CT0A 2PMRA 1MP8A 2CNQA 2XK9A 2QG7A 4N6ZA 5KBRA 3GGFA 1R33A 3R8LA 3EJUA 3GCUA 3E87A 3KRLA 1SU7A 4LUDA 2B54A 3FSFA 3DQWA 4XP3A 5I9XA 4R3CA 4FTIA 4ZS4A 3ZLWA 3NW6A 3ZOSA 4TNBA 3E62A 4EZQA 1APME 4IB1A 3LXKA 4PL5A 5IH6A 2RFEA 3QKKA 5LVOA 3ZUTA 2FSOX 1ZZLA 4F0FA 1UNLA 1RDQE 3F69A 2YCRA 3OEFX 2W5BA 4H3QA 4ITJA 4JT3A 4O21A 4WNPA 5J87A 4YPDA 3SC1A 4CMTA 5LMBA 1DKZA 3HAJA 4AZGA 4H6HA 4BCOA 3MTLA 3ZXZA 1TQMA 1JQKA 5JZNA 5LVMA 4IAIA 4OW8A 5AV1A 4Y72A 3DBFA 2QOQA 3EHAA 5ETAA 5KZ0A 5I0BA 1U46A 3BUIA 4DTAA 2VO7A 4BZDA 1M2PA 5KMIA 2JDRA 2VWYA 3HDMA 5AP2A 3RINA 4AG8A 3SGCA 4KIKB 1VJYA 4M14A 1UVRA 1ZRZA 4ANOA 1Q5KA 4Y8DA 4R7BA 2X7GA 5JRQA 3U54A 2OBMA 1XHAA 4MXXA 1GY3A 4O22A 4FV0A 3LMIA 2GTMA 3JY9A 4EKKA 1URCA 3COKA 4OBOA 1OI9A 3LMGA 2F2UA 3FXZA 4X3FC 4D1XA 4AZIA 4F01A 2BALA 4MD8E 4F6WA 3UQFA 3D51A 4CYJA 3JXWA 4JBPA 2RL5A 4XOZA 5DGZA 2F7QA 3ZYAA 3NPCA 4R7HA 3ZXTA 2IPXA 1J91A 1Y6BA 3GC0A 2G2IA 1JKTA 2O63A 4G3DA 3VUMA 2DS1A 2WHBA 2CLQA 2UZEA 2V62A 2VWBA 2W06A 2YIRA 3P4KA 3P08A 5G1XA 4N70A 4C4EA 4CFXA 5M44A 4FIIA 1XQZA 3WIKA 4D1ZA 3CTHA 2RFSA 2HXLA 4BDHA 5J8IA 2GS6A 3B8RA 3UP2A 2JDTA 5H3QA 4FR4A 3PY1A 1R0EA 4BWKA 4EH3A 2CN8A 1Y8GA 5TR6A 3FI2A 1H07A 3VRYA 4D2TA 3ERKA 3E7VA 3DBDA 1GNTA 2FGIA 4IX3A 4TY1A 4O96A 5A9UA 2J2IB 3AT4A 3UOKA 4Y5QA 4OAVB 4FG9A 4LOPA 4JWIA 1UNGA 4F9YA 4HYBA 4GCJA 3GCVA 4I21A 2W4JA 2WAJA 4Y95A 3MH0A 3RNYA 3R21A 4FSZA 4A9SA 1JSTA 2BZJA 2JGZA 4KKHA 4LV8A 4FIHA 4MNFA 4ANSA 5I3OA 1PXJA 4DH7A 2EWFA 2WU6A 2X8IA 3KXZA 3PIYA 4O6EA 3R63A 4CNHA 4I6FA 4TW9A 2BTSA 4YJNA 3F3VA 2JNSA 4FKTA 3ROCA 5BVEA 3R01A 3EWHA 2JIIA 3BEGA 5AJQA 1H24A 4OUCA 4FZSA 1DAWA 2E9UA 3SLSA 2XK6A 3V5QA 3QUPA 5EYDA 4CRSA 3BGZA 2QOFA 4JWCA 1OIQA 3WBLA 2OF4A 3BE9A 2IVTA 4ACDA 4IW0A 5E8SA 4AZ7A 3IDPA 4DYLA 4O1OA 3MBLA 2JKOA 3H0YA 4RBLA 2WB8A 3DZOA 1O7DC 4I0TA 5DT4A 3ZLSA 3EQIA 4UALA 2ZJWA 4RIYB 3ORZA 2IG7A 1K9AA 4XHKB 4L52A 4FTRA 2UZTA 4BI2A 3S3IA 2GPHA 4TWCA 4D2VA 2C5VA 5IMXA 3TUCA 4D4YA 3CE3A 5AFVA 4AXAA 2RFNA 1OPLA 4MTAA 1URWA 1HCKA 4RWIA 1ZLTA 4PUZA 5A4EA 4EJ7A 4EZNA 1VR2A 3I81A 2WOUA 3P7AA 3CKWA 4LRMA 3UBDA 4V0GB 4YSMA 1Q99A 1OKYA 3D15A 2VTOA 2CNUA 5EFQA 5J79A 4WNOA 5KKRC 4EH8A 5JQ5A 3HMPA 5K3YA 3VF8A 3RPVA 4ZJVA 3QCQA 1XBBA 5AA9A 1SVGA 1ZARA 3QRJA 4NIFB 1VZOA 1XBCA 2Y8OA 3GC8A 4K77A 4RRVA 2UW3A 1SNXA 3B2WA 3A7GA 4BCGA 4EH7A 4HVDA 3AD5A 4CLJA 3O3NB 4O82A 5EQYA 3W0PA 3PE1A 3CZNA 3P9JA 3R7UA 4WOVA 3TEIA 2XYUA 5HIEA 5DFPA 2YISA 3LLAA 4L67A 4NU1A 2X5CA 3AD4A 2G15A 1ZAOA 3F9NA 2OO8X 4DH3A 3IK3A 1Y6AA 3TZ9A 4I5MA 4O7TA 1YHVA 4JVGA 4C38A 5E8YA 4RFYA 3FL5A 3PWDA 5BX0A 4B99A 3VUTA 2VX0A 4QTEA 2G2FA 3UOLA 2F57A 4GMYA 5AV4A 2P2IA 3DNEA 1WBWA 2FVDA 1GZ8A 3R0TA 3VUDA 4BCJA 4W4VA 1OUYA 1PMVA 4AZCB 1W2FA 4EZWA 4X6QC 3WF6A 3ZSHA 5FP5A 2Z7LA 2BTRA 3ER9B 4BYIA 5JGAA 4GS6A 2W7XA 5AUVA 3IO7A 2OH4A 1CM8A 4NM3A 4FTTA 4RZVA 1IR3A 3AC4A 2VX1A 3UDSA 4TYHA 5IDNA 2Q83A 4DHJA 1STCE 5K0XA 4EONA 2AC5A 3DBEA 3QLGA 4U7ZA 5JGBA 5CEKA 4E3CA 5C1QB 4E93A 2C3JA 3E63A 2ACXA 2PWLA 3U51A 4U80A 4DFLA 4UDXX 3EYHA 2UZDA 4ACCA 4EZ5A 3KDRA 3L8VA 4FODA 3ZLXA 2C6TA 4MQ2A 2C1BA 4GIHA 2YKTA 3FQHA 3RPOA 2C0IA 3KXHA 3AGMA 4C58A 4FKVA 3VS6A 2EX3B 4E4MA 4F78A 4PMSA 3OY1A 4FZFB 3WZJA 4ORKA 2OJFE 3W0NA 3KRRA 2H34A 3RWPA 2P33A 2Y4IC 4AA5A 3PPKA 4XG8A 3R2BA 5IUIA 3NMUF 2AYPA 3TYKA 3BUBA 5IKWA 3TNHA 4FK6A 4BCHA 3CLYA 3Q4CA 3RWQA 4G3EA 1PHKA 4ENXA 2XANA 1QPDA 4U9AA 5HD7A 2BFYA 4C4HA 5CI6A 5LXMA 2A1AB 4Y83A 3LJ1A 3EN7A 2LGCA 3P7CA 4CFVA 3L8SA 3W2CA 2J51A 4CV9A 3UE4A 5HVJA 5EI2A 4DDGA 1I4DA 2GHGA 3IW5A 4C0TA 3AC5A 5KBQA 4C02A 2R7IA 3K2LA 2PVHA 2DWBA 2F7ZE 2ZDUA 4LFIA 1K2PA 4A9UA 5EDQA 3UVQA 5M57A 4O38A 3DYTA 3NVMB 3EFJA 4X2NA 4Q2AA 1H25A 3I7BA 4KKEA 4R7IA 2BZHB 1REKA 2C5XA 4L53A 4J95A 5GIOE 2DUVA 1O9UA 4G6LA 4D4SA 4QPSA 4EUTA 2E9PA 3CAZA 4OAUC 4AXDA 3DGKA 4RPVA 3U6HA 4HR1B 4MAOA 3DOGA 2F1AA 3VKHA 3C4ZA 3R00A 3DTCA 4J97A 5GNKA 2QHNA 3NCZA 4UB7A 4ZTNA 2Z0OA 4JIKA 3NR9A 3FMMA 4NCTA 4YJTA 3UNKA 3HAVA 4FUXA 2NYAA 4OBQA 3R7OA 5D1JA 4NTTA 5LARA 4AZWA 2C68A 4DFNA 1W9MA 1XH7A 2E9VA 1ZYJA 3C9WA 5BVFA 2ITZA 3GCSA 4WO5A 1T45A 4GIIA 4YR8A 5KUPA 1H1SA 2GFCA 3WF9A 4H58A 4JRVA 5C8NA 4XX9A 3RK5A 5FQDC 4RFZA 2BKZA 4J8MA 4BN1A 4CT2A 3KF4A 5C5BB 2R4BA 2PZRA 3KXXA 3MSSA 4I20A 5IF1A 2QCSA 3PVGA 4UMTA 3W10A 2Z0NA 2PYWA 1ZYDA 3R1YA 5A3XA 1QMZA 2OJJA 2VRXA 3LOKA 4L9IA 4QYGA 1OMWA 4XV3A 4EEVA 3G6GA 4AGUA 4BKJA 2QVSE 1YXUA 2GCDA 5EW3A 2HIWA 4U41A 3D83A 2WMTA 4OTHA 4BRXA 2R7BA 4AGWA 3KL8A 5CAVA 1XH4A 2G1TA 3FLQA 5BVOA 3IONA 3VBQA 3CC6A 2ZV9A 3RHKA 5HU9A 2O5KA 3ENHA 5EM7A 1LP4A 5FRIA 3G9GA 4TWPA 1M52A 2R3KA 1Q8YA 5CU6A 1YOJA 2JLDA 5J9ZA 3RAIA 5JN2A 3SVVA 2B52A 1ATPE 4MXOA 4XYFA 3ZFYA 4QMQA 3BU6A 3EN6A 4RQVA 4TYIA 4I24A 4HCUA 2CKQA 4B6LA 2KULA 2C6KA 4JDKA 5HBHA 1A9UA 3VULA 4GT3A 3RALA 4D0XA 4NM7A 3W2SA 1QWUA 3SXSA 2VD5A 4N57A 4CZTA 5ACBC 3ANQA 5CQWA 3HRBA 2Y4PA 4I92A 4O7LA 2OZOA 3NUNA 3UP7A 5IZFA 1YQJA 4FTUA 4ZSGA 3KRWA 4CMOA 4C37A 2QO7A 4RJ8A 3GVUA 1CKIA 4NT4A 3EL8A 4B7TA 4D0WA 5DIAA 3Q9ZA 2W1FA 3HUBA 5FUTA 4DEDA 2JNKA 4UWCA 5A4LA 5L8KA 5EKOA 2QU6A 5B7VA 5J95A 1YWMA 3EQRA 4BICA 3GI7A 4IDVA 2XVDA 3F5XA 4FZ7A 4GU9A 4C3FA 1UNHA 3W8LA 4ZTLA 5HG7A 4UXQA 4RIXA 1F0QA 3I6UA 5L2SA 5HZNA 1MRUA 5IA3A 4FM3A 4QTAA 3VJOA 3T46A 3FQSA 4M66A 3D2FA 4X7QA 3O3OB 4F1TA 4I1ZA 2OFUA 4AQCA 3QE6A 1CDKA 5KHXA 4FIJA 2FYVA 4L3LA 1JNKA 3BLRA 4QTCA 1PY5A 1SVHA 1YDTE 4QP3A 1X8BA 3Q9YA 4AZHA 2WQMA 4OTPA 5GZ8A 4JDJA 5EDPA 4RA4A 3WZUA 4XBUA 4Z7GA 2X7FA 4O7RA 2JIUA 1JLUE 2YA9A 3QZHA 1QL6A 3EN9A 4I4FA 1KE9A 3D7TB 3DDQA 1J7LA 2XB7A 2Q0BA 2XEZA 4NM0A 5E8VA 1H0VA 3AG9A 4XEYA 3MIYA 1OA1A 5FM3A 2R3IA 3QCSA 3VRZA 3K3IA 4EOMA 3FI8A 3VBVA 3KFAA 2BAKA 2ZM3A 4BKZA 3KRJA 4RFMA 4UX9A 5FDXA 3VUIA 2XNPA 2YIWA 3O2MA 3OT8A 4QRCA 2LXYA 3LLLA 3P5JC 2YFXA 5AM6A 4DGNA 2PE1A 2ZOQA 3QTQA 4U3YA 4F70A 4PP7A 4AXEA 4PPCA 4QMYA 2ONLC 4OT5A 4QMWA 4D5HA 4EZ7A 4JOAA 1IEPA 4BDKA 4IC8A 3O3MB 2C6IA 3NWWA 5GHVA 3ABHA 2IO6A 4FSQA 4FEVA 3WE4A 4CZYB 2OGVA 4HCVA 4WIHA 5AR3A 2WNTA 3C4FA 5D7VA 3O7LB 3G90X 3CV5A 1YWNA 4O7NA 3IW6A 3R7IA 4F6SA 3KEXA 2YIQA 5F4NA 3LW0A 1VYZA 3SOCA 3W18A 2VGOA 2CKEA 1UKIA 2HXQA 4C2WA 2WMAA 4NZWB 3RHXA 2XK8A 2JDSA 2UZOA 4FTKA 2PZPA 1OBDA 3BHUA 1HCLA 4YC6A 1RJBA 4FGRA 4DBXA 4F7LA 2UW4A 5ITAA 4GT4A 2D1LA 3TI1A 4NFNA 1IG1A 3FI3A 4DTKA 2I6LA 3E8CA 3HMNA 3OZ6A 3KN6A 1Y8YA 3MH1A 2J6MA 3RKBA 4QP4A 5DOSA 4AGDA 1P4FA 3E8EA 4E20A 3PUPA 4DLJA 3Q4UA 3NYNA 3NNVA 4DC2A 4OTQA 4J96A 3TDWA 4BYJA 5J5TA 3DAEA 3SKCA 4U79A 4R6VA 2YIVX 3P5KA 4O27B 3ZO2A 3Q5ZA 5E4HA 3KCFA 4MK0A 3RMFA 1ZMWA 3HMIA 3OFMA 3RAWA 4F00A 2XARA 3T9TA 3FY2A 4PF4A 3UDZA 4FKIA 5LVLA 3L8PA 1RW8A 4GG7A 4NKAA 3BUQA 3I60A 2W5HA 5IH5A 1JQHA 3F5GA 3VS1A 2JEDA 3C4EA 4ASEA 1YDSE 2W5AA 2ZMCA 3VBWA 1J7IA 4D55A 4JWEA 4FTOA 3VVHA 5ANEA 4BCKA 4NSTA 3G5DA 4JRNA 4YJPA 1G8JA 2NPQA 4QP1A 5HE3A 4F7NA 4WT6A 3AC8A 3AXWA 3OCBA 4H1JA 4ZZOA 5AEPA 3OWGA 5KCVA 3PRIA 4BWXA 1BI8A 4YJRA 4IQ6A 1UWHA 4IZ5A 3RI1A 1ZMVA 3NDMA 3A60A 3MI9A 3ZC5A 4D1SA 4EOJA 3OCTA 1XH6A 3AD6A 2UVZA 3N4UA 3ZM9A 1DKYA 2WQOA 4F0GA 3U4WA 4IWPA 4PMTA 4LDTA 2BDWA 3EJPA 1JSVA 3REPA 3ZONA 4QMTA 3PJCA 3DBCA 2GNJA 4P2KA 3FJQE 3UQCA 5DVRA 2YHVA 5TT7A 2OJGA 1PXPA 3R04A 2IW8A 3C0GA 2OIBA 1BL6A 3COIA 4FG8A 5EOLA 5AP5A 3L9NA 4F6UA 2XBAA 4AP7A 1Z9XA 3ULIA 4ZP5A 2GQSA 1Y57A 2J50A 4DH1A 5FLEX 4BTJA 3QTXA 2CLXA 2X0PA 3BUPA 2IJMA 4JQ8A 4FEXA 4NPHA 1IAJA 2QO2A 1PKDA 2AQXA 5FXSA 5HQ0A 1GNGA 3FHRA 4I3ZA 4AT3A 3OCGA 2WYIA 4NJDA 3G15A 4DA5A 4YJUA 4JX3A 3T3UA 5CWZA 3BHVA 4FNWA 3D2KA 5AR8A 1FBNA 3F6XA 2IZTA 3QL8A 4FTCA 3LE6A 4N0SA 3V5PA 4EOOA 4F9AA 4X2KA 2YCQA 4YPSA 3CBLA 3MB7A 3OEZA 1T46A 3I7CA 3MVMA 3OROA 5EDRA 5KZIA 3EQCA 1YVJA 3UIMA 4O7ZA 3A7JA 4R3RA 4DITA 4R5KA 2GF4A 3RPSA 2X0GA 5FLFA 3MJ1A 5M55A 2IZSA 5JFXA 3CQEA 5I3RA 3VBYA 4CQEA 4PTGA 3KREA 4C4IA 3U4UA 4FTQA 3S2PA 2QO9A 3PWYA 3QD2B 3D52A 4NSWA 4MF1A 4I6HA 4FTNA 2Z60A 5L2IA 5DEYA 3C50A 4YO6A 4YU2A 2H6DA 2QKWA 5FTOA 3FDNA 2E9NA 1OB3A 2XIKA 5CXHA 3F61A 1JKLA 2O65A 3EJ1A 2OSCA 1ZMUA 2PVJA 4KABA 4XNEA 3ORKA 2J90A 4TKSA 4UMQA 3ZO1A 3HP5A 3QYWA 4J53A 2OI4X 3RAHA 2VUWA 3ZLYA 4XRJA 3RCDA 2ETMA 5HGIA 3EJSA 2XAOA 2J0LA 5GZ9A 4YSJA 4C4GA 3KAVA 5AUTA 1H0WA 2QR8A 4BGGA 4TXCA 1WVWA 4I5HA 3Q96A 4AA4A 4PMMA 2RAKA 5JFSA <