3F7WA

Crystal structure of putative fructosamine-3-kinase (yp_290396.1) from thermobifida fusca yx-er1 at 1.85 a resolution
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
288
structure length
288
Chain Sequence
GVNSVAARVTELTGREVAAVAERGHSHRWHLYRVELADGTPLFVKALPDDAPALDGLFRAEALGLDWLGRSFGSPVPQVAGWDDRTLAMEWVDERPPTPEAAERFGHQLAAMHLAGAESFGATWDGYIGPLPMDNTPRSTWPEFYAEQRILPYLRRAADRGALTPGDVRLVEKVLDALDHLAGDPEPPARIHGDLWNGNVLWQDDGAVVIDPAAHGGHREADLAMLALFGLPYLDRVRDAYNEVAPLAEGWRARIPLHQLHPLLVHVCLFGAAYRTTLVDTARAALRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative fructosamine-3-kinase (YP_290396.1) from THERMOBIFIDA FUSCA YX-ER1 at 1.85 A resolution
rcsb
source organism Thermobifida fusca yx
molecule tags Transferase
molecule keywords putative fructosamine-3-kinase
total genus 94
structure length 288
sequence length 288
ec nomenclature
pdb deposition date 2008-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03881 Fructosamin_kin Fructosamine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3f7wA02
1.20.1270.240 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3f7wA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3f7wA01
3QUDA 2XIZA 3SA0A 2NRYA 4ARKA 3GCPA 4GK3A 4RVTA 2R4BA 1XH8A 3FSFA 3GQLA 4D5HA 3QD0A 3UIXA 3A61A 3QQGA 4CV8A 2BHEA 2RFDA 3P79A 4LRMA 5C01A 5K3YA 4BCNA 4BDBA 4R7IA 4K6ZA 4O7VA 2BZKB 3QXOA 2RFNA 1XR1A 1RE8A 2C68A 4ZEGA 4L7SA 3SW7A 4EHEA 3RCDA 2BTRA 3I81A 4X2KA 3FAAA 1APME 4F09A 4ZY4A 4J8NA 5AIRA 4U3YA 5AR8A 2RKUA 3Q6UA 4FKUA 3R1YA 4QMMA 3FY0A 3WZKA 2NPQA 4RJ6A 1OPLA 1U46A 3V5PA 4G31A 5AUTA 3ZHPC 4RVKA 2F49A 1IEPA 3FSKA 3SXFA 4IWOA 1UU3A 3OWPA 3ZFYA 4DFZE 1Q4LA 2XRUA 2ITUA 3OS3A 1XH6A 2CGXA 4DN5A 4BDJA 3QC4A 2XK4A 4GU6A 4DGLC 5EW3A 3E5AA 5FDXA 5HICA 3TZ7A 3C5IA 1PXKA 4H1MA 2VTMA 3F5GA 4RC3A 3GENA 3MVMA 1DAWA 4MWHA 4YJSA 5JQ5A 1W83A 3NMUF 4KA3A 3FZSA 5KBRA 4IZAA 3R9OA 1JSTA 4HGSA 4Y46A 1OGUA 3O96A 4WHZA 2SRCA 4MHAA 3NIZA 4YHTA 4B8LA 2IZTA 4MQ2A 4YHFA 3G6GA 2O65A 2GMXA 2P2IA 2R9SA 4RJ4A 2J2IB 2V0DA 5IA0A 2Y6OA 5EDPA 2NP8A 3BYVA 3CQEA 3F3UA 3ELJA 4MK0A 1Y57A 1O9UA 4E7WA 3G2FA 2V7OA 3OROA 4OTDA 5HNBA 4PWNA 2IW8A 5KMIA 3I0QA 3VW8A 5CLPA 3OVVA 3QQHA 2YDJA 3R21A 4JRVA 2QOBA 2PVLA 5DNRA 5EI6A 4R7HA 5JGBA 2OZOA 1OKYA 4IWDA 4MXXA 2X8IA 4RMZA 3P9JA 5KKRC 3R0TA 4FNXA 2RFEA 3ORTA 3TI1A 1QPJA 4E73A 1ZZ2A 4QD6A 3KXNA 3FKOA 3A8WA 4IHPA 4CFXA 4WKQA 5ANOA 4OT5A 3E3PA 4G3EA 3DBFA 2YN8A 4FT7A 2XNMA 4JDKA 3NUXA 3VW6A 4A4OA 3U4WA 4O6EA 3U4UA 3I0OA 1DI8A 4AWIA 5K4JA 2VX3A 1IAJA 3TUBA 4L43A 3ZO1A 2W5HA 2XF0A 5IUIA 4D58A 2C5YA 4IW0A 4M3QA 2DS1A 1K2PA 4KBCA 2G2HA 5D10A 3PY1A 4XV1A 4ZZMA 3W2CA 3IW8A 4DGGA 3MIYA 4CT1A 2V22A 3QZIA 1U5RA 5TOZA 1OBGA 3F2NA 1TKIA 2QO2A 5FXQA 4EH3A 4QMTA 5TR6A 3Q60A 3A7HA 4MYGA 4AGUA 4RX7A 3VWAA 2X4ZA 3RPRA 4C4FA 5LJJA 4JDIA 4M68A 5G1XA 5LMBA 4I1ZA 4CTBA 3PRFA 2VV9A 3KFAA 3GU5A 4L42A 3E8CA 4YZ9A 5AP3A 1H25A 4GUEA 2WTDA 4GEOA 4YLLA 4GW8A 5DN3A 3D4QA 4FV5A 2W1GA 4NH1A 4UBAA 5HBJA 1YOJA 4IAFA 4WUAA 2WGJA 5CU3A 1FINA 3NW6A 1DS5A 1KE6A 5M09A 4GYIA 3LFEA 5LVOA 2ITVA 2UVXA 4PRJA 1R39A 4AF3A 5GINE 3V8TA 3PSDA 2BHHA 5IMXA 1UA2A 3GU8A 2YFXA 2W5BA 4P2KA 4USDA 2FO0A 3PVUA 3KXMA 3DJ6A 1TQIA 5AR3A 4JX7A 4L00A 3IG7A 4I94A 4EK3A 3QUEA 3F69A 3FLSA 5J87A 2PTKA 2XJ1A 4O7TA 5H9BA 4AOJA 3CS9A 2IW6A 3ORIA 4JDJA 1OZ1A 4B9DA 4O86A 2YM4A 2R3MA 2Z2WA 4DTKA 1GZKA 2ZOQA 1Y8GA 3LJ2A 4JQ7A 4ASZA 3HV3A 2R5TA 5CSHA 4RFYA 3RK7A 3LMHA 3EQBA 3L8SA 1WBVA 3MVLA 3W2QA 4AW1A 2NO3A 1SVEA 3GOPA 2UW6A 3E63A 4W4XA 3GEQA 1G5SA 2QI8A 1BX6A 4QTDA 5D41A 3VUTA 2PMNX 2UVYA 4D4SA 3W1FA 2VZ6A 2A1AB 1GOLA 3B2TA 3ET7A 3UMXA 3DA6A 1UU8A 2Y6MA 4PP7A 5AV3A 3FXZA 4CG8A 2PUUA 5LMKA 4M67A 4FTIA 3UIMA 3ZXZA 3LQ5A 4E3CA 2BAKA 5CI7A 4BTMA 2B1PA 4UMQA 1YQJA 2X8EA 3TNIA 2I1MA 4YPDA 2J51A 2QOKA 2XNPA 3O7LD 5HG9A 3R04A 4YPSA 3GC9A 4FKGA 4FSWA 4L44A 5D11A 4QP6A 2O8YA 3FYJX 4C59A 4EUTA 4IACA 4IZ5A 2WMRA 3UC4A 4BTFA 4D2RA 5CF6A 5AR4A 5DMZA 5EI8A 2WOTA 3F3ZA 3KEXA 5K4IA 4YC8A 4K1BA 4GT3A 1ZMWA 3QF9A 5HX6A 3QQJA 1ZYCA 4IZYA 4E26A 3HP2A 4IEBA 2HELA 3H9OA 3O8UA 5CXHA 5EM6A 4EH9A 3FMEA 1FVVA 4J52A 4C2VA 2W9ZB 2PZ5A 3H0ZA 3ZXTA 5CT7A 3LPBA 4PTGA 2XKEA 3PJ8A 5LVLA 5I9XA 1GIIA 3ZMMA 3BI6A 2OJFE 3NUUA 5GZ9A 3RKBA 3MTLA 5FEEA 4C3FA 3LKMA 4YBKA 5L8JA 5EW9A 1M7QA 4NM0A 4ZY5A 5HD4A 4EK5A 4AP7A 3C4CA 3SDJA 4CFNA 3SVVA 4E1ZA 3D5XA 2UZWE 2B9JA 5IEXA 4TTHB 5DH3A 4ZTMA 4YNOA 3ZM4A 3RPOA 3IPHA 3ZO3A 5ANIA 4ANNA 3ORLA 3CTHA 3KRXA 5FTQA 2ZB0A 4G6NA 1S9IA 4OGRA 5KMNA 1ZXEA 4RLKA 4ZJJA 1YVJA 3KRLA 4MD9E 4OUCA 3D94A 4DBNA 3U6HA 4S2ZA 5M4IA 1QPCA 3UNJA 2HENA 4O0RA 5AV1A 3EFJA 3B8QA 4PL3A 4BYIA 3FEGA 1H0VA 2CCHA 2JEDA 3KCFA 4HZSA 4YMJA 4C62A 4CZTA 3RTPA 4AG8A 3BYOA 3HMNA 4BBFA 3MFUA 5HVJA 4O27B 1MRVA 3MFRA 2HWOA 3UDBA 3HUBA 3VQHA 4FKPA 4QTEA 4B6LA 1H24A 5BYYA 2WELA 3OCSA 5IPJA 4FGBA 2OFUA 3ZFXA 1P2AA 5KHWA 1U4DA 3I7BA 4XLVA 1R1WA 3TNQB 2QR8A 3EQFA 5D9HA 1P4FA 3KY2A 2BR1A 2W7XA 3COKA 3PJCA 5ANDA 5LARA 4A7CA 4BCJA 2Z7SA 2BRBA 4XP2A 4R3RA 4UMRA 4WNPA 5JT2A 4Z7HA 3BLQA 2BILB 3VS2A 4E6DA 2BDJA 4DEBA 4IB1A 1W0XC 3PLSA 4FMQA 3RAWA 5ICPA 4JQEA 2YDKA 1I09A 5A6OA 2BRGA 4C35A 5L8LA 2F4JA 2GHGA 4CMOA 4V0GA 2C0OA 1PMEA 3R7GA 3EN9A 3HYHA 4FVPA 3VS5A 4NJ3A 2Y9QA 3BE9A 2X2LA 3LCSA 3T9IA 5KKRB 5F1ZA 2X2MA 5KZIA 2VTAA 3TIZA 5C8MA 4AX8A 3TN8A 5DI1A 3KXGA 4FV7A 4FTNA 3R1NA 4L68A 3EN5A 4FZ7A 1M52A 2VU3A 5JFVA 4DFNA 3MGYA 2PHKA 3ODZX 5BYLA 3CGFA 1H07A 3JVRA 4AW0A 5KMOA 2JDVA 3DNEA 3RALA 4FOBA 1SM2A 3N51A 3DXQA 2ZMDA 3AC2A 5EYMA 1XH7A 2OZAB 3SQQA 3HAVA 2VWBA 3DJ5A 4ZOGA 4PDSA 2WTKB 2O2UA 4BGGA 4O2PA 4BWXA 4I4FA 3DPKA 3ZDIA 4ZSGA 3VC4A 4EC9A 3MVJA 3NCZA 4LGDA 4NCTA 4PTCA 4ZSEA 4EZ5A 5C9CA 3PJ1A 1QPDA 4W4YA 3TUDA 5GZAA 4NYEA 4FBXA 5E4HA 3NNUA 4FSTA 4R5YA 4CNHA 3OZ6A 4EQMA 4ZSAA 3KRWA 4IWQA 3KC3A 4FSUA 4KIKA 1XJDA 3HL7A 4MVFA 5AUZA 3R83A 4NM5A 1PF8A 2OJ9A 4GG5A 3A4OX 4FL3A 3V6RA 1R0EA 4JBPA 5FQDC 4A07A 3P5KA 3NYXA 4YJOA 4I0RA 4QQTA 3CSVA 4FVQA 4H3BA 3L8XA 4OR5A 3W8QA 4O84A 1J7UA 4JG8A 4B8MA 5M55A 3FZTA 3P0MA 4XG6A 4HOKA 2IZRA 3ZSGA 2GDOA 4DTBA 4HPTE 3QLFA 5HE3A 3MB6A 1Y6BA 3NIEA 5AUWA 5CAOA 2WOUA 1R78A 3FKNA 4GT4A 1R3CA 2UZOA 3V51A 3ZO2A 2UZVA 4CLIA 4FX3A 4GMYA 3G0FA 4DEGA 2GNJA 1TQMA 2XCKA 2WQOA 3V8WA 2RG5A 4PV0A 3UVQA 3R9HA 4FA2A 4P7EA 5IISA 3EL8A 3JY0A 4WNOA 3T9TA 5CVFA 4D2PA 5HX8A 5CEOA 3VJOA 4E8AA 5K0XA 3KN6A 3IW4A 4OTIA 3U9CA 4EEVA 4H58A 4S33A 3NUAA 5FGKA 1IR3A 3KXHA 3T3VA 3R9DA 3EB0A 2X7OA 3PIZA 1U59A 2VTOA 2I0VA 1OB3A 5K0KA 2G9XA 3A4PA 4ZTRA 4ANMA 3KMMA 5AR2A 3SRVB 2C30A 4YC3A 2PY3A 3DU8A 3GOKA 3V8SA 4I5CA 4W8DA 4AZTA 3NUNA 4II5A 4M7IA 2YJSA 4GK4A 5TO8A 2O3PA 4P5QA 4MNFA 3DNDA 2WPAA 1Y91A 2R3NA 2RF9A 2XIYA 3UVPA 3F5XA 4CKRA 2B54A 3R63A 3MA6A 4D5KA 3RM6A 3QTQA 4YJNA 5EI2A 3KK9A 2H34A 3R9NA 2VTTA 3TT0A 2IW9A 5J1VA 1E1VA 1JKLA 4EH4A 5AAEA 1Q8TA 5BYZA 2HZ4A 4YP8A 4Y85A 5HTCA 2VUWA 4KIKB 3BKBA 3R22A 3LIJA 4RX8A 5AP0A 4UN0C 3DBEA 3SGCA 4U41A 4JQ8A 4N57A 3QX4A 1YRPA 5EHYA 3PE2A 2RIOA 4Z7GA 3DZQA 4OLIA 2F2UA 2GNGA 4BKJA 1ERKA 2BCJA 3HKOA 2G1TA 4EH8A 4FKQA 5TKDA 4KRDA 3VHEA 2UW0A 3O8PA 4IX3A 2YLFA 4G3FA 2ZYBA 4YTFA 5F94A 3U55A 4X0MA 2REIA 3UIUA 3ZO4A 4IC8A 4FZFB 5AP2A 3HRFA 3FI2A 3WARA 4BHNA 4FVRA 2J4ZA 3C0HA 2PVRA 3ANQA 1PYXA 2J0MB 2ZV8A 3O23A 3VBQA 1OPKA 4IDTA 5KMMA 5HE0A 3VRZA 2BTSA 2RGPA 3D9VA 2QOLA 3JY9A 5CSVA 3QYZA 3VUMA 4DAWA 3ZRMA 1YXSA 4F08A 3TJCA 4LYNA 5IA3A 4F7SA 4U45A 2ZM4A 1ZRZA 5AAFA 3I7CA 2JKKA 4YTCA 4CXAA 4X3FC 3BEAA 3D14A 3FMMA 3GC7A 4G5PA 4JT3A 5HG5A 5KZ0A 4CMTA 5KBQA 3S1HA 4ITIA 1ZYDA 2ZAZA 4K0YA 2QCSA 3ETAA 1UU7A 1U54B 3KRRA 2VO6A 4WG3A 2CKOA 1ATPE 3EZRA 1RDQE 4D0WA 3TIYA 4X7QA 4O83A 1URCA 3OCGA 4PMTA 4EHGA 2W5AA 1JQHA 3LM0A 2AYPA 5HTBA 4BVUA 3FQEA 4BGQA 3WZEA 4NUSA 4FL1A 4YZCA 5IG1A 2CNQA 4RC4A 3KB7A 5G6VA 5CYIA 3QRUA 3R2YA 3GU6A 3Q2JA 1PXOA 3L9NA 4FT5A 4IADA 1Q3DA 5AA9A 2JDOA 2WB8A 1STCE 3OW4A 2UW4A 4YJTA 4ZJVA 4F65A 5IEVA 1IAHA 1WBOA 2ITOA 4CFMA 4BYJA 2QO7A 1KE9A 5BVEA 4GFGA 4GUBA 3FC1X 3CIKA 1Q8WA 3QWJA 4FZAB 4NKSA 4E5BA 4GFOA 5CASA 3F88A 3CTJA 4O96A 4U43A 1OMWA 4RGJA 3ULIA 5CALA 1AD5A 1PY5A 1UWHA 3Q9ZA 1JBPE 4IX5A 2H8HA 3VO3A 2XMYA 2QOQA 1XH4A 4DE4A 4GJ2A 4XH6A 5H2UA 3LFDA 3Q2MA 4MF1A 5EKNA 3DDPA 1KV2A 5CAUA 2WKMA 5EH0A 5BVKA 4Q9ZA 4GH2A 2P2HA 4FV2A 2QOCA 2VTSA 4QRCA 4ZSJA 4E6QA 1QPEA 4FTJA 3FZ1A 4AT3A 5AV4A 1KOAA 3SXRA 5HGIA 3QALE 4DITA 3WIKA 2WMUA 4QNAA 3QA8A 4BB4A 3VUGA 3UOJA 2YITA 4GL9A 4QNYA 3HRCA 2FVDA 3OXZA 3QTIA 3O17A 3LMGA 2R2PA 4KIQA 4B4LA 5EFQA 1AGWA 4MXOA 4PF4A 3SOAA 5AV2A 5IEYA 3OBGA 2XM8A 3THBA 1LP4A 5E8VA 3R7OA 4MQ1A 4XBUA 5IZFA 2XP2A 1W84A 4IVDA 3SAYA 4CZYB 3ZTXA 5A9UA 4RIOA 4UXQA 4D9TA 3MB7A 4HNFA 4NT4A 4JR7A 2IVTA 5CEKA 5E8XA 1YHSA 4MXCA 4AZWA 3WF8A 3CJGA 3R8UA 5HTIA 4J97A 3IS5A 4KKHA 5HNGA 4H1JA 2UW3A 4GRBA 3VJNA 4FT3A 4E6AA 5IDPA 3BU6A 2XK7A 3PIXA 4IQ6A 4YTHA 5AIKA 4YHJA 2R3GA 2BFXA 2WIPA 5BUJA 1PJKA 4WBBB 4J53A 3VBYA 4EOOA 2QLUA 3BHYA 3MIAA 3NCGA 3BHTA 2ITYA 3EQRA 5EK7A 3T8OA 3QAME 4XG7A 1KWPA 5CQWA 3PVGA 4QP1A 2PVNA 4GSBA 4O7WA 1YOMA 4IB3A 4RX9A 2YCQA 3IONA 2PK9A 3OEFX 4UB7A 3CBLA 2ITWA 3LCOA 1H27A 3DS6A 3K5VA 1F3MC 3CD8A 2VTLA 4PTEA 1URWA 4FIIA 4WNMA 5AADA 5BMSA 4GVAA 5CU0A 1NVRA 1XBAA 5L2SA 4B99A 4DF3A 5D12A 3F82A 4FTUA 4FSNA 1XH5A 4DGOA 4X3FB 4ACMA 3MESA 4CV9A 1NY3A 3BWJA 3W18A 5JFSA 1UNGA 2ITNA 2C3IB 3G6HA 4RPVA 4TWPA 4ACGA 4BICA 2GS2A 3K3JA 1OKZA 3KA0A 4DG0E 3IW7A 3NPCA 3PA4A 4JDHA 5L2WA 3UP7A 5FUTA 3BHHA 4FIEA 4IMYA 3RWPA 2XK6A 4ACHA 3D7TB 3OTUA 4E5WA 3OC1A 4TN6A 4BCIA 3AT2A 4A4LA 1BMKA 3L8VA 3KULA 3LAUA 4YSMA 4F9CA 2GCDA 5A54A 5HOAA 4LQMA 2VN9A 2XIXA 4D4VA 4BCKA 1KV1A 1QMZA 3UG2A 4I6QA 2OO8X 4TT7A 3ODYX 4QP7A 4TZRA 2OW3A 4TWNA 2VWVA 4E4MA 5IDNA 3QA0A 2UZDA 4JBQA 1G3NA 2FYSA 3SXSA 2HK5A 2CKQA 1PW2A 2BIKB 3FMJA 3E3BX 3WZDA 3AGLA 4C37A 1CKIA 4AA0A 4YTIA 3QKMA 3SKCA 2YWVA 1WZYA 3Q52A 3ZZWA 4E6CA 2XVDA 3I60A 2GQSA 2I0EA 4G5JA 3ZLSA 4RJ3A 5M07A 1JSVA 3S2PA 4C4JA 2PU8A 2WHBA 4IAKA 1Q8UA 4N4SA 4G16A 4YZNA 3UJGA 2PZIA 4JXFA 4FKTA 2R3KA 3BELA 5H8EA 5AM7A 1YWVA 3BWFA 2DQ7X 4Y8DA 5CY3A 5E7RA 4XV2A 3RVGA 2CPKE 2PVYA 3E64A 1M7NA 3QQKA 2OJGA 4RZWA 1WAKA 4NEUA 4XS2A 1PKDA 4RJ5A 3QRTA 4PL5A 4QMNA 4ENYA 1IA9A 5KMLA 2XYNA 4QMQA 4CG9A 1OKVA 4FTTA 5L6PA 5IUGA 1F5QA 4X21A 4DA5A 4AS0A 4FNZA 4I5PA 5B2MA 4MBLA 4O0WA 5EOBA 1PRYA 4H39A 3MSSA 3GU7A 4EK6A 2QURA 5I9VA 2O63A 2VNYA 4FG7A 3TUCA 4O81A 3BPRA 2C3KA 4HYUA 2BDWA 1U54A 4D1ZA 3KCKA 1H0WA 5IQAA 3VAPA 5GIOE 1CKJA 1GZ8A 1PMUA 3ZFMA 1YKRA 4FV6A 2C5XA 3A62A 4QT1A 3RI1A 4F0GA 1H1PA 1YI4A 2VO3A 1E9HA 3DGKA 3Q5IA 3QD4A 3OWLA 3TTIA 4U97A 3DAEA 3JPVA 5GHVA 4AFEA 2AUHA 4O7LA 4MBIA 1NA7A 2B4SB 4FTQA 2OF4A 4JG7A 5HVYA 3QBNA 3UODA 3UE4A 4PQNA 2ZDUA 5M06A 2Y4PA 5B7VA 3NLBA 2AC5A 4U80A 4FEVA 3GFEA 4IVAA 4UWCA 3BLHA 5AEPA 4ALWA 4I21A 3HMPA 5FBNC 3HV4A 4LOQA 3TV7A 4KABA 4RLLA 2PMOX 3F7ZA 4FTKA 4ONAA 1FPUA 2UZBA 3P4KA 5GIPE 2R3PA 1RQQA 1ZAOA 4AW5A 4BDGA 4FKJA 3UQFA 3UOKA 2WQNA 4I6FA 5EG3A 4CFUA 2HZNA 3QTXA 3D5UA 3DFCB 4QYHA 5EHLA 3VS3A 1FMKA 2CCIA 3UO4A 4QTBA 1Y8YA 4HZRA 3Q4TA 3COMA 4QQ5A 4ALVA 2W99B 3NAYA 4XHKB 4FEWA 2JBPA 2PZPA 5HI2A 4RVLA 4IX4A 5T3QA 2OIBA 3F3WA 2UW8A 3KK8A 1MUOA 5CEIA 4DBXA 4G17A 3CY2A 3LJ0A 3WYYA 2OU7A 1OECA 2WTWA 2WMBA 4I93A 4YNEA 4EOKA 5AP1A 2X2KA 5C8KA 5BVOA 2EXEA 2HY0A 5CENA 4CKIA 4GVJA 3I6WA 4XNEA 3R2BA 4F6UA 4MH7A 4BCOA 1CM8A 3FQHA 5EW8A 4C4IA 2NRUA 4EKLA 1WVXA 5FXSA 4JNWA 5A3XA 3FZPA 4ANOA 4C8BA 3KMUA 1YXTA 4AN2A 1J7IA 5LWNA 2EB2A 2HXQA 4BWKA 4LOPA 3E88A 1KE5A 4IM3A 4OTGA 4RWIA 4EHZA 2OJIA 3CQUA 5LOHA 4CGAA 2YM7A 2A4LA 4GG7A 4YO6A 1KE7A 5DT4A 5HCXA 4BDDA 5KX8A 5FP6A 2UW7A 3PYYA 2B53A 3ZSIA 2J0IA 3MBLA 4UXLA 3RJCA 1WBNA 3F66A 3QKKA 3MYGA 4DH5A 2OLCA 3ZS5A 5CSWA 3DQXA 3NNXA 4A9YA 2QHMA 4UY9A 4YGAA 5A4CA 2V62A 4F63A 5BVNA 4O38A 5L2QA 3EZVA 2C5OA 4N6ZA 2QLQA 1G8SA 1KUTA 2XKDA 4E4NA 5ETFA 4KUJA 3FQSA 4J98A 4DFXE 1XQZA 3R73A 4AE6A 4BDIA 3TWJA 1MP8A 5DGZA 3NNVA 4U6RA 3NRMA 1LEZA 1QCFA 3G15A 1JWHA 3HV6A 3PA3A 3QLGA 4G3DA 2AC3A 5CU6A 5HZNA 5JZJA 5I5ZA 3R01A 2BUJA 4NIFA 5CT0A 1JNKA 2OKRA 4L46A 2VGPA 3K5UA 3VBXA 3MS9A 3KN5A 4O1OA 3GNIB 4AW2A 5BQ0A 2JBOA 3TL8A 4XJ0A 4J8MA 1ZYSA 3MFTA 4FKOA 1Z5MA 2BKZA 2CJMA 4XV3A 3KVXA 3UC3A 4I24A 2XNNA 3BGPA 5EM5A 1PHKA 1Q97A 3E87A 2GQRA 3BLRA 5FRIA 4QPMA 4O2ZA 2C6DA 3CQWA 4XEYA 4F70A 4USEA 3AMAA 3FV8A 4WA9A 4YZMA 3Q4ZA 5B0XA 4JAJA 3HMIA 3QFVA 3LOKA 2UZLA 4TWCA 4PL4A 3MA3A 5HBEA 1NVSA 5C26A 5FEQA 5AUUA 1JAMA 1Q3WA 2YA9A 3SD0A 4R5SA 5JKGA 3U6IA 3FC2A 4QYGA 3OY1A 4EOPA 3IGGA 4ERKA 3NUYA 2KULA 5E92A 4NKAA 2A2AA 2ONLC 3FDNA 5IQGA 2XKFA 2WMXA 3LQ8A 2R3HA 2GFSA 5DRDA 4BDHA 4IAYA 2C1BA 2EWAA 3PWYA 4EH7A 3LCKA 4QMSA 4C0TA 3TDWA 4FV0A 5A4LA 3COHA 3HZTA 1FVRA 3NUSA 5IU2A 2YIWA 3C7QA 3JS2A 4F1MA 3OCBA 3KGAA 5IMEA 1GJOA 4JIKA 2YCFA 3OD6X 3MWUA 4TNBA 4XG8A 2X9FA 2Z60A 2W96B 3QQUA 2XUUA 5DEWA 5E1EA 4C36A 2CGVA 2OH0E 3VVHA 3PVBA 4O0UA 4M84A 4U40A 4FYOA 5CNOA 2ZM1A 5BVDA 2IPXA 4NWMA 1LEWA 4IZ7A 2GNFA 4M14A 5J95A 3R8ZA 3VULA 2EB3A 3UPXA 4D4RA 2ZDTA 4J99A 2XZSA 1U5QA 2F7XE 4FTRA 5DIAA 2PMIA 5AV0A 1ZY5A 1A48A 2VWIA 4N70A 3MTFA 4FV9A 1OUKA 2WEVA 4A9SA 3C50A 3F6XA 4FIJA 5E8TA 3QRKA 4AGCA 4R8QA 3OWKA 2A0CX 3UYTA 4R3PA 4ZSLA 3GCUA 2J0LA 5CEMA 3NUPA 4RBLA 1ND4A 4TL0A 5ETAA 5IH4A 4ZTNA 1K9AA 4K8AA 4O0YA 2OXYA 4A9RA 4DLJA 4G9CA 3QCQA 4EOLA 2JFLA 5IF1A 4DG3E 3MH2A 2E2BA 4L45A 2QD9A 4WOVA 3TZMA 4RWJA 2J7TA 1JPAA 1YDSE 3R8VA 4D28A 3PZEA 3C13A 2JFMA 3NS9A 4TRLA 2VWZA 1IRKA 3NW7A 2W1IA 5HG7A 4CKJA 5IQFA 2HW7A 1BYGA 4AACA 1OUYA 2GS6A 1CKPA 4U8ZA 3MY5A 4S34A 3R6XA 2ZJWA 3UTOA 4EI4A 2VWYA 3LLTA 4X2FA 4YC6A 4M8TA 5J9LA 4IB0A 2PE1A 3BBWA 4U79A 2J0JA 3CE3A 3ENHA 4U42A 3ZZEA 3R00A 1ZOEA 5CEQA 3BYUA 2YEXA 2PULA 1HOWA 1OL1A 2G2IA 3RK5A 4BC6A 5JGDA 5A4QA 5HU9A 4FSQA 4DFUA 3FLWA 2BAJA 4FV3A 2OXXA 3P7CA 3FXXA 3F2RA 2BRMA 1UNLA 3K3IA 4XMOA 3NYOA 2WMAA 2XYUA 1SMHA 2HY81 3DLSA 3LFQA 5CX9A 3V5WA 4F7JA 5HLWA 3TDVA 3QCYA 4GK2A 3OUNB 3FMLA 3COIA 3PTGA 3U9NA 2ZB1A 4YLKA 4IBMA 1V1KA 3L8PA 5CVGA 1Q8YA 3DTWA 3RGFA 2W05A 3KULB 3UGCA 4EH2A 4UX9A 3UQCA 3R7EA 4I4EA 4I5HA 1OVEA 1WBPA 2ESMA 3DKGA 1OL5A 4JLCA 1BUHA 4GS6A 4U3ZA 3E8NA 3O2MA 2C4GA 2R7IA 1J91A 2QHNA 2XB7A 4NZWB 4TYHB 5DPVA 3RPYA 5CSPA 1PXIA 4ENXA 3FLZA 2JKQA 5DOSA 2R3OA 3C4FA 3QCSA 4BCFA 5I4NA 3ENMA 4JG6A 4A9UA 4EH5A 2WMVA 4PDPA 4QQCA 1WFCA 3V5QA 4Z9LA 5HCZA 2EUFB 3PUPA 3PP0A 3QQLA 2HWPA 1JSUA 4Z55A 2P55A 5C4KA 4DYMA 5BVFA 2YDIA 4EZ3A 3VS1A 4EOJA 3EOCA 3LXNA 4G2FA 5L4QA 2Y8OA 4M12A 2W1DA 1SVGA 4PX6A 4QPAA 4WUNA 1VJYA 2C3JA 4G1WA 2QOHA 4JAIA 4V05A 4EWHA 4I20A 2F2CB 4TY1A 1YW2A 4YJUA 5CQUA 4ZZOA 3FYKX 5E8UA 2CNVA 5EDRA 3BRBA 4AUAA 3NYNA 3IDCA 4GYGA 2DWBA 2YJRA 4J71A 4L01A 2GHLA 3CGOA 3BE2A 4LG4A 1P14A 1B38A 4IM0A 3NAXA 3P7BA 3GVUA 3MPMA 5A14A 2YIXA 4BZOA 3N4VA 3FI8A 2XNGA 2PE2A 5LCJA 2XKCA 3Q6WA 4BTJA 1H1RA 2VO7A 3EFKA 4RG0A 4KSQA 3HRBA 3FE3A 3OFMA 4WO5A 5TF9A 2JGZA 3NVMB 2BKKA 3AT3A 3KQ7A 3OEZA 3E93A 3IOPA 4FSMA 5JFWA 4ASXA 2GPHA 3CPCA 3OHTA 4YU2A 1UKHA 3JYAA 5AA8A 4FTCA 4CFFA 4V0GB 2WZJA 3NWWA 4YZBA 3IQ7A 5EYDA 2UVZA 3R30A 4JIAA 3UZRA 2OXDA 4Y72A 2EXMA 5ANKA 2BRHA 4FEXA 2OFVA 2VRXA 2BDFA 4F6SA 5AP6A 5E9EA 4NTSA 1RJBA 5I9ZA 1M2RA 2I6LA 4IC7A 5EQYA 3VQUA 1S9JA 2ITTA 1PXLA 3F3VA 3TACA 5LXMA 4I6HA 3C5UA 3W2SA 3FHRA 1UV5A 1ZARA 3P86A 3TNWA 3VBWA 5CZIA 2PVKA 3ORKA 3QTRA 2ACXA 3QTSA 4LRJA 4BCQA 4C61A 2C6EA 4OBOA 1Q5KA 5B2KA 4BCPA 2YCRA 3GQIA 4DH8A 3ID6C 2QG7A 4FTLA 4BZNA 4DINA 4D2TA 4LOOA 2PUIA 3F2AA 5DHJA 2H6DA 5D1JA 5DR6A 4PMSA 2O0UA 3A7JA 3GB2A 2PMLX 5GZ8A 2IZSA 4DEEA 2ITPA 2YLEA 3A7GA 3MY0A 1CDKA 2ITXA 4O21A 5AX3A 4K77A 3D7ZA 4NSTA 1ZZLA 2GNHA 3HX4A 4BFMA 5J1WA 5LMKC 4WT6A 3QQFA 4IX6A 4YBJA 3L9MA 2J50A 4BKYA 4F7LA 5HIBA 2XA4A 2QODA 4F1TA 4KIPA 4FV8A 1BL6A 5AWMA 5EM7A 3F5PA 1MRUA 4J1RA 4BDKA 1NW1A 4RZVA 4TW9A 3NDMA 4U5JA 5DRBA 3SLSA 4A4XA 5HEZA 4L52A 4ANQA 4D4YA 5KO1A 3K54A 3MI9A 3VNTA 1YDTE 2P0CA 3E7OA 4UMTA 2QU6A 4K9YA 2H96A 4NJDA 3ITZA 4BN1A 4ZZNA 4BIDA 1X8BA 3DQWA 4F9BA 3MN3A 2J5FA 3QYWA 3TNPC 3DJ7A 2R3RA 4FSZA 1Q99A 3QGYA 4USFA 4AGWA 1OIYA 2OIQA 3PXYA 4EKKA 4L8MA 4ZIMA 1PMVA 4QP9A 4BI0A 5M57A 4RFMA 2R0IA 1NT2A 3M1SA 4DT8A 3LFBA 3ACKA 3ZCLA 4DEIA 5FP5A 4AN3A 1T45A 2F57A 5ACKA 1WBTA 3V5LA 4XOYA 2PPQA 4M0ZA 3CD3A 2GS7A 2W9FB 2X7GA 1ZMVA 1RW8A 4XYFA 3BHUA 4BDEA 5IQEA 3KMWA 4E93A 2EU9A 4BL1A 2PL0A 3G9NA 3P23A 3W16A 5ANJA 3DXPA 2VWUA 4QMYA 4L3LA 4MXZA 4RQVA 4NM7A 2WU7A 5HORA 2OGVA 5KE0A 3WE8A 4L6QA 1FGIA 5DLSA 3ZRLA 3B2WA 5C8NA 5C27A 3EYGA 2UZUE 5HLNA 4IANA 4FK6A 5HO8A 1UWJA 1GZOA 1J7LA 4LV5A 3LMIA 2GSFA 1J1BA 5DFPA 4QMWA 3POZA 4EL9A 2JDRA 4CVAA 2BZIB 4HPUE 3GBZA 2XNOA 5KUPA 5EQEA 3OOGA 2A19B 2Z7QA 3L9LA 3QZGA 4R6VA 3TKHA 3WZUA 4RSSA 3ZEPA 3OXTA 1NVQA 1W7HA 3R71A 4BDFA 5K5NA 1FGKA 4YLJA 3HAMA 5IUHA 3DOGA 3MJ2A 3FPQA 5J5TA 1PXMA 3VS6A 4BKZA 3DCVA 3MPTA 4CCBA 4L53A 1W8CA 3N4TA 4PP9A 5EKOA 4CQEA 3PXKA 2QNJA 3HVCA 4P4CA 2R3IA 2WQBA 4EJNA 3QL8A 4G9RA 4U7ZA 4DFBA 3ZUTA 4UZDA 2W4JA 4KKGA 4APPA 4YO4A 1TQPA 4C4GA 4HVDA 3A2CA 2X39A 1XH9A 2HIWA 3AC5A 2F9GA 1YI3A 3CJFA 3ORPA 3ZLXA 1TVOA 3NGAA 4C4HA 5CNNA 4JX3A 4XG2A 1REJA 1VR2A 2QOIA 4PY1A 4Z3VA 2E9OA 2HYYA 3HDMA 3BYSA 3TG1A 3C51A 5BMMA 4M97A 3V6SA 4R77A 4DEDA 2ETRA 3U6JA 2C1AA 2VTRA 1DI9A 3DB8A 1L3RE 2C6TA 1FMOE 2QG5A 4XRLA 5EQPA 1KE8A 1OIRA 3H30A 2CSNA 4BBMA 5J7HA 3FHIA 5AP4A 4EYMA 4S32A 3IW5A 3RPSA 4HYIA 3QHWA 3BBTB 3V3VA 5DE2A 4DH7A 4WSQA 2PYWA 3R7YA 4JBOA 2ERKA 2JDTA 3EKNA 3DBDA 4RJ8A 4W4WA 4X3FA 4EQCA 3QHRA 5K5XA 2YAAA 2XIRA 1Q8ZA 2IZUA 3QC9A 5I0BA 4FG8A 3N9XA 3H10A 4YURA 4D55A 1YWNA 1OL2A 4GV1A 4PPCA 4X6QC 5HO6A 4CEGA 3ROCA 2HZ0A 2IJMA 5E1SA 2VWXA 3VBVA 4E4XA 1OBDA 2CMWA 5HHWA 4RWKA 2CGWA 3DZOA 4RFZA 3WF9A 2R0UA 4RIYA 4W4VA 3UIBA 4HYHA 3U51A 3SHEA 2UW5A 2FUMA 2WXVA 3I4BA 4NFMA 2XM9A 4JL9A 3G0EA 2C6OA 4FKSA 5LVMA 3ZBFA 2PZRA 5ETIA 2YM5A 4QQJA 2YWPA 2B9FA 4ANBA 2YAKA 4E20A 2WMWA 5A4EA 5CF8A 5DR2A 5LVNA 3BIZA 1FVTA 4FV1A 1EH4A 5M4UA 3Q04A 4CRLA 3C4XA 4GU9A 2P33A 4S31A 1OI9A 2WTKC 4M0YA 4C2WA 1Q41A 3FKLA 3PXRA 5DWRA 2W06A 3PY0A 3TXOA 4DH1A 2VTNA 4DEAA 2A27A 3RNYA 5HG8A 3ERKA 3BCEA 3S4QA 5AM6A 3MFSA 3JXWA 3KU2A 4FL2A 4AU8A 2R64A 4E4LA 4EZ7A 5CANA 5DT3A 3V04A 3F3TA 2H9VA 2OI4X 2FA2A 3MV5A 4AA4A 2ZM3A 3ZUVA 4BWPA 2WNTA 5GJGA 4DHFA 2QOFA 5M4CA 3TCPA 1GZNA 3QWKA 5CAQA 2BRNA 3LM5A 1BI8A 4HGEA 3R7IA 4FTMA 4YR8A 2WU6A 3EMGA 4RIYB 2VX0A 3QXPA 2J9MA 5CS6A 3EJ1A 5JSMA 3KXXA 2Y7JA 2WD1A 4YUQA 3QGWA 1J3HA 3IDPA 4LGGA 4MAOA 4UMPA 5L2TA 1G8AA 2G15A 3D2IA 3PXFA 3WBLA 4GT5A 3WOWA 1WMKA 4FOCA 5EYKA 4IWPA 5FWKK 4I0SA 2B9IA 4ANSA 3KXZA 3FLQA 4IJ9A 3RINA 4F0IA 3E8EA 4OTRA 3LW0A 2CHLA 3C4WA 5CAPA 3SW4A 3P08A 2P4IA 5IQHA 2J0KA 3WF5A 4Y73A 3ATSA 3EYHA 3EFWA 5DBXA 4C7TA 1OKWA 4IXPA 2JAVA 4PNKA 3IECA 3FJQE 1M17A 3ORXA 4EBVA 3PE1A 1Z57A 2WO6A 4UWBA 4LFIA 2W4OA 2W1CA 3BGQA 4KAOA 5JZNA 1XO2B 3CC6A 1WBWA 3NNWA 3P1AA 3HNGA 3UBDA 3I1AA 4U9AA 4UYAA 3PY3A 4LL0A 5KCVA 2QR7A 2XIKA 4HCTA 4LM5A 2FSMX 1H1WA 3PJ2A 3O0GA 1PXPA 2JKMA 2YZAA 3FMKA 3OWJA 4EK8A 5IA2A 4HCVA 3UVRA 4KRCA 4OAUC 2PE0A 5FTOA 4FT9A 4LUEA 4I6BA 1V0BA 4EWQA 1H08A 4H36A 3MH1A 4OBQA 5AR7A 3F7WA 4WG4A 2VTQA 3QZHA 3JUHA 3ZC6A 2C6LA 5EOLA 4HW7A 4ID7A 4IE9A 4KBAA 2OWBA 2E9PA 3TV6A 4NIFB 3GCVA 2ITZA 3VIDA 3GI3A 4MTAA 4DC2A 5HVKA 1H26A 3NYVA 4F4PA 4XP0A 2YISA 4ITJA 3EFLA 1YDRE 4PDOA 4RC2A 1M2PA 2QVSE 3OXIA 3DKFA 2Y0AA 3POOA 4BCGA 2XEZA 3S0OA 3AQVA 4KS8A 4P90A 3HA6A 5LCKA 3EQCA 3ORMA 2P3GX 1QL6A 3A7FA 2X1NA 5FBOA 3ZUUA 1BI7A 4N0SA 2YACA 4GIHA 2OBJA 4TXCA 4Y95A 2ETKA 1VYWA 5FG8A 1WVYA 4HGTA 5ACBC 5KHXA 3UO5A 2PUPA 1H8FA 2WQEA 3FBVA 2R7BA 3O7LB 4KNBA 2X81A 3BU3A 4EOSA 4ZTHA 3Q5ZA 1GIHA 3SX9A 4AFJA 5H3QA 3D0EA 4JRNA 3LQ3A 5A46A 4QO9A 4D2WA 3NR9A 2IN6A 3QRJA 1ZLTA 1WBSA 1YHWA 3U87A 4AOIA 4F6WA 4FKVA 2X6DA 5CU4A 5AMNA 2BZJA 2YM3A 1ZMUA 1WVWA 3FZOA 4TNDA 4W8EA 3AD4A 4Y5QA 4P5ZA 4FNYA 2QOOA 1OITA 2CKEA 1BLXA 2OJJA 4AZEA 2Y4IB 3H9RA 3ZLWA 4F0FA 3BQRA 2HXLA 3H4JA 4ZAUA 3RZFA 1UNHA 3BQCA 3QU0A 3RBWA 3TV4A 2QKRA 3OCTA 2ETMA 2R3FA 4MCVA 3VF9A 5IQDA 3EQIA 1Y6AA 2C6IA 3ALNA 4KBKA 4EONA 2JKOA 4XP3A 5B2LA 5J9ZA 2YZLA 4WSYA 2W1ZA 3WF6A 3IO7A 4U0IA 4UEUA 4H3PA 4MF0A 4QP8A 3DT1A 3QD3A 5AR5A 5AUYA 3A7IA 4LL5A 3AXWA 3AMBA 4QTCA 3EQHA 5JFXA 2C0TA 3DAJA 3PPKA 5M51A 1L8TA 4KD1A 4XUFA 3PLAE 3B8RA 2YABA 2RL5A 2RSVA 3PG3A 4YJRA 3REPA 4CTCA 5KNJA 3G90X 4IDVA 1YXXA 4CYIA 3AC3A 2Z8CA 4YJVA 2WTJA 4TYEA 3U54A 2C69A 1LUFA 4MXYA 4KS7A 2WTCA 3AGMA 4HVHA 4OTPA 1A9UA 3OMVA 4EJ7A 5AX9A 3DAKA 4EOIA 1SZMA 3NX8A 4FKIA 4RX5A 4FEUA 4QP2A 2C0IA 3RAIA 3Q96A 3TTJA 3QUPA 4FKLA 5LQFA 5IA5A 3TNHA 3QTUA 2HOGA 2Q0BA 3ZYAA 3UMWA 3U8WA 5ANGA 3MW1A 2F7ZE 5AP7A 3WF7A 4FV4A 4KB8A 5CU2A 3I79A 1Z9XA 5I9UA 4BGHA 4I23A 3ANRA 3L1SA 3R9RA 5HNIX 3ZM9A 2HAKA 2XK3A 4FSYA 2XEYA 1UVRA 3KF4A 4R1VA 5CI6A 1GY3A 4ZTSA 3W55A 4JS8A 4M66A 2BALA 3VUIA 3SC1A 4C3RA 4DFYA 3PZHA 3G5DA 3R8MA 5AUXA 3LLAA 3Q9YA 4O22A 3TKUA 4BY9E 3DV3A 3NW5A 3BV3A 3DFAA 3QRIA 2CKPA 3QD2B 4G34A 4NK9A 2XBJA 2XJ0A 2V7AA 3WZJA 2FSLX 5DVRA 3VUKA 5M4FA 4AT4A 2IVUA 4XOZA 5FEDA 3DDQA 3Q4CA 4O82A 5DT0A 3MVHA 2XCHA 3AD6A 4M69B 5F4NA 3NSZA 4OTWA 3AMYA 3D15A 4FZ6A 4CT2A 3R7VA 3D83A 3PG1A 4FNWA 2CN8A 4FR4A 5HE1A 3RHXA 4BIEA 3LXKA 3FUPA 3F5UA 4GJ3A 2IWIA 3V5JA 4F9YA 3EQPA 4RVMA 4ZXTA 1CTPE 2O64A 5F95A 3VBTA 3R7UA 1XHAA 4X2NA 4XX9A 4O0XA 2WFYA 3Q4UA 3TKIA 3OBJA 3R02A 4TYHA 2VWWA 4KWPA 2GQGA 2I40A 4OT6A 3FZRA 5A6NA 3C4ZA 3EQDA 4IJPA 3RP9A 2O5KA 3OW3A 4XG9A 4D0XA 4KSPA 2OK1A 3LFSA 2C6KA 3FL5A 4EOQA 4F7NA 1IASA 3CR0A 4CSVA 3QTWA 5GJDA 4AA5A 2BMCA 2GFCA 2OG8A 4PPBA 4FIHA 4GKIA 4F1OA 1JOWB 2FGIA 3EIDA 3OP5A 3GUBA 4DG2E 4FSRA 1A06A 4JR3A 2Q83A 3GC8A 3LHJA 3R1QA 3WILA 4BIBA 3LXPA 4D1SA 3GU4A 3TZ9A 4TKSA 4CLJA 1SNUA 4QYEA 2JIUA 4FI1A 2GTMA 3PSBA 3I5NA 3VS7A 4DEHA 5DEYA 4V01A 4O7RA 1YHVA 5E90A 3T3UA 5IA1A 4Q5HA 5HBHA 3O50A 4FYNA 4QPSA 4R1YA 1XWSA 3GXLA 3D5WA 1KSWA 4MKCA 4JJRA 4ZS0A 3S00A 4QP3A 4XRJA 2CGUA 1UKIA 3M42A 4OTFA 1OL6A 2YERA 3FI4A 3R28A 2ZV9A 2BZHB 1JLUE 1PKGA 5DR9A 4HVIA 4DCAA 3CP9A 4C57A 5A4TA 3UQGA 3SG9A 3LFFA 2UV2A 1AQ1A 4MD7E 2PWLA 4IIRA 4HVGA 2QU5A 4HJOA 1YWRA 4O0SA 4FE2A 3AC1A 2R3QA 3OT8A 3TM0A 5EHOA 1JVPP 1KOBA 4X6RA 3UG1A 3UYSA 4O7NA 4WNKA 3MY1A 3E62A 4L3JA 5E8ZA 5L6OA 4B7TA 4D2VA 5FM2A 2ERZE 5IQIA 3RM7A 2VTIA 4I22A 5T6KA 4K11A 4GIIA 2QC6A 2BROA 3DB6A 2Z7LA 2X7FA 3P7AA 2E9NA 2QQ7A 4TWOA 2ONLA 4IAIA 5C03A 1I44A 5E91A 4M13A 2UZNA 3Q53A 4O91A 3HP5A 4FKWA 4X2GA 5CAVA 2B0QA 4HCUA 4IVBA 5IQCA 4FGRA 2X4FA 4U44A 2WEIA 3W10A 3DXNA 4O7SA 3DKCA 4WBOA 3UO6A 4G6OA 3GCQA 4XG3A 3FXWA 1BL7A 4AAAA 4BI2A 2ITQA 1PXJA 4I3ZA 3VF8A 3LE6A 4KKEA 4NM3A 4UYNA 3LFAA 4UALA 4IAZA 2JD5A 1GAGA 3NVKI 1BKXA 2WAJA 1NXKA 5M44A 2VTPA 5AUVA 5IA4A 1IG1A 2E9UA 3OT3A 4A9TA 1LPUA 1XBBA 2OSCA 4QOXA 5T68A 3W2RA 2XS0A 3IK3A 4C38A 5BPYA 1O6YA 3EHAA 4EYJA 2GTNA 3PWDA 4ZLYA 3RAKA 3LCDA 4NTTA 2J6MA 3RWQA 5AAGA 4QMVA 4Q2AA 5GJFA 3BYMA 5I9WA 4J95A 3I5ZA 4EHVA 1PMNA 3CTQA 4O0VA 4AZSA 3UZTA 3GFWA 2YHVA 4YZDA 1FQ1B 3ZRKA 5M56A 5I3OA 4IAAA 1MQ4A 3H9FA 3QCXA 2OH4A 4UZHA 1FOTA 2WTIA 5BUEA 3F61A 4AOTA 5TT7A 4C02A 3DBQA 4GCJA 4RA5A 4XCUA 3PJ3A 4LMUA 4GKHA 4MD8E 2GNIA 2UW9A 2W0JA 3GCSA 3L9PA 4QYFA 5ANEA 4F9AA 3ZLYA 3FPMA 3G33A 4RIWA 5FTGA 4BI1A 3HLLA 4UMUA 3HECA 5CTPA 3QKLA 3TJDA 5DA3A 5IKWA 4R78A 2FSTX 3DK7A 3CEKA 4FZDB 4ACDA 5AP5A 4APCA 5C1QB 1Q62A 2YCSA 4LV8A 2X8DA 5IH5A 3RAHA 1MRYA 3PSCA 3PPZA 4FTAA 3KRJA 4QYYA 4RIXB 5HCYA 5CF5A 3ZH8A 1V0PA 3CCNA 3FMNA 5HIEA 1SVHA 3NZ0A 1JKKA 3UOHA 1ZWSA 3ZDUA 3EKKA 4C4EA 1VEBA 3C0IA 5D7VA 3EWHA 1H1QA 1FBNA 4QMXA 3SV0A 3BZ3A 3PPJA 3HA8A 1SYKA 2UUEA 3HV7A 3D2KA 3OUKA 2VTHA 4BR3A 4ZLOA 3H0YA 3W33A 2YM6A 5L8KA 2B9HA 3PXQA 4RJ7A 3VS4A 3M2WA 2HCKA 2NNWB 1H1SA 2QONA 4AZFA 4LMNA 3VS0A 2HW6A 1OL7A 1ZYLA 3JVSA 2J5EA 2WTVA 3BGZA 3II5A 4FT0A 3TZ8A 4ACCA 2IG7A 4L9IA 3VHKA 3V01A 1E1XA 4ANLA 5ETCA 4J7BA 4ASDA 4NFNA 3E8DA 5E8SA 3OY3A 4DT9A 5TE0A 3K2LA 4CYJA 4QMOA 5BX0A 2BVAA 4CCUA 4G3CA 1MQBA 1PYEA 3AC4A 3OG7A 3O8TA 5ITAA 2QKWB 4Y83A 2RG6A 5IH6A 3PIYA 3RZBA 4O1PA 4ZS4A 2KTYA 3A8XA 3AG9A 5JMSA 2DUVA 4O7YA 3MDYA 4FIFA 2VD5A 1OIQA 3PFQA 3KREA 2PVMA 3FWQA 3LFNA 4ZMFA 1ZOHA 3BV2A 1O6LA 4PMMA 1R0PA 3CXWA 4F99A 4C3PA 3GT8A 5I9YA 4EC8A 1Q61A 4X2JA 5DG5A 1VYZA 3HGKA 5D7AA 5H8BA 4DLIA 4NL0A 3GC0A 1OIUA 4ASEA 3RMFA 5CSXA 4IB5A 1B6CB 4K33A 2W1FA 3LZBA 2Y4IC 5M53A 5JQ8A 3CPBA 4FODA 4EBWA 5BUIA 2RFSA 3GP0A 2OZAA 3HUCA 1YXVA 2V5QA 4QMZA 4ZTLA 4ZK5A 3TEIA 3C9WA 2I0YA 3FLYA 3Q32A 5HE2A 2UZTA 2C47A 2V55A 3ZOSA 3HMOA 4OTQA 4Y5HA 2XNEA 3AOXA 4BZDA 4BBEA 1K3AA 2Q0NA 4PNIA 4WRSA 5AFVA 2B52A 4WIHA 2IO6A 3AC8A 5IQBA 3EN4A 4I5MA 5JEBA 3EH9A 2BAQA 4FICA 1JKTA 4EORA 3QX2A 1UU9A 4PUZA 2QO9A 2DYLA 3IKAA 1OPJA 4K2RA 5F20A 4BDCA 4F64A 2BFYA 3ALOA 1GNGA 2C5VA 2PVHA 2XK9A 4FC0A 4FK3A 2XJ2A 2UZEA 1YI6A 3A60A 4I41A 5HIDA 3A99A 1ZOGA 2JIIA 3LCTA 3FI3A 2BPMA 5EYCA 3P78A 2IVVA 3G9LX 4L3PA 4TYIA 4UWYA 4XG4A 3W2OA 4CD0A 4KINA 3ZONA 3CY3A 4UV0A 4ORKA 4EUUA 3EL7A 3D5VA 3MPAA 4MBJA 2W1HA 3EQGA 3IGOA 4ZY6A 4CFWA 4AZVA 4DH3A 4TYJA 4MEDA 4AGDA 3BHVA 4LI5A 1PXNA 2GHMA 1W82A 4MNEA 4HVSA 3FLNC 5EM8A 3Q9XA 1H28A 3DK6A 4IFCA 2E9VA 2YIRA 4MWIA 2VO0A 2WMQA 2CLQA 1JKSA 5LVPA 1WCCA 4RIXA 2R3LA 4A06A 3DLZA 3OTVA 5F9EA 4WG5A 3DK3A 4G6LA 4BCMA 4CRSA 4FKRA 2PSQA 1YOLA 3E7VA 2Z7RA 4IH8A 3EN6A 1H00A 4WRGA 4XBRA 4DCEA 2CNUA 3BX5A 4BF2A 4ZP5A 3S3IA 2G01A 3VN9A 4S30A 3UNKA 5CEPA 4M69A 2X6EA 4QMPA 3C0GA 4FTOA 5LMAA 4NU1A 2JLDA 2JAMA 4ZTQA 5CVHA 1Q24A 4D2SA 2XNBA 3PDTA 4J96A 4ERWA 4X3JA 3E92A 3G51A 2JDSA 3NEWA 4O0TA 3WE4A 2F7EE 1H01A 5JK3A 2Z02A 2XK8A 2I0HA 3CKXA 4QMLA 4RQKA 4BTKA 4EH6A 3MJ1A 5KMJA 2PVFA 5JRSA 5HD7A 4Z16A 3ORNA 3MH0A 4H05A 5GNKA 2C3LA 5E8WA 3W2PA 5M08A 1VZOA 4ZMEA 5FM3A 3ZC5A 5L2IA 2ZMCA 3KVWA 3H3CA 2YIQA 3RK9A 4MNEB 4O6LA 4F9WA 4H3QA 1CSNA 4GFMA 5JRQA 1DAYA 4RRVA 1F0QA 3D7TA 4FIGA 3CKWA 4OW8A 3UNZA 5HO7A 2GU8A 2W17A 4EK4A 4PPAA 3I6UA 5J8IA 4BHZA 3N4UA 5HESA 3OOMA 5C4LA 1T46A 2G2FA 2PUNA 3IOKA 3ZEWA 4C34A 2J90A 1OM1A 2ZV2A 3SG8A 3PVWA 4U81A 4YJQA 1H4LA 3OF0A 4DTAA 1P4OA 4PMPA 2X9EA 3LFCA 4DGNA 1P5EA 3PRIA 4JVGA 2YM8A 3QTZA 2CN5A 4RWLA 3CLYA 4Q5EA 5LWMA 4ITHA 5JGAA 4ALUA 4D1XA 4R3CA 4NCTC 3WIGA 3WYXA 4N6YA 3M11A 3Q9WA 3FMHA 4DGMA 3RCJA 4L67A 4FUYA 3HEGA 4K18A 1DM2A 4M15A 4XLIA 4YJPA 2ZV7A 3ATTA 1REKA 3ZSHA 4XV9A 3DTCA 3O71A 3UZPA 2W1EA 4HYSA 4OBPA 3RHKA 3GGFA 4AQCA 5L3AA 5CZHA 4LUDA 1ZYJA 1YXUA 4AE9A 3KKVA 4JOAA 2XBAA 5FD2A 4LRKA 3UP2A 4E5AX 5EDQA 5I3RA 3AD5A 2CDZA 4W9WA 4NW6A 2XRWA 1IA8A 4YSJA 4JBVA 4RT7A 1XBCA 5J9YA 5FXRA 4CZUA 5J5SA 2VX1A 3DKOA 2WIHA 4CMUA 1B39A 1J1CA 4IVCA 2C6MA 4D9UA 5CXZA 3PP1A 1ZY4A 4RIWB 5E8YA 2JIVA 4L7FA 4ZLZA 3KL8A 5HU3A 2OF2A 3R8PA 2FB8A 3ZBXA 3RNIA 4IM2A 4V04A 3ULZA 3QZFA 3HMMA 3F9NA 2LGCA 3LXLA 4WD5A 1LR4A 3WI6A 4Q9SA 2HZIA 3LJ1A 2R3JA 5FLFA 2LAVA 1V0OA 4FUXA 2VAGA 3PA5A 5J79A 2BIYA 3FL4A 4TPTA 3IW6A 2FSOX 3R1SA 3SOCA 1HCLA 4HNIA 5DYJA 4AXAA 4MXAA 2OIDA 4QP4A 4KIOA 5KMKA 3VUHA 4W9XA 3ZU7A 4FEQA 3FMDA 3R8LA 2WMTA 4TYGA 5BVWA 4DFLA 3JR1A 4EOMA 4B0GA 3PXZA 3LVPA 3DY7A 2VNWA 1CMKE 4AT5A 4OTHA 3BU5A 2OICA 3W32A 3VRYA 5HQ0A 3C1XA 4BRXA 2VTJA 4C33A 2I7QA 2ZVAA 3RPVA 4RA4A 3ACJA 4HGLA 4MX9A 5FDPA 5AJQA 2WMSA 5HLPA 4CQGA 2JITA 3V5TA 2EXCX 4G3GA 4I92A 4IFGA 5JN2A 2XH5A 5HKMA 3UOLA 3ROYA 2VGOA 3KF7A 4FF8A 3IDBA 3S95A 5K9IA 2CLXA 2EVAA 3UPZA 4PDYA 3FY2A 3HV5A 4BCHA 2B55A 5J7BA 4QMUA 2W4KA 2JC6A 2PZYA 3VUDA 4O7ZA 4CFVA 1XKKA 2PVJA 3O51A 2X0GA 3DBCA 5H8GA 3Q3BA 4NW5A 1M2QA 4JI9A 2B7AA 3ORZA 4I0TA 5BNJA 3C4EA 3HDNA 1W98A 4AN9A 3W8LA 2C5NA 2YIYA 3BEGA 4C58A 4LGHA 5CF4A 1SNXA 2WQMA 3MH3A 1GIJA 5CWZA 3SRVA 4BDAA 5JH6A 4ZJIA 2GNLA 4FG9A 1O6KA 4OAVB 1M14A 3AT4A 2FH9A 3EN7A 4R7BA 4QTAA 2IVSA 4EQUA 5L6WL 1HCKA
chains in the Genus database with same CATH superfamily
3QUDA 2XIZA 3SA0A 2NRYA 4ARKA 3GCPA 4GK3A 4RVTA 2R4BA 1XH8A 3FSFA 3GQLA 4D5HA 3QD0A 3UIXA 3A61A 3QQGA 4CV8A 2BHEA 2RFDA 3P79A 4LRMA 5C01A 5K3YA 4BCNA 4BDBA 4R7IA 4K6ZA 4O7VA 2BZKB 3QXOA 2RFNA 1XR1A 1RE8A 2C68A 4ZEGA 4L7SA 3SW7A 4EHEA 3DPPA 3RCDA 2BTRA 3I81A 4NSWA 4X2KA 3VEBA 3FAAA 1APME 4F09A 4ZY4A 4J8NA 5AIRA 4U3YA 5AR8A 2RKUA 3Q6UA 4FKUA 4H6IA 3R1YA 2AEGA 4QMMA 3FY0A 3WZKA 2NPQA 4RJ6A 2F7OA 1OPLA 1U46A 3V5PA 4G31A 5AUTA 3ZHPC 3I04A 4RVKA 2F49A 1IEPA 3FSKA 3SXFA 4IWOA 1UU3A 3OWPA 3ZFYA 4DFZE 1Q4LA 2GAFD 2ND0A 2XRUA 2ITUA 3OS3A 1XH6A 2CGXA 4DN5A 4BDJA 3QC4A 2XK4A 4GU6A 4DGLC 5EW3A 3E5AA 5FDXA 5HICA 3TZ7A 3C5IA 1PXKA 4H1MA 2VTMA 3F5GA 4RC3A 3GENA 3MVMA 1DAWA 4MWHA 4YJSA 5JQ5A 1W83A 3NMUF 4KA3A 3FZSA 5KBRA 4IZAA 4HY9A 3R9OA 1JSTA 4HGSA 4Y46A 1OGUA 3O96A 4WHZA 1QX1A 2SRCA 4MHAA 3NIZA 4YHTA 4B8LA 2IZTA 4MQ2A 4YHFA 3G6GA 2O65A 2XAOA 4NQIA 2GMXA 2P2IA 2R9SA 4EZUA 4RJ4A 2J2IB 2V0DA 5IA0A 2Y6OA 5EDPA 2NP8A 3BYVA 3CQEA 3F3UA 3ELJA 4MK0A 1Y57A 1O9UA 2X0QA 3G2FA 4E7WA 2V7OA 3OROA 4OTDA 5HNBA 4PWNA 2IW8A 5KMIA 3I0QA 3VW8A 5CLPA 3OVVA 3QQHA 2YDJA 3R21A 4JRVA 2QOBA 2PVLA 5DNRA 5EI6A 4R7HA 5JGBA 2OZOA 1OKYA 4IWDA 4MXXA 2X8IA 4RMZA 3P9JA 5KKRC 3R0TA 4FNXA 2RFEA 3ORTA 3T4AG 3TI1A 1QPJA 4E73A 1ZZ2A 4QD6A 3KXNA 3FKOA 3A8WA 4IHPA 4CFXA 4WKQA 4QDEA 5ANOA 4OT5A 3E3PA 4G3EA 3DBFA 2YN8A 4FT7A 2XNMA 4JDKA 3NUXA 3VW6A 4A4OA 3U4WA 4O6EA 3U4UA 3I0OA 1DI8A 4AWIA 5K4JA 2VX3A 1IAJA 3TUBA 4L43A 3ZO1A 4AXCA 2IEWA 2W5HA 2XF0A 5IUIA 4D58A 2C5YA 4IW0A 4M3QA 2DS1A 1K2PA 3B52X 3DDFA 4KBCA 2G2HA 5D10A 3PY1A 4XV1A 4ZZMA 3W2CA 3IW8A 4DGGA 3MIYA 4CT1A 2V22A 3QZIA 1U5RA 5TOZA 1OBGA 3F2NA 1TKIA 2QO2A 5FXQA 4EH3A 4QMTA 5TR6A 3Q60A 3A7HA 4MYGA 4AGUA 4RX7A 3VWAA 2X4ZA 3RPRA 4C4FA 5LJJA 4JDIA 3AKKA 4M68A 5G1XA 5LMBA 4I1ZA 4CTBA 3PRFA 2ALWA 2VV9A 3KFAA 3GU5A 4L42A 3E8CA 4YZ9A 5AP3A 1H25A 4GUEA 2WTDA 4GEOA 4YLLA 4GW8A 5DN3A 3D4QA 4FV5A 2W1GA 4NH1A 4UBAA 5HBJA 1YOJA 4IAFA 4WUAA 2WGJA 5CU3A 1URUA 4O4FA 1FINA 3NW6A 1DS5A 4E81A 1KE6A 5M09A 4GYIA 3LFEA 5LVOA 2ITVA 2UVXA 4PRJA 1R39A 4AF3A 5GINE 3V8TA 3PSDA 2BHHA 5IMXA 1UA2A 3GU8A 2YFXA 2W5BA 4P2KA 4USDA 2FO0A 3PVUA 3KXMA 3DJ6A 1TQIA 5AR3A 4JX7A 4L00A 3IG7A 4I94A 4EK3A 3QUEA 3F69A 3FLSA 5J87A 2PTKA 2XJ1A 4O4BB 5H9BA 4O7TA 4AOJA 3CS9A 2IW6A 3ORIA 4JDJA 1OZ1A 2YLLA 4B9DA 3T47A 4O86A 2YM4A 2R3MA 2Z2WA 4DTKA 1GZKA 2ZOQA 1Y8GA 3LJ2A 4JQ7A 4ASZA 3HV3A 2R5TA 5CSHA 4RFYA 3RK7A 3LMHA 3EQBA 3L8SA 1WBVA 3MVLA 3W2QA 4AW1A 2NO3A 1SVEA 3GOPA 2UW6A 3E63A 4W4XA 3GEQA 1G5SA 2QI8A 1BX6A 4QTDA 3BVXA 5D41A 3VUTA 2PMNX 2UVYA 4D4SA 3W1FA 2VZ6A 2A1AB 1GOLA 3B2TA 3ET7A 3UMXA 2YIBA 3DA6A 3BLBA 1UU8A 2Y6MA 4PP7A 5AV3A 3FXZA 4CG8A 1YWMA 2PUUA 4O4DA 4M67A 4FTIA 3UIMA 3ZXZA 3LQ5A 4E3CA 5LMKA 2BAKA 4EZNA 5CI7A 4BTMA 2B1PA 4UMQA 1YQJA 2X8EA 3TNIA 2I1MA 4YPDA 2J51A 2QOKA 2XNPA 3O7LD 5HG9A 2Z0VA 3R04A 4YPSA 3GC9A 4FKGA 4FSWA 4L44A 5D11A 4QP6A 2O8YA 3FYJX 4C59A 4EUTA 4IACA 4IZ5A 2WMRA 3UC4A 4BTFA 4D2RA 5CF6A 5AR4A 3PFYA 5DMZA 5EI8A 2WOTA 3F3ZA 3KEXA 5K4IA 4YC8A 4K1BA 4GT3A 1ZMWA 3QF9A 5HX6A 3QQJA 1ZYCA 4IZYA 4E26A 3HP2A 4IEBA 2HELA 3H9OA 3O8UA 5CXHA 1GNLA 1X04A 5EM6A 4EH9A 3FMEA 1FVVA 4J52A 4C2VA 2W9ZB 3T49A 2PZ5A 3H0ZA 3ZXTA 5CT7A 3LPBA 4PTGA 2XKEA 1VLRA 3PJ8A 5LVLA 5I9XA 1R33A 1GIIA 3ZMMA 3BI6A 2OJFE 3NUUA 5GZ9A 3RKBA 3MTLA 5FEEA 4C3FA 3LKMA 4YBKA 5L8JA 5EW9A 1M7QA 4NM0A 4ZY5A 5HD4A 4EK5A 4AP7A 3C4CA 3SDJA 4CFNA 3SVVA 4E1ZA 3D5XA 2UZWE 2B9JA 5IEXA 4TTHB 5DH3A 4ZTMA 4YNOA 3ZM4A 3RPOA 3IPHA 3ZO3A 5ANIA 4ANNA 3ORLA 3CTHA 1DKZA 3KRXA 5FTQA 3W0NA 2ZB0A 4G6NA 1S9IA 4OGRA 5KMNA 2F1AA 1ZXEA 4RLKA 4ZJJA 1YVJA 3KRLA 4MD9E 4OUCA 3D94A 4DBNA 3U6HA 4S2ZA 5M4IA 1QPCA 3UNJA 2HENA 4O0RA 5AV1A 3EFJA 3B8QA 4PL3A 4BYIA 3FEGA 1H0VA 2CCHA 2JEDA 3KCFA 4HZSA 4YMJA 4C62A 4BNEA 4CZTA 3RTPA 4AG8A 3BYOA 3HMNA 4BBFA 3MFUA 5HVJA 4O27B 1MRVA 3MFRA 3BLAA 2HWOA 3UDBA 4DHJA 3HUBA 3VQHA 4FKPA 4QTEA 3RV1A 4B6LA 2Q13A 1H24A 4AZIA 5BYYA 2WELA 3OCSA 5IPJA 4FGBA 2OFUA 3ZFXA 2JNSA 1P2AA 5KHWA 1U4DA 3I7BA 4XLVA 1R1WA 3TNQB 2QR8A 3EQFA 5D9HA 1P4FA 3KY2A 2BR1A 2W7XA 3COKA 3PJCA 5ANDA 5LARA 4A7CA 4AZGA 4BCJA 2Z7SA 2BRBA 4XP2A 4R3RA 4UMRA 2RAJA 2RAKA 4WNPA 5JT2A 4Z7HA 3BLQA 3OHXM 2BILB 3VS2A 4E6DA 2BDJA 4DEBA 4IB1A 1W0XC 3PLSA 4FMQA 3RAWA 5ICPA 4JQEA 2YDKA 1I09A 5A6OA 2BRGA 4C35A 5L8LA 2F4JA 2GHGA 4AZCB 4CMOA 4V0GA 2C0OA 3I2WA 1PMEA 3R7GA 3EN9A 3HYHA 4FVPA 3VS5A 4NJ3A 2Y9QA 3BE9A 2X2LA 3LCSA 3T9IA 5KKRB 5F1ZA 2X2MA 3BUQA 5KZIA 2VTAA 3TIZA 5C8MA 4AX8A 3TN8A 5DI1A 3KXGA 4FV7A 4FTNA 3R1NA 4L68A 3EN5A 4FZ7A 1M52A 2VU3A 5JFVA 4DFNA 3MGYA 2PHKA 3ODZX 5BYLA 3CGFA 1H07A 3JVRA 4AW0A 5KMOA 2JDVA 3DNEA 3RALA 4FOBA 1SM2A 3N51A 3DXQA 2ZMDA 3AC2A 5EYMA 1XH7A 2OZAB 3SQQA 3HAVA 2VWBA 3DJ5A 4ZOGA 4PDSA 2WTKB 2O2UA 4BGGA 4O2PA 4BWXA 4I4FA 3DPKA 3ZDIA 4ZSGA 3VC4A 4EC9A 3DX2A 3MVJA 3NCZA 4LGDA 4NCTA 4PTCA 4ZSEA 4EZ5A 5C9CA 3PJ1A 1QPDA 4W4YA 3TUDA 5GZAA 4NYEA 4FBXA 5E4HA 3NNUA 4FSTA 4R5YA 4CNHA 3OZ6A 4EQMA 4ZSAA 3KRWA 4IWQA 3SYVA 3KC3A 4FSUA 4KIKA 1XJDA 3HL7A 4MVFA 5AUZA 3R83A 4NM5A 1PF8A 2OJ9A 4GG5A 3A4OX 4FL3A 3V6RA 1R0EA 4JBPA 5FQDC 4A07A 3P5KA 3NYXA 4YJOA 4I0RA 4QQTA 3CSVA 4FVQA 4H3BA 3L8XA 4OR5A 3W8QA 4O84A 1J7UA 4JG8A 4B8MA 5M55A 3FZTA 3P0MA 4XG6A 4HOKA 2X5CA 2IZRA 3ZSGA 2GDOA 4DTBA 4HPTE 3QLFA 2YL8A 5HE3A 3MB6A 1Y6BA 3NIEA 5AUWA 5CAOA 2WOUA 1R78A 3FKNA 4GT4A 1R3CA 2UZOA 3V51A 3ZO2A 2JNKA 2UZVA 4CLIA 4FX3A 3VEAA 4GMYA 3G0FA 4DEGA 2GNJA 1TQMA 2XCKA 2WQOA 3V8WA 2RG5A 4PV0A 3UVQA 4HR1B 3R9HA 4FA2A 4P7EA 5IISA 3EL8A 1I4TA 3JY0A 4WNOA 3T9TA 5CVFA 4D2PA 5HX8A 5CEOA 3VJOA 4E8AA 5K0XA 3KN6A 3IW4A 4OTIA 3U9CA 4EEVA 4H58A 4S33A 3NUAA 5FGKA 1IR3A 3KXHA 3T3VA 3R9DA 3EB0A 2X7OA 3PIZA 2OW6A 1U59A 2VTOA 2I0VA 1OB3A 5K0KA 2G9XA 3A4PA 4ZTRA 4ANMA 3KMMA 5AR2A 3SRVB 2C30A 4YC3A 2PY3A 3DU8A 3GOKA 3V8SA 4I5CA 4W8DA 4AZTA 3NUNA 4II5A 4M7IA 2YJSA 4GK4A 5TO8A 2O3PA 4P5QA 4MNFA 3DNDA 2WPAA 1Y91A 2R3NA 2RF9A 2XIYA 3UVPA 3F5XA 4CKRA 2B54A 4B9QA 3R63A 3MA6A 4D5KA 3BL7A 3LMFA 3RM6A 3QTQA 1E9VA 4YJNA 5EI2A 3KK9A 2H34A 3R9NA 2VTTA 3TT0A 2IW9A 5J1VA 1E1VA 1JKLA 4EH4A 5AAEA 1Q8TA 5BYZA 2HZ4A 4YP8A 4Y85A 5HTCA 2VUWA 4KIKB 3BKBA 3R22A 3LIJA 4RX8A 5AP0A 4UN0C 3DBEA 3SGCA 4U41A 4JQ8A 4N57A 3QX4A 1YRPA 5EHYA 3PE2A 2RIOA 4Z7GA 3DZQA 1OAOA 4OLIA 2Q12A 2F2UA 2GNGA 4BKJA 1ERKA 2BCJA 3HKOA 2G1TA 4EH8A 4FKQA 5TKDA 4KRDA 3VHEA 2UW0A 3O8PA 4IX3A 2YLFA 4G3FA 2ZYBA 4YTFA 4EZYA 5F94A 3U55A 4X0MA 2REIA 3UIUA 3ZO4A 4IC8A 2EFKA 4FZFB 5AP2A 3HRFA 4R5KA 3FI2A 3WARA 4BHNA 4FVRA 2J4ZA 3C0HA 2PVRA 3ANQA 1PYXA 2J0MB 2ZV8A 3O23A 3VBQA 1OPKA 4IDTA 5KMMA 5HE0A 3VRZA 2BTSA 2RGPA 3D9VA 2QOLA 3JY9A 5CSVA 3QYZA 3VUMA 4DAWA 3ZRMA 1YXSA 4F08A 3TJCA 4LYNA 5IA3A 4F7SA 4U45A 2ZM4A 1ZRZA 5AAFA 4DYLA 3I7CA 2JKKA 4YTCA 4CXAA 2YL9A 4X3FC 3BEAA 3D14A 3FMMA 3GC7A 4G5PA 4JT3A 5HG5A 5KZ0A 4CMTA 5KBQA 2EX3B 3S1HA 4ITIA 1ZYDA 2ZAZA 4K0YA 2YLAA 2QCSA 3ETAA 1UU7A 1U54B 3KRRA 2VO6A 4WG3A 3BVVA 2CKOA 1ATPE 3EZRA 1RDQE 4D0WA 3TIYA 4X7QA 4O83A 1URCA 1I4DA 3OCGA 4PMTA 4EHGA 2W5AA 1JQHA 3LM0A 2AYPA 5HTBA 4BVUA 3FQEA 4BGQA 3WZEA 4NUSA 4FL1A 4YZCA 5IG1A 2CNQA 4RC4A 3KB7A 5G6VA 5CYIA 3QRUA 3R2YA 3GU6A 3Q2JA 1PXOA 3L9NA 4FT5A 4IADA 1Q3DA 5AA9A 2JDOA 2WB8A 1STCE 3OW4A 2UW4A 4YJTA 4ZJVA 4F65A 5IEVA 1IAHA 1WBOA 2ITOA 4CFMA 4BYJA 2YKTA 2QO7A 1KE9A 5BVEA 4GFGA 4GUBA 3FC1X 3CIKA 1Q8WA 3QWJA 4FZAB 4NKSA 4E5BA 4GFOA 3A98A 5CASA 3F88A 3CTJA 4O96A 4U43A 1OMWA 4RGJA 3ULIA 5CALA 1AD5A 1PY5A 1UWHA 3Q9ZA 1JBPE 4IX5A 2H8HA 3VO3A 2XMYA 2QOQA 4FZPA 1XH4A 4DE4A 4GJ2A 4XH6A 5H2UA 3LFDA 3Q2MA 4MF1A 5EKNA 3I01A 3DDPA 1KV2A 5CAUA 2WKMA 1W9MA 5EH0A 5BVKA 4Q9ZA 4GH2A 2P2HA 4FV2A 2QOCA 2VTSA 4QRCA 4ZSJA 4E6QA 1QPEA 4FTJA 3FZ1A 4AT3A 5AV4A 1KOAA 3SXRA 1I49A 5HGIA 3QALE 4DITA 3WIKA 3ABHA 3CV5A 2WMUA 4QNAA 3QA8A 4BB4A 3VUGA 3UOJA 2YITA 4GL9A 4QNYA 3HRCA 2FVDA 3OXZA 3QTIA 3O17A 1I4LA 3LMGA 5C5BB 2R2PA 4KIQA 4B4LA 5EFQA 1AGWA 4MXOA 4PF4A 3SOAA 5AV2A 5IEYA 3OBGA 2XM8A 3THBA 1LP4A 5E8VA 2OO2A 3BL9A 3R7OA 4MQ1A 4XBUA 5IZFA 2XP2A 1W84A 4IVDA 3SAYA 4CZYB 3ZTXA 5A9UA 4RIOA 4UXQA 4D9TA 3MB7A 4G6QA 4HNFA 4NT4A 4JR7A 2IVTA 3BVUA 5CEKA 3PLTA 5E8XA 1YHSA 4MXCA 4AZWA 4AVMA 2IF8A 3WF8A 3CJGA 3R8UA 5HTIA 2F7RA 4J97A 3IS5A 4KKHA 5HNGA 4H1JA 2UW3A 4GRBA 3VJNA 2RT6A 4FT3A 4E6AA 5IDPA 3CZSA 3BU6A 2XK7A 3PIXA 4IQ6A 4YTHA 5AIKA 4YHJA 2D1LA 2R3GA 2BFXA 2WIPA 5BUJA 1PJKA 4WBBB 4J53A 3VBYA 4JWCA 4EOOA 2QLUA 3BHYA 3MIAA 3NCGA 3BHTA 2ITYA 3EQRA 5EK7A 3T8OA 3QAME 4XG7A 1KWPA 5CQWA 3PVGA 4QP1A 2PVNA 4GSBA 4O7WA 1YOMA 4IB3A 4RX9A 2YCQA 3IONA 2PK9A 3OEFX 4UB7A 3CBLA 2ITWA 3LCOA 1H27A 3DS6A 3K5VA 1F3MC 3CD8A 2VTLA 4PTEA 3PUFC 5E84A 1URWA 4FIIA 4WNMA 5AADA 5BMSA 4GVAA 5CU0A 1NVRA 1XBAA 5L2SA 4B99A 4DF3A 5D12A 3F82A 3RV0A 4FTUA 4FSNA 1XH5A 4DGOA 4X3FB 4ACMA 3MESA 4CV9A 1NY3A 3BWJA 3W18A 1W2FA 5JFSA 1UNGA 2ITNA 2C3IB 3G6HA 4RPVA 4TWPA 4ACGA 4BICA 2GS2A 3K3JA 1OKZA 3KA0A 4DG0E 3IW7A 3NPCA 3PA4A 4JDHA 5L2WA 3UP7A 5FUTA 3BHHA 4FIEA 4IMYA 3RWPA 2F7QA 2XK6A 4ACHA 3D7TB 3OTUA 4E5WA 3OC1A 4TN6A 4BCIA 3AT2A 4A4LA 1BMKA 3L8VA 3KULA 3LAUA 4YSMA 4F9CA 2GCDA 5A54A 4FZOA 5HOAA 4LQMA 2VN9A 2XIXA 4D4VA 4BCKA 2GF4A 1KV1A 1QMZA 3UG2A 4I6QA 2OO8X 4TT7A 3ODYX 4QP7A 4TZRA 2OW3A 4TWNA 2VWVA 4E4MA 5IDNA 3QA0A 2UZDA 4JBQA 1G3NA 2FYSA 3SXSA 2HK5A 2CKQA 1PW2A 2BIKB 3FMJA 3E3BX 3WZDA 3AGLA 4C37A 1CKIA 4AA0A 4YTIA 3QKMA 3SKCA 2YWVA 1WZYA 3Q52A 3ZZWA 4E6CA 2XVDA 3I60A 2GQSA 2I0EA 4G5JA 3ZLSA 4RJ3A 5M07A 1JSVA 3S2PA 4C4JA 2PU8A 2WHBA 3NFGB 4IAKA 1Q8UA 4N4SA 4G16A 4YZNA 3UJGA 2PZIA 4JXFA 4FKTA 2R3KA 2LM0A 3BUPA 3BELA 5H8EA 5AM7A 1YWVA 3BWFA 2DQ7X 4O4CA 4Y8DA 5CY3A 4XV2A 5E7RA 3RVGA 4LDTA 2CPKE 2PVYA 3E64A 1M7NA 3QQKA 2OJGA 4RZWA 1WAKA 4NEUA 4XS2A 1PKDA 4RJ5A 3QRTA 4PL5A 4QMNA 3O3NB 4ENYA 1IA9A 5KMLA 2XYNA 4QMQA 3DYTA 4CG9A 1OKVA 4FTTA 5L6PA 5IUGA 1F5QA 4X21A 4DA5A 4AS0A 4FNZA 4I5PA 5B2MA 2Z0NA 4MBLA 4O0WA 5EOBA 3P5JC 1PRYA 4H39A 3MSSA 3GU7A 4EK6A 2QURA 5I9VA 2O63A 2VNYA 4FG7A 3TUCA 1E1DA 3BPRA 2C3KA 4O81A 4HYUA 2BDWA 1U54A 4D1ZA 3KCKA 1H0WA 3DDGA 5IQAA 3VAPA 5GIOE 1CKJA 1GZ8A 1PMUA 3ZFMA 1YKRA 4FV6A 2C5XA 3A62A 4QT1A 3O3MB 3RI1A 4F0GA 1H1PA 1YI4A 2VO3A 1E9HA 3DGKA 3Q5IA 3QD4A 3OWLA 3TTIA 4U97A 3DAEA 3JPVA 5GHVA 4AFEA 2AUHA 4O7LA 4MBIA 1NA7A 2B4SB 4FTQA 4AXEA 2OF4A 4JG7A 5HVYA 3LVTA 3QBNA 3UODA 3UE4A 4PQNA 2ZDUA 5M06A 2Y4PA 5B7VA 3NLBA 2AC5A 4U80A 4HYBA 4FEVA 3GFEA 4IVAA 4UWCA 3BLHA 5AEPA 4ALWA 4I21A 3HMPA 5FBNC 3HV4A 4LOQA 3TV7A 4KABA 4RLLA 2PMOX 3F7ZA 4FTKA 4ONAA 1FPUA 2UZBA 3P4KA 5GIPE 2R3PA 1RQQA 1ZAOA 4AW5A 4BDGA 4FKJA 3UQFA 3UOKA 2WQNA 4I6FA 5EG3A 4CFUA 2HZNA 3QTXA 3D5UA 3DFCB 4QYHA 5EHLA 3VS3A 1FMKA 2CCIA 3UO4A 4QTBA 1Y8YA 4HZRA 3Q4TA 3COMA 4QQ5A 4ALVA 2W99B 2X0OA 3NAYA 4XHKB 4FEWA 2JBPA 2PZPA 5HI2A 4RVLA 4IX4A 5T3QA 2OIBA 3F3WA 2UW8A 3KK8A 1MUOA 5CEIA 2F7PA 4G17A 4DBXA 3CY2A 3LJ0A 3WYYA 2OU7A 1OECA 2WTWA 2WMBA 4I93A 4YNEA 4EOKA 5AP1A 2X2KA 5C8KA 5BVOA 2EXEA 2HY0A 5CENA 4CKIA 4GVJA 3I6WA 4XNEA 3EJSA 3R2BA 4F6UA 4MH7A 4BCOA 1CM8A 3FQHA 5EW8A 4C4IA 2NRUA 4EKLA 2EWFA 1WVXA 5FXSA 4JNWA 5A3XA 3FZPA 4ANOA 4C8BA 3KMUA 3CVRA 3VONA 1YXTA 4AN2A 4HR1A 5LWNA 1J7IA 2EB2A 2HXQA 4BWKA 4LOPA 3E88A 1KE5A 4IM3A 4WPEA 4OTGA 2NCZA 4RWIA 4EHZA 2OJIA 3CQUA 5LOHA 4CGAA 2YM7A 2A4LA 4GG7A 4YO6A 1KE7A 5DT4A 5HCXA 4BDDA 5KX8A 5FP6A 2UW7A 3PYYA 4R5IA 2B53A 3ZSIA 2J0IA 3MBLA 4UXLA 3RJCA 1WBNA 3F66A 3W0MA 1WDZA 3QKKA 3MYGA 4DH5A 2OLCA 4JWEA 3ZS5A 5CSWA 3DQXA 3NNXA 4A9YA 2QHMA 4UY9A 4YGAA 5A4CA 2V62A 4F63A 5BVNA 4O38A 5L2QA 3EZVA 2C5OA 4N6ZA 2QLQA 1G8SA 1KUTA 2XKDA 4E4NA 5ETFA 4KUJA 3FQSA 1E2UA 4J98A 4DFXE 1XQZA 3R73A 4AE6A 4BDIA 3TWJA 1MP8A 5DGZA 3NNVA 4U6RA 3NRMA 1LEZA 1QCFA 3G15A 1JWHA 3HV6A 3PA3A 3QLGA 4G3DA 2AC3A 5CU6A 5HZNA 5JZJA 5I5ZA 3R01A 2BUJA 4NIFA 5CT0A 1JNKA 2OKRA 4L46A 2VGPA 3K5UA 3VBXA 3MS9A 3KN5A 4O1OA 3GNIB 4AW2A 5BQ0A 2JBOA 3TL8A 4XJ0A 4J8MA 4UDXX 1ZYSA 3MFTA 4FKOA 1Z5MA 2BKZA 2CJMA 4XV3A 3KVXA 3UC3A 4I24A 2C08A 2XNNA 3BGPA 5EM5A 1PHKA 1Q97A 3E87A 2GQRA 3BLRA 5FRIA 4QPMA 4O2ZA 2C6DA 3CQWA 4XEYA 4F70A 4USEA 3AMAA 3FV8A 4WA9A 4YZMA 3Q4ZA 5B0XA 4JAJA 3HMIA 3QFVA 3LOKA 2UZLA 4TWCA 4PL4A 3MA3A 5HBEA 1NVSA 5C26A 5FEQA 5AUUA 1JAMA 1Q3WA 2YA9A 3SD0A 4R5SA 4D8JA 5JKGA 3U6IA 3FC2A 4QYGA 3OY1A 4EOPA 3IGGA 4ERKA 3NUYA 2KULA 5E92A 4NKAA 3ACOA 2A2AA 2ONLC 3FDNA 3NFFB 2XKFA 5IQGA 2WMXA 3LQ8A 2R3HA 2GFSA 5DRDA 4BDHA 4IAYA 2C1BA 2EWAA 3PWYA 4EH7A 3LCKA 4QMSA 4C0TA 3TDWA 4FV0A 5A4LA 3D2EA 3COHA 3HZTA 1FVRA 3NUSA 1U00A 5IU2A 2YIWA 3C7QA 3JS2A 4F1MA 3OCBA 3KGAA 5IMEA 1GJOA 4JIKA 2YCFA 3OD6X 3MWUA 4TNBA 4XG8A 2Z0OA 2X9FA 2Z60A 2W96B 3QQUA 2XUUA 5DEWA 5E1EA 4C36A 2CGVA 2OH0E 3VVHA 3PVBA 4O0UA 4M84A 4U40A 4FYOA 5CNOA 2ZM1A 5BVDA 2IPXA 4NWMA 1LEWA 4IZ7A 2GNFA 4M14A 5J95A 3R8ZA 3VULA 2EB3A 3UPXA 4D4RA 2ZDTA 4J99A 2X3VA 2XZSA 1U5QA 2F7XE 4FTRA 5DIAA 4F78A 2PMIA 5AV0A 1ZY5A 4AZHA 1A48A 2VWIA 4N70A 3MTFA 4FV9A 1OUKA 2WEVA 4A9SA 3C50A 1TQWA 3F6XA 4FIJA 4FJVA 5E8TA 3QRKA 4AGCA 4R8QA 3OWKA 2A0CX 3UYTA 4R3PA 4ZSLA 3GCUA 2J0LA 5CEMA 3NUPA 4RBLA 1ND4A 4TL0A 5ETAA 5IH4A 4ZTNA 1K9AA 4K8AA 4O0YA 2OXYA 4A9RA 4DLJA 4G9CA 3QCQA 4EOLA 2JFLA 5IF1A 4DG3E 3MH2A 2E2BA 4L45A 2QD9A 4WOVA 3TZMA 4RWJA 2J7TA 1JPAA 1YDSE 3R8VA 4D28A 1O7DC 2O0I1 3PZEA 3C13A 2JFMA 3NS9A 4TRLA 2VWZA 1IRKA 3NW7A 2W1IA 5HG7A 4CKJA 3B51X 5IQFA 2HW7A 1BYGA 4AACA 3DPQA 1OUYA 2GS6A 1CKPA 4U8ZA 3MY5A 4S34A 3R6XA 2ZJWA 3UTOA 4EI4A 2VWYA 3LLTA 4X2FA 4YC6A 4M8TA 5J9LA 4IB0A 2PE1A 3BBWA 4FZSA 4U79A 2J0JA 3CE3A 3ENHA 4U42A 3ZZEA 4R5JA 3R00A 1ZOEA 5CEQA 3BYUA 3Q0KA 2YEXA 2PULA 1HOWA 1OL1A 2G2IA 3RK5A 4BC6A 5JGDA 5A4QA 5HU9A 4FSQA 4DFUA 3FLWA 2BAJA 4FV3A 2OXXA 3P7CA 3FXXA 3F2RA 2BRMA 1UNLA 3K3IA 4XMOA 3NYOA 2WMAA 2XYUA 1SMHA 2HY81 3DLSA 3LFQA 5CX9A 3V5WA 4F7JA 5HLWA 3TDVA 3QCYA