3F7WA

Crystal structure of putative fructosamine-3-kinase (yp_290396.1) from thermobifida fusca yx-er1 at 1.85 a resolution
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
288
structure length
288
Chain Sequence
GVNSVAARVTELTGREVAAVAERGHSHRWHLYRVELADGTPLFVKALPDDAPALDGLFRAEALGLDWLGRSFGSPVPQVAGWDDRTLAMEWVDERPPTPEAAERFGHQLAAMHLAGAESFGATWDGYIGPLPMDNTPRSTWPEFYAEQRILPYLRRAADRGALTPGDVRLVEKVLDALDHLAGDPEPPARIHGDLWNGNVLWQDDGAVVIDPAAHGGHREADLAMLALFGLPYLDRVRDAYNEVAPLAEGWRARIPLHQLHPLLVHVCLFGAAYRTTLVDTARAALRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative fructosamine-3-kinase
publication title Crystal structure of putative fructosamine-3-kinase (YP_290396.1) from THERMOBIFIDA FUSCA YX-ER1 at 1.85 A resolution
rcsb
source organism Thermobifida fusca yx
molecule tags Transferase
total genus 94
structure length 288
sequence length 288
ec nomenclature
pdb deposition date 2008-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03881 Fructosamin_kin Fructosamine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3f7wA02
1.20.1270.240 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3f7wA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3f7wA01
3VULA 4EUTA 1CKIA 2IPXA 3FLWA 3AD4A 5A54A 5M4IA 2CGVA 2DWBA 2X0GA 3C4FA 4M68A 4MK0A 5KE0A 3SXFA 3SLSA 4DGLC 3GNIB 3ZLSA 4YO4A 5L8LA 2WEIA 1L8TA 3EQHA 4WO5A 3VO3A 5CT0A 5CEQA 1KOBA 3HUBA 4JR7A 2JITA 4A9UA 4KSQA 5AX9A 2X7GA 1IASA 4C38A 2VUWA 4JQEA 2P4IA 3PP0A 2A19B 2BRBA 3QYZA 4YHJA 4FT3A 4M84A 5DNRA 5GHVA 4HYUA 5BVNA 5CALA 5I9XA 2VGOA 3VBTA 3SRVA 5C8NA 4Y85A 4S31A 3VBVA 2WMAA 2QHMA 1XBAA 4AP7A 1YOMA 4FV2A 3V51A 4BCMA 3ZLYA 5DBXA 5IQAA 4GJ2A 4LUDA 4JT3A 3ZO3A 2IZSA 4A06A 4ZY4A 3TUDA 3P79A 4L3LA 3SXSA 2CMWA 3UC4A 2P3GX 4AQCA 4BRXA 3IW4A 1PKDA 2JAMA 4GU9A 3RNYA 3NW7A 3R04A 5AP3A 4RVLA 2Y0AA 5E8ZA 4BZDA 1X8BA 2UW6A 3UNKA 5CEKA 5LCKA 2BZHB 3MY1A 5EHYA 1BMKA 5EW8A 4L67A 4F65A 4EUUA 5AIRA 1BL7A 2XIKA 4R3RA 1P2AA 2DS1A 4QYGA 2PE2A 4H39A 3DXNA 3A62A 3QCQA 2PZPA 4NIFB 3W33A 2W1HA 5IZFA 2RIOA 1KE5A 2GU8A 3WZEA 3PXRA 1YI3A 3BV2A 3ULZA 2HW6A 3A99A 2YITA 4AN3A 4UYAA 4FV9A 5FDPA 4U80A 5EKNA 3AGLA 3GU4A 3FMHA 4O0SA 4MXOA 5KMJA 5HO7A 4ALWA 2VU3A 4QPMA 2OJGA 4ZTLA 3COMA 3LIJA 3C1XA 3FXXA 3VUGA 4YC8A 5L6PA 3DQXA 3BIZA 4CFFA 1EH4A 1ZXEA 3UO4A 5M4UA 4H1JA 1XO2B 5GIPE 4C57A 4LRJA 5EYCA 1MQ4A 4GMYA 4FSUA 5M51A 2W1CA 3Q4CA 1UNLA 4R7BA 3UE4A 1REKA 3RK5A 2VTPA 3RP9A 4ZTNA 5EHLA 4D58A 5H2UA 2YM4A 3C5IA 2NP8A 3KY2A 5ANGA 5E90A 3GFWA 4YP8A 2YHVA 3R21A 5DEYA 2OXYA 2GS2A 3V6SA 1P5EA 1FMOE 4V0GB 4AA0A 3ALOA 5FD2A 4MXCA 3W16A 4AZSA 4DLIA 2QO9A 3VWAA 1CM8A 3MS9A 4FIHA 2GSFA 3OXTA 2QOCA 3QTIA 5DFPA 5AUVA 4GK2A 1RE8A 3UPZA 4EWQA 2ERZE 2X7FA 3LVPA 5CI7A 3HEGA 5HEZA 4Q2AA 4ZZNA 3E63A 3NWWA 4QMXA 3R8PA 4QD6A 5EHOA 3FMDA 4ASXA 2XB7A 3QKMA 2VTRA 1H24A 2C69A 4HNFA 5FXQA 5IQCA 2CLXA 3CTJA 5JT2A 1MRYA 5CSHA 4KINA 4APCA 3AT3A 3G6GA 4YZ9A 2YA9A 2XK7A 1MUOA 4WBBB 5E8SA 4CT1A 1VEBA 5J5SA 3RPSA 4OR5A 5IH4A 4OTRA 5AP2A 3KN6A 2WZJA 4P5QA 4RWJA 4FSNA 4XV2A 5J1VA 3DK7A 1Q8TA 2EUFB 5JFWA 3EZRA 4LGGA 3LZBA 2C6IA 4NZWB 3IPHA 4C35A 1A9UA 4EH9A 2VNWA 3ORPA 3N4VA 1J7LA 1YHSA 4OBOA 3WOWA 2V7OA 5ANEA 1FPUA 2XM8A 3JR1A 1YXTA 1ZAOA 3H0ZA 2QU6A 3NNXA 3HA6A 4GFOA 5IH6A 3U87A 3KREA 3T9TA 2X8DA 4CYIA 4I6BA 2JBOA 3UOLA 3TV4A 5KMIA 1IRKA 5BVDA 5A9UA 1OKWA 1A48A 1ZYLA 2WU7A 4I1ZA 5GZ9A 3PDTA 4G6OA 5L6WL 2O63A 4JAJA 4XH6A 4D5HA 5CEMA 3G5DA 3K3JA 4S33A 1GAGA 2A4LA 4XBUA 4BBFA 2VGPA 1R0EA 3EQGA 4U5JA 1JOWB 4IAKA 3R9HA 3FXZA 4BKJA 3RI1A 3E8EA 4O2ZA 3LOKA 5D9HA 4L6QA 1KE6A 3P9JA 5J9YA 2XNBA 2VV9A 3HV6A 4J99A 4BHZA 5IQIA 4QP2A 4G9RA 2BRNA 4AZWA 1YHWA 4ITHA 3UVQA 4V04A 1RW8A 2YERA 4HVIA 2BMCA 3R1SA 2OJIA 3PIZA 4BY9E 3FXWA 4EJNA 4IZ5A 4K1BA 3MV5A 5AR7A 4IACA 5KZ0A 3DZQA 4AW2A 4JDHA 2JIVA 2PMLX 4KABA 3V5LA 4GW8A 5AP0A 3R7GA 3GQLA 4D4VA 4FKLA 4JDJA 2JD5A 4PP9A 4XUFA 4AACA 3BGPA 3F3TA 2RKUA 2VTSA 4I41A 4QMOA 2XEZA 4EK6A 2XK6A 2ZM4A 2OO8X 1MRUA 2OJFE 2UZNA 3VHEA 4X0MA 1P4FA 4A9RA 3UBDA 4QP3A 1ZMWA 4EJ7A 4DYMA 3FE3A 2B9JA 4FYNA 4LFIA 3HRBA 3GEQA 3QD0A 3QRTA 5CU2A 3PXYA 5CU0A 4YJRA 4PWNA 2VNYA 3ZCLA 4E4NA 4IIRA 1Q97A 1YWRA 5FLFA 5J5TA 5KMMA 4G6LA 4C33A 2BHEA 3KC3A 4YZNA 3PLAE 4NIFA 3JS2A 4FF8A 4MAOA 3R7YA 1OMWA 3R28A 4CFXA 4FTKA 2GCDA 4IVDA 3U4UA 2CKOA 2IVUA 4IWDA 2VTOA 3AQVA 5CY3A 4D28A 3RM6A 3ALNA 4DLJA 1G8SA 1QMZA 3K54A 3MTFA 1XHAA 1K2PA 3ZLWA 2IN6A 4TYHB 2GNJA 3A2CA 4E6CA 2OJJA 1L3RE 4U3YA 3RAKA 3PA4A 4QMZA 2PPQA 4QRCA 3DPKA 1T45A 1UV5A 3DBCA 4YJUA 4JRNA 2XKFA 3ZBFA 2YIRA 4BDKA 3RVGA 2YABA 3HV7A 3WF9A 2F9GA 1JBPE 3IW8A 4R3CA 3WI6A 4MCVA 3R2BA 3N9XA 4FTOA 1F5QA 3OUNB 1ZLTA 4RJ7A 4FV3A 3OP5A 4NCTA 4OTDA 3KXNA 2GMXA 4XJ0A 1OKYA 4RGJA 3D5XA 2VX0A 4YNOA 1ZY4A 2I0YA 4D2TA 2QO2A 4L9IA 4EQMA 3FMKA 4HGSA 3TV7A 2KULA 2UW7A 5HCYA 4TYEA 4C4EA 4CFNA 5IMEA 3FLZA 2EB2A 2A0CX 3FY2A 2YZLA 3MVHA 2HK5A 1SVGA 4F9AA 4EC9A 3D83A 1KE9A 3OF0A 4L00A 3DZOA 3U51A 5KMNA 5FTGA 2XP2A 3NUAA 5HVYA 3ZTXA 4EL9A 1Y57A 5D10A 5EDQA 4XG8A 5HG5A 4GL9A 4ZSAA 4ZTMA 3LQ3A 3QD3A 4BHNA 4FKQA 4U6RA 1ZMVA 4LYNA 4OTWA 2G01A 5B2KA 3V3VA 2JKKA 3VS0A 4F08A 5HG9A 3MFRA 4O7WA 3FI8A 4ZY5A 4A7CA 3KF4A 4W4XA 5AV1A 4D4YA 3OTVA 4GG5A 3QALE 2V62A 4TN6A 3AC2A 2OFVA 3Q4UA 3NIEA 4CZYB 4FEXA 2OIQA 2WD1A 4IE9A 4YUQA 2Y4IC 1M52A 3NW5A 4FVQA 4PPAA 4DEIA 2REIA 5CAVA 5D41A 3JY0A 2R3HA 2UZBA 2XS0A 2E9NA 3KVXA 3VS7A 3Q3BA 2QR8A 2ERKA 4IQ6A 3UOHA 5IA4A 3O51A 3PVUA 3V8WA 3L8PA 4CSVA 4DFLA 3GU5A 1ND4A 5AAGA 3ORMA 1WBOA 5DLSA 4AGWA 4R5YA 1WAKA 4PUZA 4AZVA 5GZAA 3UOJA 3QD4A 5J1WA 1XWSA 4PF4A 2YM7A 3D0EA 4C2VA 4D9UA 4NEUA 5EI2A 5F94A 3MDYA 2WU6A 2XMYA 3CS9A 3PP1A 4FICA 4FZ7A 4AX8A 5CF6A 4ALUA 2OU7A 2QKWB 3NGAA 5FBNC 3HMNA 1CSNA 4QYHA 2J0JA 4LRMA 4OTQA 3BU3A 4ACMA 5FEDA 3R8UA 5JQ5A 2XJ0A 5CNOA 4IBMA 2ZAZA 3Q5IA 5HIBA 3TNIA 4LGDA 3VS3A 4HW7A 2A1AB 3FZ1A 5E8WA 5I9VA 4BR3A 4JQ7A 3OCSA 4LMNA 2UV2A 1OIYA 2W9FB 2YFXA 4UMTA 3RCDA 2VTMA 1B6CB 3MYGA 1FVVA 5J8IA 4UWBA 3F2AA 4I24A 4KS8A 5AAFA 3ZC5A 3R1YA 4RFZA 4RC4A 2F4JA 3V04A 5BX0A 1PXNA 4G5PA 4AUAA 3HA8A 4ZJJA 2GPHA 2I0VA 4DG3E 3OXIA 4XEYA 3QRJA 4YPSA 5AX3A 2BKKA 2PYWA 4A9SA 4E4XA 2VWXA 3MN3A 5HTBA 2W17A 2XVDA 2QQ7A 4IAZA 4IM2A 2J0IA 2G9XA 4PMMA 5J95A 4EC8A 3QTWA 1K9AA 3Q6UA 2OKRA 3W2OA 2GQGA 4KIOA 2J50A 4R7HA 4CV9A 4WG5A 4NJ3A 1LR4A 2ITZA 2ONLC 3KEXA 1VR2A 2J0KA 3UNZA 1FGKA 4A4OA 4O86A 5IUHA 4BCJA 2Z02A 2BHHA 3OVVA 4LG4A 1H0VA 4D1SA 2X4ZA 4MBLA 1IEPA 4AU8A 4PRJA 3BGQA 4PX6A 4E7WA 2Y4PA 3H10A 5EFQA 4IFCA 5FGKA 4NU1A 3QZGA 5AWMA 4UB7A 4UV0A 1K3AA 2B53A 4O0XA 4FEWA 2GHMA 2PE1A 2R3FA 5DT0A 2RFNA 2QCSA 5EYMA 4TYHA 4CG9A 3IO7A 3O71A 4JIAA 5G1XA 2R3QA 4IAAA 3QXOA 4MF1A 1V0PA 1ZWSA 5ETAA 3SA0A 4YO6A 2Z7LA 4DH8A 1V1KA 3P23A 4DBXA 1NVSA 3LFCA 1OI9A 1W98A 1OM1A 1ZYJA 2RSVA 3UYTA 3BX5A 2XM9A 1URCA 3IW6A 3I1AA 4FZDB 4Y5HA 5ACKA 5AADA 3SOCA 4YJTA 1IG1A 4C58A 3DJ7A 4BZNA 1XH9A 1WBPA 4E4LA 2WTDA 4J71A 4BIBA 4C59A 5A4EA 2P0CA 4YLLA 2FUMA 4U42A 5CTPA 2C30A 4JIKA 3VNTA 4O7ZA 4U97A 4CVAA 3ODZX 3VIDA 3KMWA 4M12A 4F7LA 4E5WA 1PJKA 4V01A 2JBPA 1P4OA 4IB5A 4NL0A 3ZM9A 3Q4ZA 5ANOA 2H6DA 1H26A 4R5SA 2OZAB 3REPA 5HORA 1IR3A 2C1BA 4EKKA 3CPBA 3D7TB 3EQBA 2H96A 4GG7A 4O22A 4QMPA 2YJRA 4RQKA 5HE0A 2CHLA 1PXIA 5HOAA 1T46A 4IH8A 2JDOA 5I9UA 4AF3A 3C5UA 3DNEA 3TUCA 3HAVA 3C51A 2VWWA 3TG1A 3TM0A 1WBWA 4ZOGA 4B8LA 4PTCA 5DI1A 4QMYA 1ZZLA 5EOLA 3G6HA 3DK6A 4ENXA 2VX3A 2NPQA 3TIZA 4CFWA 4FEUA 3Q2MA 4F7JA 2E9OA 3E7OA 1BI8A 2QOOA 3KA0A 3NPCA 5AUXA 1KE7A 5LWNA 3TZMA 4O7NA 3I7BA 2JFLA 3VF9A 4XS2A 1WBSA 2UVXA 3MJ2A 3UMXA 4K33A 2ITXA 1GOLA 2XCHA 4HPTE 4FKUA 4C4FA 3GOPA 3DFCB 3KKVA 4J7BA 4RMZA 5JSMA 3QRKA 3DGKA 3Q4TA 1LEZA 4IJ9A 4RG0A 3TNQB 5M4FA 3QQKA 4RIWB 4JI9A 3SQQA 3TI1A 4BBEA 4EOKA 2XNEA 2BIKB 5J9LA 3TT0A 1OL2A 3KRXA 3BRBA 3L1SA 4MNEA 5FTOA 4NWMA 4F9BA 3R1NA 5HNIX 1RQQA 2HYYA 4W8DA 3ROYA 4OBPA 4KS7A 1Y8YA 2I0HA 4O38A 4LOQA 5DYJA 1Y6AA 1M7NA 4FK6A 4RJ6A 4U0IA 4XG3A 3UMWA 5AEPA 2X1NA 5FP6A 3UNJA 1ZMUA 3AMAA 4LOOA 4GYIA 2RFDA 2JC6A 5FWKK 1GNGA 4FOCA 4X2FA 2OF4A 5JRQA 3BBWA 5LVOA 2VWVA 3DK3A 3VW6A 3WZKA 3DU8A 3FC1X 3BHUA 2X8IA 3FLYA 2B4SB 2R64A 4MH7A 3FI2A 5IQFA 4FVPA 3DY7A 3SRVB 3G0EA 5CSXA 3Q32A 4XRJA 3FZTA 3FLQA 3PVBA 3G33A 3VHKA 1PYXA 2X2LA 5I3OA 2CDZA 4M14A 3T8OA 3OCBA 2C0OA 4XNEA 3WBLA 4ERKA 3DBFA 5C4LA 5HICA 4X2KA 4BIEA 2WHBA 4USDA 5A4CA 5JFXA 3TUBA 3WZDA 4J98A 2W05A 5AR4A 3N51A 5HHWA 4FC0A 5KKRB 2VAGA 3CEKA 3F5UA 3L8VA 5AJQA 4EH5A 4JLCA 2ZYBA 4BCFA 3GCVA 5ANKA 2P33A 3BYUA 5KX8A 5HO6A 4PMTA 3RPYA 5JGDA 3R7UA 4YTHA 3KRLA 1R1WA 3PY0A 3OMVA 4O1PA 4IB3A 4WD5A 5H8BA 5HE1A 4DG0E 5E1SA 1ATPE 3I0OA 4EZ5A 4EORA 2ZMCA 2WEVA 3QF9A 4F6SA 3ZFXA 2C5VA 2CJMA 3OW3A 4M97A 3BV3A 1P14A 3C9WA 3JY9A 2XJ2A 3QD2B 2C5XA 5HD7A 4QMTA 3VS2A 2J2IB 3DCVA 2B52A 3ENHA 3KB7A 3MWUA 4J1RA 4YZDA 3FI4A 4O7RA 2F7ZE 2BAQA 3EL8A 3B2TA 4DF3A 3EN6A 2I0EA 4O0TA 5A4QA 3VS5A 3BYVA 4UMRA 3EFWA 2R3MA 2XKCA 5DT3A 3WE4A 4UN0C 2VTNA 4YURA 3R9OA 3RK7A 2HWPA 4EH7A 3ZMMA 3OTUA 5EKOA 4DEEA 5HG8A 4FKIA 4G34A 2OZOA 4I3ZA 5HLPA 4WNKA 3O7LD 4UMPA 4L8MA 2O64A 4UWCA 3WARA 1PXOA 3D5UA 4NM7A 3LQ8A 3OD6X 3TKUA 2IO6A 2G2IA 3GCQA 4K18A 3TL8A 4BTMA 2I1MA 2GHLA 4M3QA 2W5AA 5IA5A 4IM0A 3MFTA 3D15A 3VBQA 3DNDA 1F3MC 4NUSA 5L2QA 4R78A 3ZFYA 2XK9A 1DAWA 3EN7A 4ZSEA 4GKIA 3QWKA 2H9VA 2XRWA 5BMMA 4ANOA 2J90A 2OH0E 5DA3A 4IDVA 2ETMA 3HX4A 1OECA 2PY3A 4OT5A 2Y7JA 3R1QA 3MVMA 4R1YA 5BVOA 4ACHA 2BR1A 4U9AA 4C4GA 4EHZA 3P0MA 3HL7A 5CEPA 1DI8A 1QPJA 5F95A 3FEGA 4XV9A 3NNVA 4O7VA 4GH2A 3WIGA 5E8VA 2PUUA 3G90X 4KB8A 5EDPA 4G3CA 2PVHA 3E87A 5DN3A 4LI5A 5IQHA 4MD9E 1IAHA 3O50A 2QOIA 2XKEA 4E20A 5KHXA 3TKIA 1H1QA 2CCHA 3ZUTA 2X39A 4PMSA 3BU5A 3EQPA 3GC8A 4FTIA 4B7TA 2X81A 3AXWA 2IW9A 4FT5A 3ZU7A 4CZUA 4RIWA 3OT8A 5HNGA 5I3RA 4W9XA 5J87A 4RIYB 5CF5A 3FUPA 4S34A 2WXVA 1UVRA 3E64A 4DHFA 2HENA 2HZIA 3FYKX 4B8MA 3QC9A 4MD7E 1NVQA 3FZOA 2J0LA 3CP9A 3UZRA 2QOKA 4I0SA 3KCKA 4CGAA 3NAXA 2X4FA 1TKIA 4E3CA 2IVVA 2ITYA 2V5QA 3R7VA 5HTCA 4O7YA 1OUKA 3QZHA 5LMKC 3F2RA 4DEGA 3D2KA 1BI7A 2WKMA 5C9CA 2ACXA 5AMNA 3NRMA 1PHKA 1XR1A 1S9IA 3F61A 4GVAA 4NJDA 2QONA 4FNXA 4QNAA 4BBMA 2OI4X 3O0GA 3C0IA 4GK3A 1BKXA 3VUKA 5CF8A 4FGRA 4QP6A 3HYHA 1PMVA 3LFEA 4UZHA 5T6KA 3E92A 3IDPA 3A7JA 4J53A 3RAHA 4FTLA 3TZ8A 3G2FA 2ESMA 3GFEA 4TNBA 4CFVA 2PWLA 3OZ6A 1QCFA 4NFNA 4CYJA 3QTUA 5K4IA 1Q5KA 2QLQA 4K2RA 2WQMA 3VF8A 2WIPA 3K3IA 4ANBA 4D4SA 2W99B 2BDFA 2BAKA 4FK3A 2W1IA 3PSDA 4QQJA 1TQMA 5DHJA 4XCUA 3E5AA 2R0UA 2WQBA 2QODA 1SNUA 2QC6A 3E93A 3FI3A 3PUPA 4JG6A 4MF0A 4FMQA 4OGRA 5CU6A 4KSPA 5HLWA 2Q83A 3NR9A 5TO8A 3NUSA 2WAJA 4DFBA 3LXKA 4ASZA 3ZZEA 3CKXA 3QCYA 4H3BA 3FL5A 4RIOA 4CKIA 3MBLA 3UDBA 4FNWA 5L6OA 4PPBA 2YM5A 1ZY5A 3VBYA 3I6UA 3MIAA 3Q6WA 5L3AA 4I6QA 1TQPA 3NSZA 4DFYA 3ZLXA 2ZV9A 3U6HA 3ORKA 4G16A 3PXQA 2B55A 4DFXE 3EWHA 2WMTA 3R22A 4FKOA 4FSMA 4QYFA 2B9HA 4Y73A 3BZ3A 5CNNA 3WYXA 2B0QA 4IAIA 3HV4A 3KRRA 4JBOA 2ITUA 3TNPC 2NO3A 2YEXA 3V5QA 5KO1A 4OW8A 3PWYA 3P7BA 5K9IA 4K11A 3DXPA 4WNOA 3MPAA 2X7OA 3FMMA 4FVRA 4NT4A 4BFMA 2Z7SA 2BRGA 3ETAA 3Q53A 4IZYA 1MP8A 1Q8ZA 2WELA 3AGMA 4M69B 2XKDA 4KNBA 2XNOA 5HE3A 3VQHA 2QOQA 3G0FA 5CQUA 1J7UA 2DQ7X 4I4FA 1J3HA 4F0GA 3MY0A 2GNIA 4ZEGA 3FKLA 4ZMEA 2YDJA 3U9NA 4C4HA 3PPJA 4XHKB 1OL1A 4CRLA 4FKJA 4OAVB 4BKZA 4MQ2A 3MESA 3DS6A 3PPZA 2O0UA 4LL0A 3S3IA 2RL5A 4FSWA 1XH8A 2YIXA 3CJFA 3V5JA 2H34A 1OB3A 3D2IA 2YAKA 5HO8A 3WZJA 2UW8A 5FBOA 3VJOA 1Y6BA 4FTAA 5IQBA 4N6ZA 2JKQA 4I23A 1FBNA 4HOKA 4A4XA 4BWXA 2PMOX 3PE2A 2GNFA 1JSVA 3CSVA 3PWDA 4IFGA 4IMYA 4CD0A 2W7XA 1O6YA 4E5BA 2C5OA 3C4EA 4I93A 3ZSHA 1UU9A 4K0YA 3GBZA 5GJFA 2OJ9A 5F4NA 2HXLA 2VTLA 4UZDA 5JGBA 1OL7A 1YXVA 5TOZA 3MPTA 2V0DA 2XNMA 4FODA 4JR3A 3RBWA 4TYJA 4Q5EA 2PMNX 3JXWA 3SX9A 3EN5A 3NYOA 2IZTA 4HGEA 5CENA 3R8MA 5EM7A 3ORZA 3EFKA 3L9MA 3OOMA 2AC3A 3E88A 3DTCA 4QTDA 4EYMA 4E1ZA 3BHYA 1J1BA 4FIEA 4QO9A 5HVJA 2W1EA 3VVHA 4EQCA 4O84A 3IDCA 5CI6A 5E8UA 4R8QA 1Z57A 3KMUA 4DT8A 4U81A 1GZKA 1GZOA 4HYSA 3OUKA 5AA9A 4RIYA 2YWVA 4O0VA 3II5A 5JFVA 1PXMA 3OY3A 1GZ8A 2B1PA 2VO0A 4ZJVA 1XBCA 4P2KA 4XP3A 2PVFA 2UZOA 4QMVA 3RPVA 4CKJA 3NUYA 4FL2A 2UZDA 3RM7A 2X6DA 1UNGA 3BEAA 4BI0A 4HVSA 2SRCA 2PZYA 3EQIA 3W2PA 2NNWB 4NM3A 4MNFA 1REJA 2X8EA 3SXRA 3HNGA 3NDMA 2IJMA 2OGVA 3LFQA 3SD0A 4AGCA 3OC1A 2WMBA 5CYIA 4EKLA 3EN4A 3ACJA 5DR6A 3EQCA 4J95A 4L52A 4BDDA 4FTTA 4G9CA 5CZHA 5K3YA 1NVRA 2XIRA 5ANIA 2BFXA 3F82A 4BI1A 3L9LA 3POZA 4AT3A 4EH2A 1ERKA 1IA8A 3UP2A 4C2WA 2FB8A 3QQUA 4DCAA 5EI6A 4BTFA 3DXQA 4U79A 1S9JA 4GCJA 1G8AA 3ZRMA 2BILB 4EH6A 1Q61A 3OS3A 4X21A 1G3NA 4L3PA 2CGUA 3A4PA 3UP7A 4USFA 5LCJA 4DH3A 3COIA 1W84A 4F9WA 4IHPA 3CC6A 3NVKI 2X9EA 4EOJA 4YZBA 3F69A 4ZXTA 1JKLA 2C3KA 1BUHA 4TRLA 4ANMA 5AM7A 4QTCA 1UKIA 1J7IA 5HVKA 1XH5A 4IX6A 3RK9A 1Z9XA 3SOAA 1CKJA 4YTCA 3OWKA 4I21A 4ZSLA 3WF6A 3ZRKA 2CKPA 2BKZA 3PY3A 4LRKA 3NX8A 4Y83A 5C8KA 4AGUA 3WILA 3HECA 1O9UA 3I0QA 4U41A 4AOIA 4GIIA 3W8LA 4Q9ZA 2JDSA 2OBJA 1NXKA 3O17A 3I5ZA 3SAYA 5FQDC 3CXWA 1ZOEA 4BN1A 4NSTA 3QYWA 4O0WA 5EH0A 2PVMA 1YI6A 3MY5A 5L2TA 2UVYA 4U3ZA 1SM2A 5I9ZA 3RTPA 2PZRA 3JVSA 3NYXA 4U40A 4P90A 4RWKA 2RGPA 2HCKA 3R7OA 2QHNA 4RZVA 3FZRA 3W8QA 1NY3A 4RLLA 4O7LA 1Q3WA 3TZ7A 4M7IA 3UOKA 4XV1A 4FV7A 3QKLA 1HOWA 2YWPA 3GT8A 3NS9A 1UWJA 3Q9YA 4FKVA 4F63A 5BUJA 5GNKA 4H05A 5E9EA 5L2IA 2QNJA 3ZXTA 4M69A 4CEGA 5DWRA 2OW3A 2R0IA 4FT7A 5CSPA 3SGCA 4C0TA 4Z7HA 2RG6A 5ICPA 1CMKE 4QMLA 3QU0A 3RINA 4FZAB 5TF9A 5E92A 1WVWA 3UPXA 3NZ0A 4YJPA 4IM3A 5EDRA 3BHVA 2GNGA 4QMSA 3TV6A 4KRCA 1UWHA 3A61A 5IQEA 4IZAA 4DAWA 4RBLA 4PDSA 3ZS5A 1IA9A 2GFSA 2HZ0A 4A07A 2J5EA 1DI9A 1I44A 4HJOA 2YIQA 3LJ2A 3SG8A 5BUIA 3K2LA 3QKKA 3C7QA 1APME 4CTCA 4BCGA 4D9TA 2G2FA 4F0IA 3PE1A 2YDIA 2EXMA 4UYNA 4GV1A 3ATSA 4ZSJA 4DH1A 3OEZA 1KE8A 4CMOA 3GQIA 4FSRA 5GJDA 3ODYX 5KZIA 3ZSIA 3A8WA 3BLHA 3B2WA 4X2GA 2W06A 1FINA 2C3IB 2XYUA 2WPAA 4D55A 3MTLA 3MA3A 3NNUA 3THBA 3EHAA 3ZBXA 1MRVA 4FV4A 4YLKA 4WBOA 2BIYA 2YM6A 2VN9A 4FYOA 5AR3A 5HBEA 1YHVA 2ZM3A 5HBHA 4BCPA 3Q2JA 4NM0A 4AFJA 4WNMA 4X2JA 2WMVA 1JKSA 2C6EA 3U8WA 4BKYA 4FNYA 3OY1A 4HVGA 3RAWA 4NTTA 4N70A 5K4JA 2GHGA 3KF7A 5BQ0A 5LJJA 2ETRA 3NUPA 3O8PA 3RHKA 5BMSA 1W82A 2Y4IB 3DDQA 2O3PA 3HRFA 3A60A 2YLEA 3VJNA 2R2PA 4B99A 4MNEB 2GDOA 3DV3A 1OL5A 1Q24A 5DT4A 1H8FA 2VWBA 3EL7A 4H1MA 4LV8A 4MBIA 3S4QA 1WVYA 5E91A 3ZDIA 2R3IA 4CNHA 4DC2A 5KUPA 4QMMA 3QGWA 3FMNA 1ZYSA 2XRUA 1WMKA 2VX1A 4X7QA 4DFZE 3T3UA 4FTCA 1NA7A 4FA2A 4I94A 3UVRA 4TYIA 5J9ZA 3DAEA 5EM8A 1QPEA 4FL3A 1SNXA 4FOBA 4ITJA 5FXSA 3D7ZA 3LFAA 3F5XA 4FUXA 4X3FC 3IW7A 4YHTA 3G15A 1U54B 5BVFA 5IA2A 4PL5A 4EYJA 5AUWA 5M4CA 4NK9A 2H8HA 1H1PA 5EW3A 1XH6A 2XH5A 3GXLA 3H3CA 3LFDA 4U45A 4E8AA 4IB0A 4D1XA 3FLSA 3O8UA 3UC3A 1Q3DA 2XIZA 4O0YA 4GS6A 4YJNA 4F6WA 4N57A 2R9SA 3MVJA 4BYJA 4PMPA 4FSYA 2PE0A 4KAOA 2JGZA 3WF7A 4PNKA 4Y8DA 3K5VA 4QP8A 4IB1A 2GTNA 5IH5A 2PU8A 3ELJA 5HZNA 2CGWA 4R77A 4J8NA 4ZK5A 3O96A 5CAUA 4O96A 5JN2A 3F3ZA 3FZSA 5H9BA 3UO6A 1OIRA 3OFMA 3COKA 3IGOA 3SKCA 2C6OA 5CX9A 5K0XA 2WTKC 2X2KA 2ZOQA 5J7HA 4MTAA 1LP4A 2IW8A 2ITOA 4ID7A 5D11A 2VTAA 4DG2E 4I5MA 2C5YA 3V5PA 3R9RA 1NW1A 4J8MA 2VWZA 4F4PA 2CSNA 3FKOA 2UZTA 3L8XA 2VO6A 1GZNA 1LEWA 3VS4A 1Y91A 4W8EA 5TT7A 2FSOX 5E7RA 2C4GA 1O6KA 5IEXA 2C3JA 3QHRA 2CKEA 3P1AA 5BPYA 4BYIA 2PHKA 2C0TA 4TWCA 4JOAA 3VUDA 4BB4A 4C02A 1JSTA 1KV1A 3R00A 4FKRA 3H30A 5I9YA 3BEGA 4GU6A 4DH7A 3SG9A 3KRJA 4M0YA 5B7VA 4MVFA 2Z2WA 3M11A 5BUEA 5AIKA 5AP5A 4IC8A 2RF9A 4TWOA 3SW4A 1YWVA 4DGNA 1BYGA 4NTSA 1YXXA 1PXJA 3VW8A 4E6DA 4KUJA 3MJ1A 3VUTA 2WTJA 5TKDA 5D7AA 2KTYA 3RPRA 3BE2A 3PA3A 4IW0A 4OTHA 5M07A 3OOGA 2J4ZA 4F64A 2E9UA 2PSQA 4GT4A 3E8DA 3CQWA 4ZTRA 4OT6A 2AYPA 4OBQA 5EOBA 1E1VA 3KMMA 2BPMA 5IISA 1QPDA 4FSTA 5F9EA 4RPVA 4IEBA 4QT1A 1SMHA 2PVLA 2WTVA 1GJOA 2EU9A 2OK1A 2QVSE 3I6WA 2Y9QA 2FO0A 5JMSA 4MD8E 1PXPA 1CKPA 3EB0A 4LGHA 4QTEA 3H9FA 2CNUA 4DCEA 3DQWA 3IG7A 5C26A 2Z8CA 3TIYA 5LMBA 5HX6A 4C4IA 2J51A 3MB6A 1U5QA 3T9IA 5LOHA 4HNIA 3R7EA 2VD5A 3BLRA 3QQJA 4J96A 3BHTA 3PJ3A 2XZSA 1UA2A 4F70A 3DBEA 3CD3A 3NYNA 1YVJA 5CZIA 1JWHA 4WKQA 3ZXZA 4TXCA 3HV5A 2R5TA 3G51A 4FSZA 1OPLA 2UVZA 3R9DA 3UZTA 3DDPA 1M2RA 2CKQA 5EYDA 2BAJA 2UZWE 2JIIA 3Q52A 5DVRA 5I9WA 4Y72A 5M53A 1YXUA 4R7IA 2IZRA 2AC5A 3HAMA 3I7CA 1U59A 4QP4A 4AW0A 2GFCA 4D4RA 4DEBA 4UEUA 4WA9A 5ITAA 4PV0A 4CZTA 3I60A 2UZVA 3UVPA 1YW2A 2FGIA 4Y46A 3UYSA 2W4KA 4C36A 2J5FA 4S2ZA 4RJ5A 2C0IA 2E2BA 2QOBA 5JRSA 4XG4A 4EK3A 3C0HA 3W32A 5JGAA 3KFAA 5HD4A 1YDRE 2QKRA 3LAUA 2PULA 3L9PA 3ORTA 2BVAA 2XIYA 4E5AX 5L4QA 3U6IA 2WMQA 2XUUA 3LCDA 4EOIA 2VZ6A 3FSKA 2OXDA 4BDJA 2IVSA 1Q8UA 5CEOA 4EH8A 3VUIA 4NM5A 4K8AA 2ZJWA 2EB3A 4FTRA 3FDNA 5I4NA 1U54A 4AGDA 3PXKA 3CE3A 3W2CA 5GZ8A 1WVXA 1Y8GA 3LJ1A 3W2QA 5DGZA 1WCCA 2P2HA 3BELA 2YCSA 2QURA 3ORXA 3P08A 4G3GA 3P86A 1U4DA 4H3QA 4I22A 3OHTA 3LXLA 2GQSA 4O1OA 2W5HA 3DKFA 3IOPA 2YM8A 4ZTHA 3O23A 4D2WA 3F5PA 4E6AA 4L7SA 2UZLA 4QMUA 1OUYA 4JBVA 4BGHA 4IANA 3MB7A 3EZVA 3CTHA 5M57A 3AC5A 2PK9A 3DKOA 1OKZA 4O2PA 2R4BA 2R3LA 4C7TA 5IUGA 1WBVA 4MWIA 3UIXA 3Q9ZA 4UALA 4CG8A 2ZDUA 4DEHA 4OAUC 3GCPA 4G3DA 3EQFA 5JZNA 4BCOA 3Q5ZA 2QOHA 2ONLA 2WOUA 1FQ1B 4FG8A 3TZ9A 4YU2A 5EQEA 5FM2A 4FGBA 3NUNA 4OTPA 4HZRA 5M55A 4MXAA 3ANQA 2OWBA 4FSQA 4JG8A 4UY9A 1M2QA 2WIHA 3OW4A 4GJ3A 4QYYA 5BYYA 5BVEA 3V8SA 4JRVA 4LOPA 4XG7A 1LPUA 1PMNA 3RAIA 4FTNA 4PTEA 4M8TA 5CT7A 1OPJA 3BE9A 3DBDA 4IJPA 3PSBA 4OLIA 4PPCA 4X2NA 5AM6A 3LHJA 4K6ZA 2IZUA 1JVPP 1VYZA 3EFJA 5L8JA 3HGKA 4R3PA 2QG7A 3A7IA 4FT9A 4QQCA 5LARA 4IX5A 5CF4A 4NW5A 3FQHA 4C3FA 4KBCA 5JKGA 3UO5A 2BDWA 3WE8A 3PZHA 4EOLA 1YDSE 1YDTE 2YIYA 3DAKA 4K9YA 1Q8WA 3LM5A 3SDJA 3NEWA 5AR8A 3PFQA 5F1ZA 1YKRA 4CCBA 4DGMA 3HKOA 4P7EA 1YWNA 3TNHA 2CPKE 2JKOA 3QTZA 3WF5A 3NAYA 3GI3A 4NW6A 3OCTA 3BBTB 4G17A 3BKBA 5CAQA 5K5XA 3KXZA 3OWJA 3CY3A 1H0WA 1RJBA 3DBQA 3JYAA 5J79A 2UW9A 2QOFA 2IWIA 5DPVA 1SZMA 3OWPA 2C6TA 3EQDA 2O2UA 4DE4A 4AW5A 4EI4A 1WZYA 3VS1A 4YHFA 2YN8A 3S00A 2J7TA 5C27A 2ITWA 3UJGA 4I0TA 3TACA 1Q99A 4AOTA 4F99A 1KUTA 4AZTA 3BYMA 3UIUA 3IGGA 5AR2A 3D9VA 3C4ZA 3MH3A 5JFSA 1F0QA 2VTTA 2XIXA 3PLSA 5KCVA 3QX4A 3QX2A 4AE6A 4PDOA 3FQEA 2XCKA 2XJ1A 5CLPA 2YZAA 4BC6A 3FQSA 4EZ3A 3QXPA 2PVNA 4CTBA 3U4WA 4BCHA 4IAFA 4J97A 2DUVA 4MKCA 4FV6A 4GIHA 4JQ8A 3VS6A 5AP1A 4ZY6A 3TJDA 2W9ZB 4FE2A 3TTIA 3KVWA 5HE2A 2W96B 3MIYA 3IOKA 4R1VA 5LVMA 3H9OA 4BF2A 1VZOA 1UKHA 4N0SA 4ZZMA 3QTRA 3AMYA 3ET7A 4YGAA 4EK5A 3GC0A 2Y6OA 3PPKA 3KXGA 1HCLA 3GOKA 3QCXA 1TVOA 3QLFA 4DEAA 1AGWA 3CGOA 3RKBA 4TW9A 4H36A 4IDTA 3HP2A 1O6LA 3W10A 4IWQA 2B54A 2HY0A 2R3PA 4O6EA 3TWJA 4M15A 3LLAA 1PKGA 5JQ8A 2I6LA 3S0OA 4O6LA 3QBNA 3FV8A 4YTFA 3EJ1A 2QI8A 3EYGA 1SYKA 3M2WA 1VYWA 3A4OX 4XOYA 2FH9A 3A8XA 5D1JA 5IF1A 5FUTA 2R7IA 4YNEA 4FT0A 4KD1A 4DFNA 3G9LX 5CVFA 2F7XE 4ZZOA 4HYIA 3EKNA 3TNWA 2F2CB 5HCXA 4CLIA 1OBGA 4CXAA 5ANDA 2BRMA 3ULIA 1URWA 4B4LA 4BZOA 4DTBA 2W1GA 4FNZA 3ORNA 4YJVA 2E9PA 5DMZA 2QO7A 4BDEA 2W0JA 4BCKA 3F2NA 4C3RA 5LVPA 5GINE 3KK8A 4WRGA 3FKNA 3GUBA 3W18A 5LXMA 5HCZA 1WFCA 2XNNA 4JL9A 5AV4A 5AFVA 3I81A 2WMXA 2R3OA 3C13A 2BDJA 1GIHA 2UUEA 4LV5A 3FMLA 3H0YA 3R7IA 2PZ5A 3LCOA 3GC7A 4U44A 3Q9WA 5DG5A 3VC4A 4IVBA 4RFYA 1DS5A 3AC4A 2JKMA 2YDKA 3BYOA 5CSVA 3QA0A 3QUEA 1J1CA 1PMUA 4RC3A 3RGFA 3LFSA 4NYEA 3GGFA 5E1EA 2PUIA 3ERKA 4F6UA 4F09A 1OGUA 3DJ6A 5C01A 5AAEA 3R30A 5HX8A 4ZMFA 2C47A 4I5HA 4HVDA 2WTCA 4UMQA 3OG7A 2F49A 3BPRA 4CT2A 2BTSA 4F7NA 3I4BA 1M17A 4B0GA 3H4JA 2HAKA 3IK3A 4KIKA 4ANSA 3E62A 3CTQA 1OVEA 5AP6A 1ZZ2A 1GIJA 2W4OA 4ANQA 4N6YA 5CANA 1V0OA 3PIXA 4YZCA 3RHXA 4RJ4A 5J7BA 5B2MA 1B39A 1PW2A 4MQ1A 4QQ5A 5HU9A 2Z60A 3PSCA 2O65A 1PY5A 3FMEA 4JX3A 4W9WA 4DH5A 4O7SA 3HUCA 3ZEWA 4DN5A 4XG2A 3D4QA 4RVTA 2JAVA 2RFSA 4HZSA 3VRZA 4S32A 4EBVA 3VN9A 4DTAA 2WO6A 1H4LA 3CIKA 4A9YA 2EXEA 5HLNA 4FTJA 4XG6A 4ZSGA 4LMUA 5HQ0A 2EXCX 3EFLA 4RLKA 4EBWA 1Z5MA 3Q60A 3LXPA 3E8NA 1UNHA 4RX7A 3EYHA 5FTQA 5G6VA 5IQGA 2WTWA 4D2SA 5CAOA 3GB2A 4K77A 2ZVAA 3GCSA 3E8CA 4IVAA 4ZP5A 4BDIA 4FEQA 5AUUA 5I0BA 1JPAA 1XH4A 1XKKA 3QLGA 5CXZA 2QU5A 4NCTC 3SHEA 3R8ZA 3LM0A 5KMKA 3EIDA 4ZAUA 3EH9A 3EN9A 4TPTA 3AT2A 4WSQA 4YC3A 4UXLA 3LQ5A 2JDTA 4H58A 3HMPA 5ETFA 4AAAA 1CDKA 3BLQA 2C5NA 2QD9A 3ANRA 1PYEA 2XK8A 4RIXA 3W2RA 4FEVA 3O8TA 2A2AA 3V01A 1XQZA 3HDMA 5TR6A 4L53A 2UW3A 4QP9A 2GNHA 2Y6MA 5IKWA 1PMEA 2DYLA 5E8TA 3V5WA 3FAAA 1IAJA 5HGIA 1FGIA 3IONA 4EH3A 3ZSGA 4L7FA 4HPUE 4X3JA 4USEA 4ONAA 4AW1A 4O83A 3KQ7A 3PJCA 4GT5A 3BWJA 2VWIA 3LW0A 5H8EA 4EOMA 4QMNA 2GS7A 4QOXA 3OXZA 3DTWA 4E4MA 3QAME 3PRIA 3ID6C 3GENA 4WNPA 5IA1A 5EW9A 3RCJA 2WQOA 1ZARA 4KKEA 3CLYA 1BX6A 2WMRA 3VBXA 2OXXA 3IDBA 1DM2A 4BDCA 4XYFA 3MPMA 4MX9A 3HDNA 2C6DA 3OWLA 4DGGA 5IPJA 3N4UA 3EOCA 4UBAA 3W55A 4C62A 4FTMA 4PNIA 5HTIA 4RX9A 3B8RA 2ITVA 3CKWA 5HIDA 4QQTA 4MWHA 4RX8A 5DR2A 4BDGA 3H9RA 3KK9A 2JIUA 4AN2A 3BHHA 3P7CA 4QPAA 3D14A 3NUUA 5C8MA 4JX7A 4CMTA 4GT3A 4UMUA 2JFMA 5B0XA 3PJ2A 4C3PA 4HCUA 3TKHA 5D7VA 4AA4A 3LFBA 4RA4A 5FXRA 4TL0A 5E4HA 3VUMA 5LQFA 1JKKA 2W1ZA 5HESA 1KV2A 5LMKA 3I79A 1SVHA 1A06A 2NRUA 4AZFA 4GYGA 3LXNA 3P5KA 4MHAA 4JDKA 5K5NA 3P7AA 3ZFMA 4D2VA 2BZKB 1TQIA 4CKRA 3IECA 4EZ7A 2J0MB 1YXSA 4YPDA 2UW0A 3LLTA 4OTIA 4AS0A 2UW5A 4L43A 1OIUA 2ITNA 4FG9A 5H8GA 2HOGA 3ZH8A 1H1SA 2PZIA 2ZM1A 3EKKA 3W1FA 3PIYA 4TZRA 1GY3A 3CJGA 3IKAA 3MH1A 4QTBA 4D1ZA 3KN5A 2IG7A 5IA0A 2HZNA 4G31A 4ANLA 3QC4A 2FA2A 3LCKA 5DR9A 3SC1A 3FJQE 3PG3A 3OROA 4QTAA 4EH4A 5BVKA 1KOAA 2Z7QA 4EOPA 5M44A 1R78A 2UZUE 3R0TA 1WBTA 3NIZA 3R73A 4L68A 4W4VA 5ETCA 3ORLA 5BYZA 5JK3A 3QA8A 4TNDA 4AG8A 2VWYA 3F3WA 4PL4A 2PVYA 4ZS0A 4GUBA 4Z9LA 4NH1A 5AA8A 5LWMA 3R01A 4FKTA 3OEFX 2YIWA 2I7QA 2HELA 2XA4A 5EQPA 4YTIA 2BCJA 2PVJA 3FLNC 3Q96A 2WMUA 1E9HA 5AR5A 3CR0A 3D5WA 2E9VA 3FC2A 2ZB0A 4Z7GA 5CU3A 2R3NA 4P5ZA 4ACGA 4BWPA 3KU2A 4EHGA 2VO7A 4UX9A 3OBGA 3UODA 5HU3A 5FM3A 3S95A 4YSJA 1XH7A 2IVTA 2UW4A 4ZLOA 5A6NA 4ACCA 2X2MA 4FIJA 2Q0NA 2GTMA 3RALA 4EONA 1OKVA 5IDPA 3O2MA 3QHWA 3QQLA 3L8SA 5M08A 5CASA 3DFAA 1STCE 1FVTA 2A27A 1JKTA 3PVWA 4WG3A 4D5KA 2QR7A 5AUYA 4ZTQA 3B8QA 2G2HA 3R2YA 3LJ0A 3NCZA 3W2SA 1AD5A 5FDXA 2R3JA 5JZJA 5ACBC 4BVUA 3SVVA 3ZM4A 3AC1A 3KGAA 3HMIA 4V05A 5ANJA 4MEDA 4AT5A 5IMXA 4NKAA 3F7WA 4EK4A 3EMGA 1H28A 4L01A 1H1WA 3AG9A 2HWOA 3DB6A 4Z16A 4D2PA 4DITA 4WUNA 4XLIA 4C61A 2J9MA 3AC3A 4BL1A 3G9NA 4MXXA 3U6JA 3BQCA 4I6FA 3TCPA 2OF2A 3A7HA 2ITPA 3QZIA 4TWPA 4TTHB 2QG5A 4U7ZA 4FBXA 4V0GA 4NFMA 2IW6A 4O0UA 2HZ4A 3TEIA 2W1DA 2YACA 1OZ1A 4LL5A 4L44A 5DEWA 5HBJA 4CV8A 1E1XA 5IA3A 3QCSA 2OLCA 4OTGA 1NT2A 3EQRA 1ZRZA 5T68A 2G15A 3GU8A 2QLUA 1XJDA 4BWKA 1B38A 3RWPA 4F1TA 3L9NA 3MSSA 3ZO2A 4RJ3A 2C6KA 5E8YA 3F7ZA 4YLJA 5T3QA 1UU3A 3MVLA 3DB8A 3ZOSA 2W1FA 5C1QB 5EYKA 1OPKA 3POOA 4ALVA 2GQRA 3PXFA 3VAPA 4CLJA 3OT3A 5AV3A 4WIHA 5DH3A 4JS8A 5CXHA 3QTXA 2QOLA 4RWIA 3DLSA 3V6RA 4HYHA 4PDPA 5JEBA 4TKSA 3NLBA 4JXFA 1Q62A 3CGFA 4FUYA 5D12A 3IW5A 2PTKA 3PY1A 5L2SA 3RZFA 4RSSA 2ZDTA 3DKCA 4ZTSA 4E26A 2WTIA 2ZMDA 4ZLYA 4DA5A 4EOQA 4F9YA 4XBRA 1PRYA 2W4JA 4RJ8A 2WGJA 3GU7A 1J91A 3BGZA 5H3QA 3FHRA 4AE9A 2LAVA 3RPOA 4GK4A 3BQRA 1FOTA 4BDBA 1KSWA 2C3LA 3KL8A 3ZYAA 4B9DA 4IVCA 1AQ1A 3VRYA 5A4LA 1R3CA 2XEYA 3E7VA 3QRIA 4YBKA 3R71A 4Z3VA 2PUNA 4Y95A 4XX9A 2F2UA 5EI8A 3ROCA 4QPSA 4ANNA 4PQNA 4DFUA 5A46A 3CBLA 2XBAA 4FKSA 4BICA 5IEYA 2PVKA 2CCIA 1GIIA 4CMUA 4M13A 3RWQA 1H00A 2C6LA 4IC7A 3ZRLA 5IEVA 1UU7A 4O82A 2YJSA 4GFGA 4WSYA 4G3FA 4XOZA 5FG8A 5EM5A 5FEEA 1U5RA 4O81A 4ERWA 4F1OA 3JPVA 4X3FB 4LM5A 4JDIA 4PP7A 3UZPA 3CQEA 3QGYA 4ZLZA 2BALA 2HIWA 2VRXA 3QTSA 2C6MA 3UGCA 1H01A 3M42A 2CLQA 2V7AA 3KULB 1MQBA 2BFYA 5F20A 3FSFA 4IWOA 4A4LA 4MXZA 3QQGA 4DINA 1W83A 1YI4A 2GNLA 3NCGA 4XG9A 3RMFA 3V5TA 3RZBA 2P2IA 2C68A 2FSLX 3BWFA 3GCUA 4WOVA 3CD8A 5EQYA 4L46A 4O91A 2EWAA 3Q9XA 4RFMA 4L42A 4YZMA 4MXYA 5KBQA 1H27A 3UTOA 2EVAA 1ZOHA 3CQUA 3FYJX 4CQGA 4EWHA 4LUEA 5HNBA 4MBJA 4Z55A 1DAYA 4Q9SA 4FKWA 2W5BA 4FIFA 4KIPA 3I5NA 4BTJA 4M67A 1BLXA 3ENMA 3HV3A 3QUDA 3GP0A 4AXAA 2WTKB 3C50A 4C4JA 1H08A 4RC2A 4TY1A 4EHEA 3KCFA 4BGQA 4EOOA 3Q04A 4GKHA 4YJSA 3DA6A 2CN8A 1V0BA 3F3VA 1HCKA 3PYYA 3MGYA 3AD5A 4FL1A 2XNGA 4JBPA 5I5ZA 2VTIA 5KBRA 2VO3A 4KA3A 4EEVA 3ORIA 4RVMA 3QFVA 4FG7A 4FTQA 1JQHA 3CCNA 3CPCA 3PA5A 3FL4A 4FKGA 2XK3A 3R6XA 1XBBA 3LFFA 4G1WA 4D2RA 1PXLA 3QWJA 3GU6A 4C34A 4ENYA 3ZC6A 3GC9A 4G5JA 4I92A 4FTUA 4BGGA 3FY0A 2YISA 3PJ8A 4XP0A 5A3XA 3F66A 4GVJA 1M14A 2B9FA 4AFEA 3QUPA 2RG5A 4H3PA 1FMKA 4IXPA 1R39A 5DRDA 2OFUA 4FV8A 1QL6A 4FZ6A 5C03A 5M06A 3D94A 3C4XA 4FR4A 4UWYA 3ZUVA 4I5PA 4KKHA 4FIGA 3JVRA 4WRSA 4XV3A 4O21A 5IUIA 4RQVA 5DRBA 4I0RA 4W4YA 3ZONA 1R0PA 3E3BX 4XMOA 4G3EA 3BYSA 4BDFA 5AV2A 4CFMA 4BDHA 3NW6A 2G1TA 4PY1A 4YR8A 1JSUA 1JAMA 3HMOA 1RDQE 3WZUA 4DGOA 3A7GA 3HVCA 5KMLA 3C0GA 3C4WA 1U46A 5M56A 2JEDA 4B6LA 4BCQA 1PF8A 4CFUA 4IADA 4I5CA 3WYYA 2RFEA 2HW7A 2WMSA 2YAAA 3LMIA 2XBJA 3ZDUA 3NNWA 3ZZWA 4IWPA 3A7FA 2B7AA 3KXXA 2O8YA 2WMWA 1Q41A 2ITQA 3MW1A 2PUPA 3N4TA 4IAYA 1W8CA 2ZV7A 3IQ7A 2WOTA 3QTQA 3QZFA 4GSBA 3FMJA 5TE0A 3PJ1A 4BTKA 5IG1A 5KMOA 5CAPA 3WIKA 3R83A 4FV1A 4FI1A 4RA5A 3FPMA 3JUHA 4BCNA 2AUHA 2R7BA 2VWUA 4WG4A 4FZFB 4YC6A 3HMMA 5A14A 4EK8A 3COHA 3PVGA 5IU2A 3PRFA 4CQEA 4RT7A 2OIDA 4JBQA 5HI2A 3RNIA 1JNKA 4D0WA 3MA6A 3AC8A 4KWPA 4HVHA 2WFYA 5GIOE 5CVHA 5FP5A 1FVRA 1YRPA 3C4CA 4O0RA 1VJYA 1YOJA 4KKGA 1QPCA 3AT4A 4F7SA 5LVLA 4AOJA 2ITTA 5B2LA 4YBJA 4ITIA 4XLVA 3PG1A 2OSCA 2YCFA 3D5VA 3U55A 3ACKA 3KXHA 3R9NA 3LKMA 3ZUUA 4QP1A 4E73A 3R8VA 4RVKA 5AP4A 4M0ZA 3NYVA 5EK7A 3P78A 3MH0A 4GFMA 5LMAA 4EOSA 3UQGA 3AMBA 2PL0A 3DKGA 3FBVA 4F9CA 3S1HA 1CTPE 5CS6A 4D0XA 1ZYCA 3U54A 2YCRA 4JNWA 4XRLA 2OG8A 3VUHA 5L8KA 4QMQA 3QL8A 1W0XC 4N4SA 3UG2A 2X9FA 2ZB1A 3DAJA 2VTHA 5K0KA 4X3FA 4AA5A 4LQMA 2Q0BA 2PVRA 3SW7A 2XF0A 4RZWA 3ATTA 2ETKA 1ZYDA 3KULA 3NUXA 3ZHPC 4ACDA 1OIQA 2I40A 4TT7A 2Y8OA 1BL6A 4G2FA 4PTGA 4ASDA 4F1MA 2CNVA 2CNQA 4RX5A 3HRCA 4OUCA 4OTFA 4Y5QA 2X6EA 4HGTA 4Q5HA 4BIDA 3UG1A 2WNTA 3KXMA 4QYEA 2BROA 1OITA 4S30A 4W4WA 4WT6A 3FPQA 4AT4A 4ZS4A 2BRHA 5E8XA 5KKRC 3TN8A 5CQWA 2R3KA 4U8ZA 3TDVA 3DT1A 4E6QA 2LGCA 4GEOA 3ZO1A 1H25A 3FHIA 2F7EE 4RWLA 3E3PA 5CEIA 2C1AA 4MYGA 4QMWA 2BUJA 2J6MA 5C4KA 1M7QA 3HZTA 4BI2A 4KBKA 4JVGA 4KIKB 5AP7A 3UQFA 3O7LB 4KIQA 1UU8A 3F88A 4WUAA 2XNPA 5GJGA 4AN9A 4E93A 4QNYA 3UQCA 2YLFA 3UIMA 4BCIA 5IQDA 2VTJA 3ITZA 4ZJIA 3WF8A 3PTGA 3S2PA 4JJRA 3M1SA 3F5GA 3DJ5A 4I6HA 2P55A 3CY2A 2WB8A 2YM3A 3AD6A 4FX3A 3ZO4A 4M66A 4C37A 5BYLA 4DBNA 4C8BA 2R3RA 2WQEA 5CVGA 4J52A 5IDNA 5EG3A 2JDRA 3FZPA 3KRWA 4GUEA 3MH2A 3OCGA 3NMUF 3R8LA 4EQUA 4HCTA 4IX4A 5LVNA 3DOGA 1OL6A 4PL3A 4DTKA 4YMJA 4JAIA 3PZEA 3TDWA 2O5KA 1H1RA 4ARKA 4CCUA 4O7TA 1YQJA 5AUTA 4O27B 3R02A 3AOXA 1ZOGA 4II5A 3HP5A 1H07A 5EM6A 3SV0A 4WHZA 5ETIA 3VQUA 2V55A 5FEQA 3BU6A 4L3JA 2ZV2A 4F0FA 4I20A 4IZ7A 3P4KA 4QP7A 3QRUA 5CU4A 4G6NA 4FKPA 4GRBA 2OICA 3BCEA 3QQFA 1WBNA 5DIAA 4AWIA 2NRYA 3LCSA 2Z7RA 3QQHA 3LCTA 3BI6A 3TXOA 4HCVA 5KNJA 3MFUA 2F57A 1OBDA 4CRSA 2HXQA 4RIXB 4YJQA 4A9TA 4BDAA 4TWNA 2OZAA 2FSMX 2V22A 3F9NA 3HLLA 4FV5A 5CWZA 3RJCA 2XYNA 5HKMA 3D7TA 3IS5A 5FRIA 1Q8YA 3TJCA 3UIBA 4ORKA 2BZIB 3R63A 4RRVA 5HIEA 1G5SA 5AUZA 3PXZA 2BZJA 4YSMA 2CN5A 2UZEA 2VTQA 5KHWA 4HGLA 2FYSA 2BTRA 1W7HA 3LFNA 3DLZA 3T3VA 3LMGA 4NKSA 4APPA 2GS6A 5HG7A 4DEDA 5A4TA 4UXQA 3U9CA 2XK4A 1JLUE 4KBAA 3MFSA 5DOSA 4L45A 5AV0A 2HY81 1M2PA 5A6OA 3V8TA 4YJOA 5L2WA 1SVEA 3F6XA 4FIIA 4AZEA 2OH4A 4IX3A 4XP2A 2YCQA 4ASEA 3ZEPA 3NVMB 4ZIMA 4X6QC 5BNJA 4JG7A 1KWPA 2JLDA 1PXKA 2ZV8A 1LUFA 4R6VA 4X6RA 4I4EA 3F3UA 4KRDA 1Q4LA 4P4CA 4PDYA 2FSTX 3K5UA 4TYGA 2OIBA 5DE2A 2JDVA 4EHVA 3VBWA 5BVWA 3GVUA 2WQNA 1YOLA 2B9IA 2PMIA 3OBJA 4DT9A 2FVDA 2R3GA 4U43A 3TTJA 3FWQA 5CSWA 3LMHA 5M09A 5JH6A 3MI9A 4FV0A 1I09A 3LPBA 3LE6A 2CGXA
chains in the Genus database with same CATH superfamily
3VULA 4EUTA 1CKIA 2IPXA 3FLWA 3AD4A 5A54A 5M4IA 2CGVA 2DWBA 2X0GA 3C4FA 4M68A 4MK0A 5KE0A 3SXFA 3SLSA 4DGLC 3GNIB 3ZLSA 4YO4A 5L8LA 2WEIA 1L8TA 3EQHA 4WO5A 3VO3A 5CT0A 5CEQA 1KOBA 3HUBA 4JR7A 2JITA 4A9UA 3L3OM 4KSQA 5AX9A 2X7GA 1IASA 4C38A 2VUWA 4JQEA 2P4IA 3PP0A 2A19B 2BRBA 3QYZA 4YHJA 4FT3A 4M84A 5DNRA 5GHVA 4HYUA 5BVNA 5CALA 5I9XA 2VGOA 3VBTA 3SRVA 5C8NA 4Y85A 4S31A 3VBVA 2WMAA 2QHMA 1XBAA 4AP7A 3W0QA 1YOMA 4FV2A 3V51A 4BCMA 3ZLYA 5DBXA 5IQAA 4GJ2A 4LUDA 4JT3A 3ZO3A 2IZSA 4A06A 4ZY4A 3TUDA 3P79A 4L3LA 3SXSA 2CMWA 3UC4A 3LMFA 2P3GX 4AQCA 4BRXA 3IW4A 1PKDA 2JAMA 3B52X 4GU9A 3RNYA 2X3VA 3NW7A 3R04A 5AP3A 4RVLA 2Y0AA 5E8ZA 4BZDA 1X8BA 2UW6A 3UNKA 1ST4A 5CEKA 5LCKA 2BZHB 2Q12A 2WYIA 3MY1A 5EHYA 1BMKA 3D2EA 5EW8A 4L67A 4F65A 4EUUA 5AIRA 1BL7A 2XIKA 4R3RA 1P2AA 3BUIA 2DS1A 4QYGA 2PE2A 4H39A 3DXNA 3A62A 3QCQA 2PZPA 4NIFB 3W33A 2W1HA 5IZFA 2RIOA 1KE5A 2GU8A 3WZEA 3PXRA 1YI3A 3BV2A 3ULZA 2HW6A 3A99A 2YITA 4AN3A 4UYAA 4FV9A 5FDPA 4U80A 5EKNA 3AGLA 3GU4A 3FMHA 4O0SA 4MXOA 5KMJA 5HO7A 4ALWA 3ER8C 2VU3A 4QPMA 2OJGA 4ZTLA 3COMA 3LIJA 3C1XA 3FXXA 3VUGA 4YC8A 5L6PA 3DQXA 3BIZA 4CFFA 1EH4A 1ZXEA 3UO4A 5M4UA 4H1JA 1XO2B 5GIPE 4C57A 4LRJA 5EYCA 1MQ4A 4GMYA 4FSUA 5M51A 2W1CA 3Q4CA 1UNLA 4R7BA 1W2FA 3UE4A 1REKA 3RK5A 2VTPA 3RP9A 4ZTNA 5EHLA 4D58A 5H2UA 2YM4A 3C5IA 2NP8A 3KY2A 2PY6A 5ANGA 5E90A 3GFWA 4YP8A 2YHVA 3R21A 5DEYA 2OXYA 2GS2A 3V6SA 1P5EA 1FMOE 4V0GB 4AA0A 3ALOA 5FD2A 4MXCA 3W16A 4AZSA 4DLIA 3SYVA 4EZYA 2QO9A 3VWAA 1CM8A 3MS9A 4FIHA 2GSFA 3OXTA 2QOCA 3QTIA 5DFPA 5AUVA 4GK2A 1RE8A 3UPZA 4EWQA 2ERZE 2X7FA 3LVPA 5CI7A 3HEGA 5HEZA 4Q2AA 4ZZNA 3E63A 3NWWA 4QMXA 3R8PA 4QD6A 5EHOA 3FMDA 4ASXA 2XB7A 3QKMA 2VTRA 1H24A 2C69A 4HNFA 5FXQA 5IQCA 2CLXA 3CTJA 5JT2A 1MRYA 5CSHA 4KINA 4APCA 3AT3A 3G6GA 4YZ9A 2YA9A 2XK7A 1MUOA 4WBBB 5E8SA 4CT1A 1VEBA 1SU6A 5J5SA 3RPSA 4OR5A 5IH4A 4OTRA 5AP2A 3KN6A 2WZJA 4P5QA 4RWJA 4FSNA 4XV2A 5J1VA 3DK7A 1Q8TA 2EUFB 5JFWA 3EZRA 4LGGA 3LZBA 2C6IA 4NZWB 2GAFD 3IPHA 4C35A 1A9UA 4EH9A 2VNWA 3ORPA 3N4VA 1J7LA 1YHSA 4OBOA 3WOWA 2V7OA 5ANEA 1FPUA 2XM8A 3JR1A 1YXTA 1ZAOA 3H0ZA 2QU6A 3NNXA 2AEGA 3HA6A 4GFOA 3BVWA 4O4FA 3U87A 5IH6A 3KREA 3T9TA 1VLRA 2X8DA 4CYIA 1E2UA 4I6BA 2JBOA 3UOLA 3TV4A 5KMIA 1IRKA 5BVDA 5A9UA 1OKWA 4I1QA 1A48A 1ZYLA 2WU7A 4I1ZA 5GZ9A 3PDTA 4G6OA 5L6WL 2O63A 4JAJA 4XH6A 4D5HA 5CEMA 3G5DA 3K3JA 4S33A 2Z8YA 1GAGA 2A4LA 4XBUA 4BBFA 3OHXM 2VGPA 1R0EA 3EQGA 4U5JA 1JOWB 4IAKA 3R9HA 3FXZA 4BKJA 1XMMA 2X0PA 3RI1A 3E8EA 4O2ZA 3LOKA 5D9HA 4L6QA 1KE6A 3P9JA 5J9YA 2XNBA 2VV9A 3HV6A 4J99A 4BHZA 3EJSA 4QP2A 4G9RA 5IQIA 2BRNA 4AZWA 4QDVA 1YHWA 4ITHA 3UVQA 3CKDA 4V04A 1RW8A 2YERA 4HVIA 2BMCA 3R1SA 2OJIA 3PIZA 4BY9E 3FXWA 4EJNA 4IZ5A 4K1BA 3MV5A 5AR7A 4IACA 5KZ0A 4WPCA 3DZQA 4AW2A 4JDHA 2JIVA 2PMLX 4KABA 2F7PA 3V5LA 4GW8A 2YI8A 4AXFA 5AP0A 3EJRA 3R7GA 3GQLA 4D4VA 4FKLA 4JDJA 2JD5A 4PP9A 4XUFA 4AACA 3NFGB 3BGPA 3F3TA 2RKUA 2VTSA 4I41A 4QMOA 2XEZA 4EK6A 2XK6A 2ZM4A 2OO8X 1MRUA 2OJFE 2UZNA 3CAZA 3VHEA 4X0MA 1P4FA 4A9RA 3UBDA 4QP3A 1ZMWA 4EJ7A 4DYMA 3FE3A 2B9JA 4FYNA 4LFIA 1HWWA 3HRBA 3GEQA 3QD0A 3QRTA 5CU2A 3PXYA 5CU0A 4YJRA 4PWNA 2VNYA 3ZCLA 4E4NA 4IIRA 1Q97A 1YWRA 5FLFA 5J5TA 5KMMA 4G6LA 4C33A 2BHEA 3KC3A 4YZNA 3PLAE 4NIFA 3JS2A 4FF8A 4MAOA 3R7YA 1OMWA 3R28A 4CFXA 4FTKA 2GCDA 4IVDA 3U4UA 2CKOA 2IVUA 4IWDA 2VTOA 3AQVA 5CY3A 4D28A 3RM6A 3ALNA 4DLJA 1G8SA 1QMZA 3K54A 3MTFA 1XHAA 1K2PA 3ZLWA 2IN6A 4TYHB 2GNJA 3A2CA 4E6CA 2OJJA 1L3RE 4U3YA 3RAKA 3PA4A 4QMZA 2PPQA 4QRCA 3DPKA 1T45A 1UV5A 3DBCA 4YJUA 2EWFA 4JRNA 2XKFA 3ZBFA 2YIRA 4BDKA 2X3WA 3RVGA 4M0MA 2YABA 3HV7A 3WF9A 2F9GA 1JBPE 3IW8A 4R3CA 3WI6A 4MCVA 5FIGA 3R2BA 3N9XA 4FTOA 1F5QA 3OUNB 1ZLTA 4RJ7A 4FV3A 3OP5A 4NCTA 4OTDA 3SOGA 3KXNA 2GMXA 4XJ0A 1OKYA 4RGJA 3D5XA 2VX0A 4YNOA 1ZY4A 2I0YA 4D2TA 2QO2A 4L9IA 4EQMA 3VEAA 3FMKA 4HGSA 3TV7A 2KULA 2UW7A 5HCYA 4TYEA 4C4EA 4CFNA 5IMEA 3FLZA 2EB2A 5E84A 2A0CX 3FY2A 2YZLA 3MVHA 2HK5A 1SVGA 4F9AA 4EC9A 3BUQA 3D83A 1KE9A 3OF0A 4L00A 3DZOA 3U51A 5KMNA 5FTGA 2XP2A 3NUAA 5HVYA 3ZTXA 4EL9A 1Y57A 5D10A 5EDQA 4XG8A 5HG5A 4GL9A 4ZSAA 4ZTMA 3T46A 3LQ3A 2Z0OA 3QD3A 4BHNA 4FKQA 4U6RA 1ZMVA 4LYNA 4OTWA 2G01A 5B2KA 3V3VA 3W0NA 2JKKA 3VS0A 4F08A 5HG9A 3MFRA 4O7WA 3FI8A 4AZ5A 4ZY5A 4A7CA 3QNIA 3KF4A 4W4XA 5AV1A 4D4YA 3OTVA 4GG5A 3QALE 2V62A 4TN6A 3AC2A 2OFVA 3Q4UA 3NIEA 4CZYB 4FEXA 2OIQA 2WD1A 4IE9A 4YUQA 3W0MA 2Y4IC 1M52A 3NW5A 4FVQA 4PPAA 4DEIA 2REIA 5CAVA 5D41A 3JY0A 2R3HA 2UZBA 2XS0A 2E9NA 3KVXA 3VS7A 3Q3BA 2QR8A 2ERKA 4IQ6A 3UOHA 5IA4A 3O51A 3PVUA 3V8WA 3L8PA 4CSVA 4DFLA 3GU5A 1ND4A 5AAGA 3ORMA 1WBOA 1MJGA 5DLSA 4AGWA 4R5YA 1WAKA 4PUZA 4AZVA 5GZAA 3UOJA 3QD4A 5J1WA 1XMLA 1XWSA 4PF4A 2YM7A 3D0EA 4C2VA 4D9UA 4NEUA 5EI2A 5F94A 3MDYA 2WU6A 2XMYA 3CS9A 3PP1A 4FICA 1O7DC 3KDRA 4FZ7A 4AX8A 5CF6A 4ALUA 2OU7A 2QKWB 3NGAA 5FBNC 3HMNA 1CSNA 4QYHA 2J0JA 4LRMA 4OTQA 3BU3A 4ACMA 5FEDA 3R8UA 5JQ5A 2XJ0A 5CNOA 4IBMA 2ZAZA 3Q5IA 5HIBA 3TNIA 4LGDA 3VS3A 4HW7A 2A1AB 3FZ1A 5E8WA 5I9VA 4NQIA 4BR3A 4JQ7A 3OCSA 4LMNA 2UV2A 1OIYA 2W9FB 2YFXA 4UMTA 3RCDA 2VTMA 1B6CB 3MYGA 1FVVA 5J8IA 4UWBA 3F2AA 4I24A 4KS8A 5AAFA 3ZC5A 3R1YA 4RFZA 4RC4A 2F4JA 3V04A 3TMOA 5BX0A 1PXNA 4G5PA 4AUAA 3HA8A 4ZJJA 2GPHA 2I0VA 4DG3E 3OXIA 4XEYA 3QRJA 4YPSA 5AX3A 2BKKA 1Y2OA 4A9SA 4E4XA 2PYWA 2VWXA 3MN3A 5HTBA 2W17A 2XVDA 2QQ7A 4IAZA 4IM2A 2J0IA 2G9XA 4PMMA 5J95A 2YL6A 3BUDA 4EC8A 3QTWA 1K9AA 3Q6UA 2OKRA 3W2OA 2GQGA 4KIOA 2J50A 3DDFA 4R7HA 4CV9A 4WG5A 4NJ3A 1LR4A 2ITZA 2ONLC 3KEXA 1VR2A 2J0KA 3UNZA 1FGKA 4A4OA 4O86A 5IUHA 4BCJA 5KBPA 2Z02A 2BHHA 3P5JC 3OVVA 4LG4A 1H0VA 4D1SA 2X4ZA 4MBLA 1IEPA 4AU8A 4PRJA 3BGQA 4PX6A 4E7WA 2Y4PA 3H10A 5EFQA 4IFCA 5FGKA 4NU1A 3QZGA 5AWMA 4UB7A 4UV0A 1K3AA 2B53A 3O5AA 4O0XA 4FEWA 2GHMA 2PE1A 2R3FA 5DT0A 2RFNA 2QCSA 5EYMA 4TYHA 4CG9A 3IO7A 3O71A 4JIAA 5G1XA 2R3QA 4IAAA 3QXOA 4MF1A 1V0PA 1ZWSA 5ETAA 3SA0A 4YO6A 2Z7LA 4DH8A 1V1KA 3P23A 4DBXA 1NVSA 3LFCA 1OI9A 1W98A 1OM1A 1ZYJA 2RSVA 3UYTA 3BX5A 2XM9A 1URCA 1URUA 3IW6A 3I1AA 4FZDB 4Y5HA 5ACKA 5AADA 3SOCA 4YJTA 1IG1A 4C58A 3DJ7A 3BL7A 4BZNA 1XH9A 1WBPA 4E4LA 2WTDA 4J71A 4BIBA 4C59A 5A4EA 2P0CA 4YLLA 2FUMA 4U42A 5CTPA 2C30A 4JIKA 3VNTA 4O7ZA 4U97A 4CVAA 3ODZX 4EZNA 3VIDA 3KMWA 4M12A 4F7LA 4E5WA 1PJKA 4V01A 2JBPA 1P4OA 4IB5A 2OW7A 4NL0A 3ZM9A 3Q4ZA 5ANOA 2H6DA 1H26A 4R5SA 2OZAB 3REPA 5HORA 1IR3A 2C1BA 4EKKA 3CPBA 3D7TB 3EQBA 2H96A 4GG7A 4O22A 4QMPA 2YJRA 4RQKA 5HE0A 2CHLA 1PXIA 5HOAA 1T46A 4IH8A 2JDOA 5I9UA 4AF3A 3C5UA 3DNEA 3TUCA 3HAVA 3C51A 2VWWA 3TG1A 3TM0A 1WBWA 4ZOGA 4B8LA 4PTCA 4MUQA 1TQVA 5DI1A 4QMYA 1ZZLA 5EOLA 3G6HA 3DK6A 4ENXA 2VX3A 2NPQA 3TIZA 4CFWA 4FEUA 3Q2MA 4F7JA 2E9OA 3E7OA 1BI8A 2QOOA 3KA0A 3NPCA 5AUXA 1KE7A 5LWNA 3TZMA 4O7NA 3I7BA 2JFLA 3VF9A 4XS2A 1WBSA 2UVXA 3MJ2A 3UMXA 4K33A 2ITXA 1GOLA 2XCHA 4HPTE 4FKUA 4C4FA 3GOPA 3DFCB 3D4YA 3KKVA 4J7BA 4RMZA 5JSMA 2LXYA 3QRKA 3DGKA 3Q4TA 1LEZA 4IJ9A 4RG0A 3TNQB 5M4FA 3QQKA 4RIWB 4JI9A 3SQQA 3TI1A 4BBEA 4EOKA 2XNEA 2BIKB 5J9LA 3TT0A 1OL2A 3KRXA 3BRBA 2C08A 3L1SA 4MNEA 5FTOA 4NWMA 4F9BA 3HAIA 3R1NA 5HNIX 1RQQA 2HYYA 4W8DA 3ROYA 4OBPA 4KS7A 2Q13A 1Y8YA 2OZNB 2I0HA 4O38A 4LOQA 5DYJA 1Y6AA 1M7NA 4FK6A 4RJ6A 4U0IA 4XG3A 3D50A 3UMWA 5AEPA 2X1NA 5FP6A 3UNJA 1ZMUA 3AMAA 4LOOA 4GYIA 2RFDA 2JC6A 2Z0VA 5FWKK 1GNGA 4FOCA 4X2FA 2OF4A 5JRQA 3BBWA 5LVOA 2VWVA 3DK3A 3VW6A 3BLBA 3WZKA 3DU8A 3FC1X 3BHUA 2X8IA 3FLYA 2B4SB 2R64A 4MH7A 3FI2A 5IQFA 4FVPA 3DY7A 3SRVB 3G0EA 5CSXA 4AZGA 3Q32A 4XRJA 3FZTA 2F7OA 3FLQA 2JNSA 3PVBA 3G33A 3VHKA 1I49A 1PYXA 2X2LA 3T4AG 5I3OA 2CDZA 4M14A 3T8OA 3OCBA 2C0OA 4XNEA 3WBLA 4ERKA 3DBFA 5C4LA 5HICA 4X2KA 4BIEA 2WHBA 4USDA 5A4CA 5JFXA 3TUBA 3WZDA 4J98A 2W05A 5AR4A 3N51A 5HHWA 4FC0A 5KKRB 2VAGA 3CEKA 3F5UA 3L8VA 5AJQA 4EH5A 4JLCA 2ZYBA 4BCFA 3GCVA 3OK8A 3W0RA 5ANKA 2P33A 3BYUA 5KX8A 1QX1A 5HO6A 4PMTA 3RPYA 5JGDA 3R7UA 2ZXQA 4YTHA 3KRLA 1R1WA 3PY0A 3OMVA 4O1PA 4IB3A 4WD5A 5H8BA 5HE1A 4DG0E 5E1SA 1ATPE 3I0OA 4EZ5A 4EORA 2ZMCA 2WEVA 3QF9A 4F6SA 3ZFXA 3BLAA 2C5VA 2CJMA 3OW3A 4M97A 3BV3A 1P14A 3C9WA 3JY9A 2XJ2A 3QD2B 2C5XA 5HD7A 4QMTA 3VS2A 2J2IB 3DCVA 2B52A 3ENHA 3O3OB 3KB7A 3MWUA 4J1RA 4YZDA 3FI4A 4O7RA 2F7ZE 2BAQA 3EL8A 3B2TA 4DF3A 3EN6A 2I0EA 4O0TA 5A4QA 3VS5A 3BYVA 4UMRA 3EFWA 2R3MA 2XKCA 5DT3A 3WE4A 4UN0C 2VTNA 4YURA 3R9OA 3RK7A 2HWPA 4EH7A 3ZMMA 3OTUA 5EKOA 4DEEA 5HG8A 4FKIA 4G34A 2OZOA 4I3ZA 4DCNC 5HLPA 4WNKA 3O7LD 4UMPA 1W9MA 2EFKA 4L8MA 2O64A 4UWCA 3WARA 1PXOA 3D5UA 4NM7A 3LQ8A 3OD6X 3TKUA 4R5GA 2IO6A 2G2IA 3GCQA 4K18A 3TL8A 4BTMA 2I1MA 2GHLA 4M3QA 2W5AA 5IA5A 4IM0A 3MFTA 1TQUA 3D15A 3VBQA 1R33A 3DNDA 1F3MC 4NUSA 5L2QA 4R78A 3ZFYA 2XK9A 1DAWA 3EN7A 4ZSEA 4GKIA 3QWKA 2H9VA 2XRWA 5BMMA 4ANOA 5FLEX 2J90A 2OH0E 5DA3A 4IDVA 2ETMA 3HX4A 1OECA 2PY3A 4OT5A 2Y7JA 3R1QA 3MVMA 4R1YA 5BVOA 4ACHA 2BR1A 4U9AA 4C4GA 4EHZA 4DHIB 3P0MA 3HL7A 5CEPA 1DI8A 1QPJA 5F95A 3KAVA 4XV9A 3NNVA 3FEGA 4GH2A 4O7VA 3WIGA 5E8VA 2PUUA 3G90X 4KB8A 5EDPA 4G3CA 2PVHA 3E87A 5DN3A 4LI5A 5IQHA 4MD9E 1IAHA 3O50A 2QOIA 2XKEA 4E20A 5KHXA 3TKIA 1H1QA 2CCHA 3ZUTA 2X39A 4PMSA 3BU5A 3EQPA 3GC8A 4FTIA 4B7TA 2X81A 3AXWA 2IW9A 4FT5A 3ZU7A 4CZUA 4RIWA 3OT8A 5HNGA 5I3RA 3M3WA 4W9XA 5J87A 4RIYB 5CF5A 3FUPA 4S34A 2WXVA 1UVRA 3E64A 4DHFA 2HENA 2HZIA 3FYKX 4B8MA 3QC9A 3QWEA 4MD7E 1NVQA 3FZOA 2J0LA 3CP9A 3UZRA 2QOKA 4I0SA 3KCKA 4CGAA 3NAXA 2X4FA 1TKIA 4E3CA 2IVVA 2ITYA 2V5QA 3R7VA 5HTCA 4O7YA 1OUKA 3QZHA 5LMKC 3F2RA 4DEGA 3D2KA 1BI7A 2WKMA 5C9CA 4H6IA 2ACXA 5AMNA 3NRMA 1PHKA 1XR1A 1S9IA 3F61A 4GVAA 4NJDA 2QONA 4FNXA 4QNAA 4BBMA 2OI4X 3O0GA 3C0IA 4GK3A 1BKXA 3VUKA 5CF8A 1O7DB 4QP6A 3HYHA 1PMVA 3LFEA 4UZHA 4FGRA 5T6KA 3E92A 3BVTA 3IDPA 3A7JA 4J53A 3RAHA 4FTLA 3TZ8A 2A98A 3G2FA 2ESMA 3GFEA 4TNBA 4CFVA 3Q0KA 2PWLA 3OZ6A 2YLAA 1QCFA 4NFNA 4CYJA 3QTUA 5K4IA 1Q5KA 2QLQA 4K2RA 2WQMA 3VF8A 2WIPA 3K3IA 4ANBA 4D4SA 2W99B 2BDFA 2BAKA 4FK3A 2W1IA 3PSDA 4QQJA 1TQMA 5DHJA 4XCUA 3E5AA 2R0UA 2WQBA 2QODA 1SNUA 2QC6A 3E93A 3FI3A 3PUPA 4JG6A 4MF0A 4FMQA 4OGRA 5CU6A 4KSPA 5HLWA 2Q83A 3NR9A 5TO8A 3NUSA 2WAJA 1ST0A 4DFBA 3LXKA 4ASZA 3ZZEA 1WDZA 3CKXA 3QCYA 4H3BA 3FL5A 4RIOA 4CKIA 1OA1A 3MBLA 2ZFYA 3UDBA 4FNWA 5L6OA 4PPBA 1OAOA 2YM5A 1ZY5A 1OGYA 3VBYA 3I6UA 3MIAA 3Q6WA 5L3AA 4I6QA 1TQPA 3NSZA 4DFYA 3ZLXA 2ZV9A 3U6HA 3ORKA 4G16A 3PXQA 2B55A 4DFXE 3EWHA 2WMTA 3R22A 4FKOA 4FSMA 4QYFA 2B9HA 4Y73A 3BZ3A 5CNNA 3WYXA 2B0QA 4IAIA 3HV4A 3KRRA 4JBOA 2ITUA 3TNPC 2NO3A 2YEXA 3V5QA 5KO1A 4OW8A 3PWYA 3P7BA 5K9IA 4K11A 2PMRA 3DXPA 4WNOA 3MPAA 2X7OA 3FMMA 4FVRA 4NT4A 4BFMA 2Z7SA 2BRGA 3ETAA 3Q53A 4IZYA 1MP8A 1Q8ZA 2WELA 3AGMA 4M69B 2XKDA 4KNBA 2XNOA 5HE3A 3VQHA 2QOQA 3G0FA 5CQUA 1J7UA 2DQ7X 4I4FA 1J3HA 4F0GA 2FICA 3MY0A 2GNIA 4ZEGA 3FKLA 4ZMEA 2YDJA 3U9NA 4C4HA 3LVTA 3PPJA 4R5JA 4XHKB 1OL1A 4CRLA 4FKJA 4OAVB 4BKZA 4MQ2A 3MESA 3DS6A 3PPZA 2O0UA 4LL0A 3S3IA 2RL5A 4FSWA 1XH8A 2YIXA 3CJFA 3V5JA 2H34A 1OB3A 3D2IA 2YAKA 5HO8A 3WZJA 2UW8A 5FBOA 3VJOA 4AXDA 1Y6BA 4FTAA 5IQBA 4N6ZA 2JKQA 4I23A 1FBNA 4HOKA 4A4XA 4BWXA 2PMOX 3PE2A 2GNFA 1JSVA 4AQKA 3I39X 3CSVA 3PWDA 4IFGA 4IMYA 4CD0A 2W7XA 1O6YA 4E5BA 2C5OA 3C4EA 4I93A 3ZSHA 1UU9A 4K0YA 3GBZA 5GJFA 2OJ9A 5F4NA 2HXLA 2VTLA 4UZDA 5JGBA 1OL7A 1YXVA 5TOZA 3MPTA 2V0DA 2XNMA 4FODA 4JR3A 3RBWA 4TYJA 4Q5EA 2PMNX 3JXWA 3SX9A 3EN5A 3NYOA 2IZTA 3DX3A 4HGEA 3T48A 3DPQA 5CENA 4FJVA 3R8MA 5EM7A 3ORZA 3EFKA 3L9MA 3OOMA 2AC3A 3E88A 3DTCA 4QTDA 4EYMA 4E1ZA 3BHYA 4D8JA 1J1BA 4FIEA 4QO9A 5HVJA 2W1EA 3VVHA 4EQCA 3BUPA 3PFYA 3IDCA 4O84A 5CI6A 5E8UA 4R8QA 1Z57A 3KMUA 1E9VA 4DT8A 4U81A 1GZKA 1GZOA 4HYSA 3OUKA 5AA9A 4RIYA 2YWVA 4O0VA 3II5A 5JFVA 1PXMA 3OY3A 1GZ8A 2B1PA 2VO0A 4ZJVA 1XBCA 4P2KA 4XP3A 2PVFA 2UZOA 4QMVA 3RPVA 4CKJA 3NUYA 4FL2A 2UZDA 4UDXX 3RM7A 2X6DA 1UNGA 3BEAA 4BI0A 4HVSA 2SRCA 2PZYA 3EQIA 3W2PA 3EJUA 4EZZA 4NM3A 4MNFA 2NNWB 1REJA 2X8EA 3SXRA 4AZ7A 3HNGA 3NDMA 2IJMA 2OGVA 3LFQA 3SD0A 4AGCA 3OC1A 2WMBA 5CYIA 4EKLA 1GN9A 3EN4A 3ACJA 5DR6A 3EQCA 4J95A 4L52A 4BDDA 4FTTA 4G9CA 5CZHA 5K3YA 1NVRA 2XIRA 5ANIA 2BFXA 3F82A 4BI1A 3L9LA 3POZA 4AT3A 4EH2A 1ERKA 1IA8A 3UP2A 4C2WA 4JN4A 2FB8A 3QQUA 4DCAA 5EI6A 4BTFA 3BVVA 3DXQA 4U79A 1S9JA 4GCJA 1G8AA 3ZRMA 2BILB 4EH6A 1Q61A 3OS3A 4X21A 1G3NA 4L3PA 2CGUA 3A4PA 3UP7A 4USFA 2O0I1 5LCJA 4DH3A 3COIA 1W84A 4F9WA 4IHPA 3CC6A 3NVKI 2X9EA 4EOJA 4YZBA 3F69A 4ZXTA 1JKLA 2C3KA 1BUHA 4TRLA 4ANMA 5AM7A 4QTCA 1UKIA 1J7IA 5HVKA 1XH5A 4IX6A 3RK9A 1Z9XA 3SOAA 1CKJA 4YTCA 3OWKA 4I21A 4ZSLA 3WF6A 3ZRKA 2CKPA 2BKZA 3PY3A 4LRKA 3NX8A 4Y83A 5C8KA 4AGUA 3WILA 3HECA 1O9UA 3I0QA 4U41A 4AOIA 4GIIA 2RT6A 3W8LA 4Q9ZA 2JDSA 2OBJA 1NXKA 3O17A 3I5ZA 3SAYA 2ND0A 3L3PA 3ACOA 5FQDC 3VKHA 3CXWA 1ZOEA 4BN1A 4NSTA 3QYWA 4O0WA 5EH0A 2PVMA 1YI6A 3MY5A 5L2TA 2UVYA 4U3ZA 1SM2A 5I9ZA 3RTPA 2PZRA 3JVSA 3NYXA 4U40A 4P90A 4RWKA 2RGPA 2HCKA 3R7OA 2QHNA 4RZVA 3FZRA 3W8QA 1NY3A 4RLLA 4O7LA 1Q3WA 4O4EA 3TZ7A 4M7IA 3UOKA 4XV1A 4FV7A 3QKLA 4QEBA 1HOWA 2OBLA 4LDTA 2YWPA 3GT8A 3NS9A 1UWJA 3Q9YA 4FKVA 4F63A 5BUJA 5GNKA 4H05A 5E9EA 5L2IA 2QNJA 3ZXTA 4M69A 4CEGA 5DWRA 2OW3A 2R0IA 4FT7A 5CSPA 3SGCA 4C0TA 4Z7HA 2RG6A 5ICPA 1CMKE 4QMLA 3QU0A 3RINA 4FZAB 5TF9A 5C5BA 5E92A 1WVWA 3UPXA 3NZ0A 4YJPA 4IM3A 5EDRA 2X0QA 2GNGA 3BHVA 4QMSA 3TV6A 4KRCA 1UWHA 3A61A 3KAWA 4NSWA 5IQEA 4IZAA 4DAWA 4RBLA 4PDSA 3ZS5A 3QE6A 1IA9A 2GFSA 2HZ0A 4A07A 4AXCA 2J5EA 1DI9A 1I44A 4HJOA 2YIQA 3LJ2A 3SG8A 1TZDA 5BUIA 3K2LA 3QKKA 3C7QA 1APME 4CTCA 4BCGA 4D9TA 2G2FA 4F0IA 2KHOA 3PE1A 2YDIA 2EXMA 4UYNA 3AKJA 4GV1A 3ATSA 4ZSJA 4DH1A 3KIOC 3OEZA 1KE8A 4CMOA 3GQIA 4FSRA 5GJDA 3ODYX 5KZIA 3ZSIA 3A8WA 3BLHA 3B2WA 4X2GA 2W06A 1FINA 2C3IB 2XYUA 2WPAA 4D55A 3MTLA 2IEWA 1HTYA 3MA3A 3NNUA 3THBA 3EHAA 3ZBXA 1MRVA 4FV4A 4YLKA 4WBOA 4R5LA 2BIYA 2YM6A 2VN9A 4FYOA 5AR3A 5HBEA