3F7WA

Crystal structure of putative fructosamine-3-kinase (yp_290396.1) from thermobifida fusca yx-er1 at 1.85 a resolution
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
288
structure length
288
Chain Sequence
GVNSVAARVTELTGREVAAVAERGHSHRWHLYRVELADGTPLFVKALPDDAPALDGLFRAEALGLDWLGRSFGSPVPQVAGWDDRTLAMEWVDERPPTPEAAERFGHQLAAMHLAGAESFGATWDGYIGPLPMDNTPRSTWPEFYAEQRILPYLRRAADRGALTPGDVRLVEKVLDALDHLAGDPEPPARIHGDLWNGNVLWQDDGAVVIDPAAHGGHREADLAMLALFGLPYLDRVRDAYNEVAPLAEGWRARIPLHQLHPLLVHVCLFGAAYRTTLVDTARAALRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative fructosamine-3-kinase (YP_290396.1) from THERMOBIFIDA FUSCA YX-ER1 at 1.85 A resolution
rcsb
source organism Thermobifida fusca yx
molecule tags Transferase
molecule keywords putative fructosamine-3-kinase
total genus 94
structure length 288
sequence length 288
ec nomenclature
pdb deposition date 2008-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03881 Fructosamin_kin Fructosamine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3f7wA02
1.20.1270.240 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3f7wA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3f7wA01
2JITA 1YHVA 4ZAUA 2QCSA 2OZAB 2KTYA 3TNPC 5CF4A 3RKBA 4YP8A 4LI5A 2NPQA 4QMOA 4K6ZA 5IH5A 5B7VA 1Y57A 2XJ2A 3NUXA 4QP1A 1YHWA 4A4LA 4MNEA 2XB7A 4JQEA 4TT7A 3QC9A 3G0FA 2BHEA 2YDJA 3IPHA 3QCYA 2PVHA 3SLSA 3RWQA 1V0OA 4M15A 5IMEA 3CY2A 4YHTA 4JBVA 4WT6A 5HCXA 3F69A 5LJJA 3ZSHA 4QMWA 2VTJA 2CLXA 2JDVA 3TKUA 5FP5A 4EK3A 5HO8A 5LQFA 4FV5A 3HUBA 3A8XA 1OVEA 3MI9A 2RL5A 3NLBA 4LRMA 2WMUA 4WG3A 3T3UA 3UOLA 3VUMA 3G0EA 3EFWA 3Q32A 4JIKA 4OTDA 4FSNA 5ANKA 3D14A 3ZZWA 3T8OA 1YI3A 4AE9A 3FZ1A 3R7VA 1JKTA 1GNGA 1O6LA 2PHKA 3QGYA 5HZNA 4YJOA 4DEGA 2Y4IB 4IM3A 3P9JA 5C8MA 3KU2A 4A9UA 2VTHA 3FV8A 4HJOA 4LL0A 4FIEA 4EH6A 3RAIA 4DH8A 5HNGA 4J7BA 4MBLA 2J5FA 1CKIA 5GINE 4DINA 3P7AA 3ZEPA 5HVKA 4QTDA 4FKUA 4DFUA 3WARA 4NM0A 2I0EA 4WNKA 2JFLA 3BEGA 4I21A 1OKWA 4RFZA 4DG0E 4E6DA 4HCVA 3G15A 2B55A 3CTHA 4DEIA 4HOKA 5CX9A 4U5JA 5IA4A 2CGVA 5DYJA 5IQBA 3TIYA 1H0VA 3FHRA 1FMKA 4BZOA 3I6WA 4D4YA 2QR7A 3FMEA 2VTPA 2XK9A 4IAFA 4I5HA 3FXWA 3R28A 3TZ8A 1Q8ZA 3A8WA 3UTOA 4DEHA 5HLWA 2QURA 4IFGA 2ZM4A 5EDRA 3KXXA 5HGIA 1SYKA 3R8LA 5BYYA 2Y6MA 5FTQA 4FMQA 3NVKI 4WHZA 3OROA 2WAJA 3I6UA 1UWHA 4UBAA 4KBKA 1MQ4A 3FQHA 2UUEA 4J8NA 5C27A 3VUHA 3M42A 4M7IA 3ZC5A 1OMWA 5D11A 5HTCA 4IFCA 2W1IA 2OIBA 1YRPA 5F95A 4ASDA 3TJCA 3LMIA 3SVVA 3R02A 1IA8A 3R8MA 3F3TA 4QMPA 3OT8A 5ETCA 5J7HA 5FP6A 4HVGA 4PQNA 3I5NA 4AACA 2GNGA 2YIYA 5IMXA 4EOKA 4P2KA 4DYMA 3A7FA 4CV8A 3NUSA 3O51A 3ZONA 2HAKA 4FEQA 4IM0A 4I6QA 2GU8A 3PSBA 5FQDC 2G01A 4OLIA 1H24A 3I5ZA 2X81A 3QKKA 5K0XA 4FZAB 2OBJA 3P7CA 2QQ7A 3WBLA 1LPUA 2EVAA 4LRJA 4WOVA 2X7FA 1JLUE 3NWWA 4CCUA 4D4SA 3QCSA 4I22A 4ALVA 3F5PA 3EQDA 5AFVA 4UXQA 2XJ1A 4M69B 4D5HA 2PYWA 4C3PA 1U59A 4E3CA 2QOQA 4ERWA 4L3LA 4J97A 3BHYA 5E9EA 1H01A 2YISA 3PFQA 4MNEB 3W2QA 4DEAA 4C0TA 4F64A 3H9FA 4WSQA 3PVWA 1OKVA 3MFRA 3EN5A 2P0CA 3UC3A 5EYDA 2WMBA 3IOKA 2UZEA 4JBOA 3FMHA 4CNHA 4DFLA 4KD1A 2QOHA 4C2VA 4DLJA 1IAHA 2BTRA 4J98A 3MV5A 2VWZA 4CMUA 1KWPA 4F0FA 4IZAA 4ENYA 4XP2A 3KXMA 3LM5A 1YDSE 4NTTA 4F7NA 4YTFA 4AAAA 1HCKA 2BRHA 3PA3A 5JH6A 3GU8A 2E2BA 3V51A 5AM6A 3ALNA 3MY0A 2WXVA 2C5YA 2XBJA 3F2AA 2C5XA 4C61A 3DKOA 4OTPA 3I81A 5IKWA 4E6QA 3MYGA 4ZY5A 4HGEA 4JQ8A 5C03A 4X2NA 3Q4CA 3MDYA 4O91A 5F1ZA 1FVVA 4W4VA 4AF3A 1W82A 1IA9A 5EHLA 2I1MA 5TT7A 2YCQA 5FTGA 3HV4A 4LG4A 2YM8A 3R8UA 1FGIA 2BDWA 3EN7A 4EHVA 5A4QA 5DMZA 3H4JA 4BYJA 4ZZOA 4B99A 4LGHA 4W9WA 4FKSA 4IQ6A 3I7BA 4F7JA 2WMTA 4CRLA 1UU8A 2REIA 3OS3A 1SM2A 4KSPA 4L01A 2FVDA 3ZM4A 2I0VA 4DH7A 2WGJA 3R9OA 2ZVAA 1OUKA 4RPVA 5JSMA 3VBWA 4E1ZA 2VWXA 2OK1A 3V01A 1ZARA 4BDBA 5A4EA 4PY1A 3TTJA 4E7WA 4LGDA 1P4FA 1YWVA 4G16A 4K77A 5DT4A 4AOJA 2WMXA 5AUXA 5J1WA 3RPRA 3Q6UA 2OWBA 3DK7A 3QWJA 4MHAA 3GUBA 4CKJA 5DNRA 3SW4A 2CGWA 4MF1A 2P4IA 4XLIA 2YLFA 4I3ZA 2ITZA 3KULA 3UYSA 5KKRB 4BI2A 2AYPA 5JK3A 4ANMA 4C02A 3BZ3A 1UA2A 4FKQA 4P4CA 5AV0A 5HNBA 5C4KA 5AP6A 4MD9E 4NM3A 3ZEWA 4QMMA 2C6LA 3PJ8A 5DRDA 3PXZA 4QTEA 3QHWA 4Y46A 3AD6A 4EH4A 5CZIA 3SXSA 4RZWA 3TL8A 4CFWA 3PJ2A 4KB8A 3GU4A 4LM5A 2F7EE 3DXNA 4XRLA 3ZMMA 3UOHA 3ZRMA 2UVZA 2XYNA 3EQBA 3FKLA 4EZ7A 2VNYA 1Y8GA 4EH8A 5HNIX 4QMTA 3OXZA 5FRIA 3L9NA 5H2UA 3E88A 4MX9A 5IA3A 1E1XA 4OBOA 4DE4A 3K54A 5HKMA 3UG2A 2QO7A 3DQXA 4RJ5A 4D4RA 4U3YA 3VVHA 1DAYA 1SVGA 2OFVA 3P1AA 1PYXA 3FZOA 4N6ZA 1UNGA 5CSHA 4ALWA 3QD2B 1VR2A 4Z55A 1QPJA 2X8DA 3BRBA 4DLIA 4PTEA 4XS2A 4CKIA 5CXHA 3UGCA 4W8EA 1YVJA 5K4IA 4P5ZA 3BX5A 4ACCA 3I79A 5AP7A 3OCSA 3TJDA 4O22A 2HW6A 3QTUA 1KE8A 4FBXA 3SRVB 2VTQA 4AW2A 2PZYA 4JBPA 5IQGA 4K2RA 3V5JA 5JQ5A 1PF8A 1V0PA 3OC1A 1Q8UA 2GS6A 3PY1A 4TWNA 4FTQA 3N4VA 5AP2A 3HA6A 4X3FB 3ZSGA 4D9UA 2X7GA 2HELA 4QMVA 4B8LA 1UU3A 2CKOA 4OAVB 1R1WA 4NFNA 5GJDA 3GOPA 4M67A 4N57A 1Q97A 2EXCX 4HZRA 5E90A 3U9CA 4BDCA 4DFZE 3DZQA 2BUJA 2XIZA 3ZLYA 4R78A 4E6AA 3AC3A 4C4IA 2ZB1A 2VTMA 4F9AA 3WF9A 5HG7A 3ORTA 2Y4IC 4FUXA 3BCEA 4IM2A 5I9YA 3PSDA 3ROCA 5M4UA 5CEQA 3KMMA 5EKNA 4O84A 3VUKA 3JVSA 2YEXA 5HICA 1S9JA 4L52A 2QOFA 3NPCA 1YDRE 3SG8A 2W7XA 5CSPA 4QPSA 3U51A 2O64A 3IOPA 3S3IA 4W9XA 4O7LA 4IB5A 1JPAA 4PUZA 1WFCA 3CEKA 1ZOEA 3VIDA 3SC1A 3G33A 4J99A 5DEYA 5I3OA 4EBVA 4IDTA 2WTDA 2YAKA 3FE3A 3RI1A 3E93A 1RDQE 4LUDA 3OWPA 3UP7A 3UZRA 4RIXB 4FSZA 4QMXA 4YJVA 5ANEA 2IZRA 3AD5A 2IJMA 3A7HA 4YZBA 5HOAA 3RNYA 4BTMA 4USEA 3TDVA 4J71A 3AGMA 3KA0A 2ONLC 4K18A 4ZY6A 3ENMA 4CXAA 1M7QA 1F5QA 3T3VA 3C4CA 1Z57A 3FPMA 1RQQA 4I5MA 4FE2A 3A7GA 3Q3BA 5CI7A 5IH6A 2GQRA 3BI6A 4JX7A 4M3QA 1T46A 3TNWA 4KIKA 2W1CA 2X2LA 4MXYA 4XG3A 2WQNA 4IWQA 3NAYA 3H9RA 4R7HA 2BTSA 5DI1A 1BMKA 3RK5A 4HYSA 4XCUA 3AMYA 4FVPA 1JSUA 1PXKA 4PRJA 2UZTA 2A27A 2B52A 2YM3A 1LEWA 3EN9A 4HYHA 3ULZA 3HUCA 3BYVA 4FKWA 5A4TA 3MTFA 4DCEA 5DR9A 4YJNA 5CALA 1YWNA 4MXAA 4WUAA 3V6SA 2XKFA 1OB3A 1O6KA 1H1RA 2PZ5A 4FV0A 5E8ZA 3VAPA 4FTKA 1E1VA 4AN9A 4EHEA 4B7TA 1YKRA 1EH4A 4FSRA 4EOQA 2YIRA 4C4HA 5FEQA 3QA0A 2PWLA 4RJ8A 3PVUA 4JQ7A 4YZCA 2JAMA 2OF4A 2R3LA 2VRXA 3JY9A 4I23A 4F7SA 3U87A 2WMSA 4RQKA 3BHVA 2W1FA 2FSMX 2W4JA 4BCPA 3P0MA 4TYGA 2VTRA 2YITA 3FZSA 4DTBA 4AA5A 1QPDA 3QTQA 3F66A 2XA4A 3LJ2A 5DWRA 3OEFX 4XYFA 2PE0A 3FMKA 5EW9A 2XEZA 4DEBA 5K5NA 3HGKA 1Q3WA 4AQCA 1REKA 1FPUA 3IDBA 4BCNA 5CSVA 3PE1A 4AGCA 4QYYA 1OBGA 4B4LA 2OZOA 5CASA 1YOJA 4ARKA 4J8MA 1OIUA 4K11A 2J0IA 5TKDA 3C4WA 3JS2A 5AJQA 4BCQA 4TYIA 5ETAA 3U55A 1JBPE 2V5QA 2X0GA 2GPHA 2QKRA 3C0HA 2Z7LA 4HW7A 4DFYA 4MK0A 2BAKA 4FNWA 4G5PA 5CS6A 5LVLA 3EB0A 1TVOA 3MTLA 2CKPA 3POZA 3CIKA 2PE2A 1ZAOA 2QVSE 3H9OA 2OH0E 4JL9A 3WZEA 4QQ5A 5BUEA 4M97A 3N9XA 4RBLA 5CT0A 3ATTA 4BB4A 2RG6A 4RIOA 4YNEA 4MXXA 4PL4A 4NEUA 3DBCA 4Y72A 3C5IA 3PA4A 2W1EA 2A4LA 2J51A 2XK3A 3ZTXA 3OCBA 5L2IA 5DA3A 2PUNA 4GCJA 4CMOA 4QP2A 2QHNA 4YZNA 4FEWA 2OZAA 3FLQA 2ZB0A 1H8FA 1DAWA 3TI1A 3OOGA 2KULA 4FKOA 2CMWA 4GG7A 1OIRA 4QQTA 3G6GA 4BBFA 4HVHA 2XKCA 1TQPA 4XP3A 3CPBA 5J9LA 2VTOA 2QG7A 3C7QA 4Z7GA 2YM4A 4RIWA 3LJ0A 2R5TA 5M07A 2BVAA 2FSTX 3VRZA 2W5BA 2CN5A 3U6JA 3ZDIA 3ORXA 2OSCA 3O23A 3N4UA 4HCUA 1YHSA 3GQIA 2Y7JA 4NSTA 3R9RA 3H3CA 1UKIA 4NU1A 5FM2A 5M4IA 2G2FA 1M2RA 1Q24A 2R3RA 3RHXA 4KIOA 5ACBC 3F7ZA 2HWPA 1YDTE 1WBOA 4F63A 4O21A 3UNKA 2WD1A 3LQ3A 4D28A 1ZY5A 2G2HA 2G15A 4Z16A 2VWYA 4IAIA 3OW4A 3HRFA 4NKAA 4V01A 2PMOX 2XP2A 2R3NA 1ZYCA 3GENA 5EHOA 3S2PA 3VUGA 1AD5A 5IF1A 1WZYA 2YHVA 4UX9A 1TQIA 3CPCA 4BF2A 4FEVA 4L43A 3R7IA 4TNDA 4YLLA 4HVSA 1IG1A 2FUMA 5FDXA 2H34A 4FSWA 4IVCA 3LFAA 2UZOA 4C3FA 4O0UA 5KMJA 4E5WA 3ODZX 3ZLSA 4JG8A 3GNIB 4FOBA 4IJ9A 5G6VA 5L8LA 5JGAA 3BGPA 3OUKA 3DKFA 3R1YA 4ZTSA 4BZDA 1Y6AA 4FTLA 4KRDA 4QNYA 2X7OA 2J4ZA 3C4EA 4CFMA 5HBJA 1ZZ2A 3ORKA 1B39A 5M06A 1TKIA 4BIEA 5J1VA 3R2BA 4BRXA 3E8DA 3PPJA 2YA9A 5FWKK 2WQOA 5HTIA 1L3RE 2VTLA 4FI1A 4W4WA 4XV2A 2OJGA 4PP9A 1NT2A 2YCSA 3GC9A 4ACDA 3W8LA 2WKMA 5EI6A 4RJ4A 4AUAA 5KX8A 2YACA 4FTUA 3KREA 1G8AA 2ZDUA 2OXDA 4ZTNA 1A9UA 5E8TA 4O83A 5ICPA 5JFSA 5D9HA 4FV8A 2V62A 3PPKA 1XO2B 4PPAA 5K5XA 5CVFA 3QD0A 2BALA 3IW7A 3LPBA 4X6RA 3ROYA 4RX5A 3GCVA 4YJRA 3LFNA 4M68A 4ANNA 4O82A 3AD4A 3R83A 3OWJA 3OXIA 3LFQA 2EUFB 3QTIA 3DY7A 3PLSA 3BLQA 1XH5A 1MP8A 2QC6A 2ONLA 4I94A 2C6KA 3KXZA 4ALUA 4K0YA 3KQ7A 3B8QA 3DB6A 3F88A 2W05A 1MRVA 4L00A 3SOCA 3G9NA 3GEQA 2JBOA 5BUJA 3D94A 2F57A 3BWFA 3VBYA 3QU0A 3W18A 4WA9A 1SNUA 3EQHA 3QQFA 5CEPA 3A7JA 1P2AA 2UW6A 3NRMA 3UC4A 2QLQA 2C6MA 4BGHA 1PXPA 4IB3A 4K1BA 4FYOA 5F4NA 4BDGA 4IZ5A 5IA0A 4QO9A 4YZ9A 4JG6A 3W32A 4AZTA 5AAEA 5CZHA 3QBNA 5M09A 3IQ7A 3C4ZA 3IONA 1MRUA 4FNXA 5BVEA 3UVRA 3VQHA 2O3PA 4QTCA 3ID6C 3DBQA 3QCXA 3FMMA 4FKLA 3CJFA 1S9IA 2OFUA 4JDIA 3UYTA 3FLNC 3TG1A 2YDKA 4CFNA 4H3BA 4LL5A 4PMSA 3WF5A 4FSQA 3WIGA 2C4GA 2I0YA 5CNNA 3QQGA 5BVDA 5L4QA 3DGKA 3QLGA 1H08A 1Y6BA 2BZHB 3G6HA 3KMUA 1GZOA 2UW8A 4MNFA 3VN9A 3LFSA 4C34A 3GC8A 3CE3A 4YPDA 5CAVA 3OY3A 4OTHA 1JKKA 5LARA 3PY3A 4A9SA 4O6LA 2X9EA 4RJ6A 3ZRLA 1PJKA 2OLCA 3FC1X 4BDEA 4O7YA 1PXIA 3OW3A 3WILA 3FMDA 4RVTA 5J8IA 5M08A 4CSVA 1PY5A 5JN2A 4S32A 3WIKA 5AAFA 1RE8A 3COHA 4O86A 2J9MA 5AV3A 4AT5A 4G3DA 5E7RA 4F08A 4QOXA 4BWPA 5CF5A 3PVBA 1KSWA 4ACGA 4DTAA 2WQEA 4XEYA 4XJ0A 1RJBA 2BMCA 3IG7A 2CGXA 4DFXE 4S31A 3FI3A 4H39A 3D7ZA 4BVUA 2C3IB 4DHFA 4G9CA 1JSVA 5LMKA 3FI2A 4AZEA 3NR9A 2R3PA 1Z5MA 4IX3A 3P5KA 5CT7A 4BCIA 3UQCA 2XCHA 1J7IA 3WOWA 1XR1A 2ESMA 2GTNA 3LW0A 3V8SA 2Z7QA 1UV5A 3E3BX 4YC6A 2XH5A 3LQ8A 5AP3A 3ZO2A 3TXOA 3LCOA 3EKNA 4DA5A 2DS1A 3PG3A 4GKHA 3RPVA 3MSSA 4X6QC 4IX6A 4L3JA 2EXEA 2IVVA 4XV3A 4UMPA 4K33A 5BVNA 5M53A 4YC3A 3ZRKA 2PVJA 2VD5A 4BBEA 4RFMA 4KBCA 2QG5A 3P08A 3Q9YA 5EI2A 2AUHA 2CCIA 1SZMA 2C6OA 4G17A 3R1NA 3PJ3A 4FA2A 2O0UA 2R3GA 2CLQA 3DK6A 3HAVA 3PZHA 2WOTA 1CMKE 4KSQA 2WPAA 1H28A 3VQUA 2WIPA 5GNKA 2DUVA 5LCKA 4YTCA 1WBVA 2GHLA 2UVYA 3VBQA 4BHNA 5GIPE 4WO5A 2YABA 1QPEA 1R3CA 3HMMA 5DR2A 4U44A 3HA8A 3G90X 3NNWA 4YGAA 4PL3A 4ZS0A 3BQRA 3HMNA 3E8CA 5KE0A 4TYJA 1ERKA 2EWAA 2ITQA 3DFCB 3D83A 3Q52A 4GJ3A 5J79A 1R0PA 5I0BA 2OU7A 2PK9A 3KF4A 1GJOA 1YXTA 4EL9A 1OIQA 3EKKA 3DJ6A 3QTWA 4CLIA 4CV9A 1K9AA 3EQIA 3LCSA 1IAJA 2VGOA 2ITPA 3UO4A 4FV4A 4GW8A 1XH8A 3PWYA 5AUWA 1H1QA 3EH9A 4EOPA 3DXQA 1APME 4A4OA 4DC2A 3R1SA 2UZDA 4K9YA 4F7LA 4GL9A 4DF3A 2BRBA 5IDNA 5B2LA 4TYHA 4F9BA 3QKMA 4IC7A 3RPSA 4KUJA 3II5A 2UW5A 3HMOA 4RX9A 3ZOSA 4E26A 4X2GA 3NSZA 3TZ9A 4RWLA 3KCKA 5E8UA 4C4JA 3I1AA 2RFDA 3EYGA 3NYNA 4EORA 3G2FA 3LXNA 3EJ1A 1CTPE 5LMAA 4NIFB 4AW5A 4BHZA 4ZSEA 4ERKA 5L2TA 4FT9A 2JIUA 2R7BA 2ETMA 2JLDA 2X4FA 3EFLA 4OR5A 4BFMA 3V3VA 4FKJA 5CWZA 1IR3A 1TQMA 4II5A 5D41A 4U40A 4C8BA 4DGLC 2Q0BA 5BVFA 1SVEA 5BQ0A 3FWQA 3JVRA 2YFXA 4AX8A 2W4OA 2Y0AA 4WBBB 4OW8A 2R64A 5DOSA 2BKKA 3FYJX 3MS9A 4RT7A 1ND4A 3F2RA 3OTVA 2H8HA 2QOLA 2UW4A 3NYOA 5DGZA 4DH1A 2HZ4A 2O8YA 4NIFA 3ZDUA 3AT2A 5B2MA 4L3PA 4EOIA 1OPKA 1H07A 3K3JA 4RA4A 4DG3E 4FV1A 2ITWA 3FLSA 2F7ZE 2OO8X 5DVRA 5JT2A 4GT4A 5CAUA 2CPKE 5BVWA 4FGBA 5BYZA 4BL1A 3IK3A 5E8XA 2QU6A 4M13A 4XG8A 4A4XA 4APCA 3LMHA 3QTRA 3QTXA 4IBMA 3NX8A 3ZH8A 3H0YA 3QL8A 3S0OA 3OFMA 4KBAA 4O7VA 3TT0A 2CHLA 1OKZA 3MVJA 5AIKA 3NZ0A 3V5LA 4C38A 3E64A 4ZJJA 4MWHA 3ZUUA 2CNQA 3KRXA 5CVGA 2OXYA 4H36A 1F3MC 4OGRA 2YM5A 3FZTA 5EQYA 4UZDA 3SG9A 4JAJA 2HENA 3PXQA 3SD0A 1YXUA 3GCQA 3LLTA 3R01A 3T9IA 3VS5A 5IQDA 1PW2A 5HD7A 5EM6A 2W06A 3KKVA 1NW1A 5CNOA 4YSMA 4JT3A 5CF8A 1H27A 3F3UA 3FZRA 2JGZA 4FV2A 4R1YA 3RALA 5A46A 4Q2AA 5EG3A 2QNJA 3V5PA 3RK7A 4GFOA 3KCFA 3ANRA 4BBMA 4OTIA 5ANJA 5A3XA 3CQUA 1Q99A 4XV1A 3Q9WA 4BCFA 4C36A 2WOUA 3TEIA 5IEVA 4M69A 2QD9A 3HZTA 4FTRA 2PU8A 3CD3A 3O8PA 4D1XA 1A48A 2WMRA 5HO7A 3UO5A 4CTCA 5D1JA 3UOJA 3S00A 5AR3A 3K5UA 5HG9A 4N0SA 5C1QB 3BBTB 2OJ9A 3QXOA 4FT3A 2UVXA 3V8TA 3L8PA 1OL7A 4ZTLA 4EH2A 2VTTA 2CKQA 3A61A 4QP6A 1UKHA 1KV2A 4B6LA 4WNMA 3I7CA 4EK4A 1H1PA 3D7TA 5JEBA 3DBDA 2XIXA 3QLFA 5FBNC 4QPMA 3BPRA 3QZIA 3CQWA 4GS6A 5IA2A 5C4LA 4G3CA 3FUPA 4RVLA 4LOPA 4DGGA 3FLYA 4UMUA 1L8TA 2X6DA 4U9AA 1PXLA 2B9FA 4LV8A 3OHTA 3WZDA 3HNGA 2XS0A 3ANQA 3IW5A 4P7EA 4LQMA 5FEDA 2JEDA 3QUEA 4N6YA 3ZXTA 4RZVA 4FL1A 4RJ3A 3KK8A 3RAKA 5IZFA 5L2WA 2GNJA 3HDMA 4CFVA 3HECA 1LEZA 3ULIA 4GT5A 4GK4A 4EEVA 4G6LA 2IG7A 1JWHA 2BKZA 3LFDA 3R8PA 4JIAA 1M7NA 5AWMA 2ITTA 3BLHA 3PDTA 1YOMA 5AR7A 4CT2A 3TKHA 4DEDA 4EQCA 5K4JA 2WO6A 4IAYA 3ZFMA 3MY1A 4KIQA 5EM5A 4O1PA 4FL2A 3COMA 3PIYA 5HVJA 4E4NA 4EK5A 2XCKA 2CGUA 5DR6A 3CXWA 1OL1A 5JZNA 2F2CB 2Z60A 3MJ1A 4FG8A 3DJ7A 4HPUE 5HE1A 4EWHA 5M4FA 3WZKA 4IHPA 1U4DA 3RM6A 5HG8A 2C5VA 3NNVA 4E5AX 5IG1A 4DG2E 1ZRZA 1VJYA 3DOGA 2F49A 2VTIA 4JVGA 2OJFE 5AV1A 4X2KA 4YURA 3TM0A 3FI4A 3MB7A 2RFSA 4EJ7A 2OJJA 3QZFA 3VUIA 3OF0A 2BAQA 3JY0A 3P78A 3Q6WA 4V0GA 4QTAA 3CJGA 3EZRA 2OG8A 3ZCLA 2DWBA 1PHKA 2V55A 2IN6A 3ZUVA 3HRCA 4A9YA 3NYVA 4OTQA 2JKQA 4UYNA 3UZPA 5B0XA 2VV9A 3VJOA 5ANGA 4PL5A 4EOOA 2Q0NA 1U54A 4IDVA 3GGFA 4AZSA 4QT1A 3VNTA 2OW3A 4IADA 2ZMDA 4NTSA 4C7TA 4ZSJA 4F65A 1FGKA 2BIKB 2X9FA 4OBQA 5H3QA 2C0OA 2WTCA 4X3FC 3VS6A 1PXOA 1REJA 3CBLA 5KMIA 1WMKA 2QKWB 4YHFA 4IMYA 4L45A 4DGOA 3D5UA 3IO7A 4UMTA 5CSXA 2GNFA 2FA2A 4RA5A 2YZLA 5IQAA 3VWAA 4TL0A 3R00A 5A9UA 3UPXA 4ZSAA 5J5SA 5L8KA 4DITA 3L9LA 5E91A 1Y91A 3IW8A 1KOBA 4RC3A 3BEAA 4IB0A 4FKGA 4L44A 4BICA 2B4SB 3KL8A 3PTGA 4XG9A 3TZMA 1XKKA 4EOLA 3E7OA 4KWPA 4EH3A 2YJSA 5EW8A 4E4MA 2YM6A 1J3HA 5IUHA 3DT1A 4BC6A 3C4FA 5JFXA 2BAJA 4JBQA 4XG7A 4TRLA 4R6VA 2C1AA 4BIDA 4CTBA 1OBDA 1KE7A 1VYWA 2AC3A 4IW0A 3CC6A 4IE9A 5L2SA 4DBNA 4U97A 4HVDA 3R7UA 2BPMA 3DTCA 2FB8A 3AQVA 2B54A 3R1QA 4FUYA 3R2YA 1M14A 1ZYJA 3E8NA 4ZEGA 5HX6A 2A1AB 2W96B 2XRUA 4AE6A 3OBGA 3E63A 4R1VA 1IRKA 3QRUA 3Q9ZA 5ACKA 5KNJA 1FBNA 2WQMA 3ACJA 1UU9A 3VS7A 3F5XA 4ASZA 4TWCA 4EONA 1ZWSA 4IAKA 3V5WA 3TKIA 4YBJA 3QALE 3I0OA 4JLCA 2X1NA 4I93A 3LKMA 1U5RA 2IVUA 1BKXA 4GK2A 4GUEA 4EK8A 3HVCA 4GYIA 4U6RA 4AZWA 1M52A 4N4SA 5IQFA 5T6KA 1Q62A 4WNOA 4BN1A 4E73A 2C6DA 3WE4A 3ZS5A 3CQEA 4JDJA 3VHKA 2XNPA 3R7OA 1PKDA 1GIJA 4FKTA 5HE0A 5BUIA 3SW7A 3LFFA 2BRNA 4D9TA 1IASA 2JDSA 4C2WA 4NYEA 2Y4PA 5KMOA 3BHUA 3W8QA 2ITOA 4QMQA 5D7AA 4Q9SA 3ODYX 2GFCA 4UB7A 3FMLA 4BYIA 5I5ZA 3O71A 3PLAE 2J5EA 2A2AA 3TWJA 3FPQA 3HMPA 1CSNA 3AT4A 3R0TA 3FKOA 1YW2A 3LOKA 1OI9A 3GU6A 4KABA 4V0GB 5FD2A 5AEPA 5ITAA 3UOKA 4FZ7A 1DI9A 5A4LA 3JPVA 3VS1A 2GQGA 2GS2A 3Q4ZA 4W8DA 4FEXA 3IS5A 5CI6A 3DQWA 2IW8A 1FINA 1OL5A 4BCKA 3DCVA 3PIZA 5D12A 3LVPA 2WTVA 4CT1A 3R71A 5KMLA 4RVKA 4R3CA 3HX4A 4BDHA 1RW8A 4FIGA 5F20A 3MFTA 5E8WA 4JS8A 3F61A 4TTHB 1M2PA 3MVMA 2E9NA 3CKXA 3DU8A 4NUSA 4CZTA 4Y83A 4CD0A 2QHMA 2R3HA 2CN8A 2V0DA 2WEVA 2QOOA 2HIWA 5CU0A 2QOCA 2WTWA 5EHYA 2P33A 4I6HA 2PMLX 4QMYA 4YJSA 5EOLA 5JRSA 4CLJA 3HV5A 2ZV9A 3DBEA 2O5KA 2LAVA 4QYGA 4AS0A 1OIYA 2BR1A 3OUNB 5HCZA 4HZSA 3FY0A 5L8JA 4XMOA 2XNMA 1O6YA 3RK9A 4QTBA 4USDA 3UODA 4NWMA 2PZRA 4RSSA 3NUNA 1X8BA 3DB8A 4AGWA 3V8WA 4AFEA 5M57A 3MJ2A 4RC4A 4D1SA 4LFIA 3A4OX 4EJNA 5HI2A 5LWMA 1DM2A 3EQCA 4UZHA 5DFPA 4APPA 4MTAA 3A2CA 4F6UA 4ANOA 1OKYA 3EN6A 1PKGA 1XBBA 5FXQA 4OT6A 3F9NA 2PVRA 5DBXA 2X2KA 4I5CA 2E9VA 2VO6A 1PMEA 2WMAA 3SKCA 2IWIA 1GZKA 2Y8OA 4XNEA 4EOSA 5E4HA 5IEXA 3COKA 3Q04A 3QRJA 2UZUE 3UBDA 4EZ3A 3L9PA 4UMQA 1STCE 3NUUA 1FVRA 5J95A 3MPMA 4TWOA 4U42A 3EFJA 3UPZA 5JRQA 5CU6A 5AUTA 2NP8A 2ZV8A 4ASEA 3MY5A 5J7BA 3ORNA 1XBAA 3F3VA 2W99B 3ERKA 2R3MA 4YBKA 4L68A 1QCFA 3HP2A 4B8MA 4R3RA 3PJCA 3OP5A 4BKYA 3HKOA 4ORKA 4PP7A 3VC4A 5HU9A 4F1MA 4G3EA 3IW6A 4GK3A 4DH3A 3A60A 5BVKA 4EC9A 5FLFA 5EYKA 4BDDA 5M4CA 1BL6A 2PVKA 3OEZA 4EOJA 3BELA 3ET7A 4Q5HA 4O0SA 5BMSA 4JX3A 1DS5A 5GZAA 1OGUA 3SQQA 3ZC6A 3DAEA 1LUFA 3W2SA 4I20A 4FEUA 3WZUA 4EYMA 1J7LA 5AA9A 3EYHA 5CENA 1B6CB 2BRGA 5AR5A 4QMNA 5CEOA 4WBOA 4EKKA 2YIQA 2E9OA 5KO1A 2ZV7A 2GFSA 4GH2A 2SRCA 4BI1A 5CF6A 3DJ5A 2DYLA 4E20A 4ZMFA 2UZBA 1WBNA 1PXMA 3RZFA 3ORMA 3WE8A 3QQJA 2G1TA 1H00A 2J2IB 2NRUA 3RTPA 3EQRA 4AZVA 5AUUA 4H58A 5AV2A 3VBXA 1ZOGA 3BU5A 4XG4A 2G9XA 2HCKA 2XUUA 4KS7A 3DBFA 3PYYA 4O27B 4YZDA 3ZU7A 5KCVA 3RMFA 2ITUA 5GIOE 3CTJA 3F3WA 3GI3A 5CAPA 4PNKA 3KRJA 4TYHB 2WFYA 4QYHA 4ANBA 1CDKA 3SGCA 5L2QA 3UVPA 4AZFA 3TIZA 4ACMA 3HMIA 2C3JA 1Q61A 3KXHA 5TE0A 4AG8A 2CSNA 2HXLA 4FSTA 3VS4A 1FMOE 2XM8A 2OIDA 2YJRA 4FIIA 3LCDA 4G6NA 5EDQA 3QC4A 3ZYAA 3B2WA 4GIHA 3JR1A 2G2IA 4UWBA 4L6QA 4UV0A 3N4TA 4JNWA 2ACXA 5CTPA 2XK7A 5A14A 3QCQA 3NMUF 2C68A 3OVVA 1R0EA 4DN5A 4ZZNA 4DAWA 4LV5A 4ACHA 3D0EA 2PVNA 3NIEA 3ORIA 3DXPA 1K3AA 1BLXA 3R7GA 5KZIA 4O0XA 1SMHA 3K5VA 3C1XA 4C33A 2QONA 2R3IA 2XNNA 3Q2MA 3RCJA 3W2RA 3W55A 3FQEA 4PDSA 3RP9A 4AU8A 4GJ2A 3KVXA 5CQWA 5EI8A 4JI9A 4G3GA 4FZFB 1W8CA 3MB6A 4PF4A 4U41A 5CXZA 1NVSA 3LQ5A 5LVNA 5E92A 4UWYA 3TTIA 4AFJA 5BVOA 1XH9A 2C5OA 4NT4A 4AP7A 4KNBA 4ZJIA 3SHEA 3MWUA 3QFVA 4U43A 4XG6A 5HX8A 3GB2A 3Q96A 3O96A 1ZOHA 3F5GA 4FG9A 3TV6A 5HIBA 1ZMVA 3DKCA 4I4FA 1PMUA 4GRBA 1BX6A 3DNDA 3LFEA 3RJCA 3ZFYA 5EQEA 3IKAA 3PWDA 2QOKA 4DEEA 3TV7A 4G3FA 5CAOA 4F0IA 3CR0A 1UNLA 2QU5A 4UEUA 5H8GA 3DLSA 1OL6A 3ALOA 4O7TA 5CEMA 4OTRA 4ZLZA 4OT5A 4RG0A 3VBVA 3LFBA 5ETIA 1H0WA 5AV4A 1BI8A 3LLAA 3LFCA 2VWBA 3HAMA 1KE6A 1LP4A 2PUPA 4EH5A 2ETKA 2BFXA 4CEGA 3GU7A 4BR3A 4EZ5A 4C58A 4ITHA 1UNHA 3CCNA 5M55A 1PMNA 4HPTE 5IH4A 3NUAA 2OJIA 3PRIA 4EUTA 2UZNA 3EIDA 3IGGA 4FL3A 4P5QA 4AA0A 2XIRA 4DH5A 4I6BA 4D4VA 4J95A 4QQCA 3UZTA 1W0XC 3R9DA 3OOMA 5IUIA 4YHJA 4X2JA 2C69A 4D2PA 4BDAA 3MH3A 4Y95A 1Y8YA 2IZUA 1CM8A 2J90A 2C5NA 4IB1A 3MVHA 4H1MA 2IW6A 3RAWA 5EYCA 3A4PA 2BDFA 4FNZA 4YNOA 1BYGA 4YLJA 3NCGA 2XF0A 5HHWA 4BCGA 2E9UA 5DG5A 3LXKA 3SDJA 4O7RA 3KK9A 2OXXA 3KRWA 3HV7A 3E62A 3MPTA 4YLKA 2W1HA 2X8EA 2XIYA 5GJGA 1H1WA 3BHTA 4E8AA 3OXTA 3F3ZA 4A9TA 4RMZA 1UVRA 3MESA 4PV0A 4P90A 2B7AA 5AR2A 4I1ZA 3ELJA 3I0QA 1Q4LA 4KS8A 3P23A 5K3YA 4R8QA 4CVAA 1AQ1A 3ACKA 2R2PA 5AR8A 3VRYA 3FY2A 2HOGA 1Q8TA 4TZRA 3DAKA 1GZ8A 3DZOA 3NW7A 4PPCA 1JSTA 1WBPA 3CD8A 2WIHA 2XIKA 3OBJA 4NK9A 3U6IA 3MFSA 1H25A 4XOZA 3VW6A 4R77A 2C30A 4EH9A 4F9YA 3LM0A 1F0QA 2ZOQA 5AM7A 3OY1A 2RGPA 4FZ6A 3TV4A 4AW0A 3VF9A 4BTFA 1NVRA 4XOYA 3CGOA 3OT3A 1NA7A 2ZM1A 3EL8A 1BUHA 4FKPA 4HVIA 2ZMCA 2PZIA 4BCJA 4DT8A 4NJDA 4QQJA 3FMJA 4EBWA 2PTKA 4CGAA 2ZV2A 2RSVA 4FV9A 4M12A 3AC1A 2I0HA 2X8IA 1ZXEA 4E6CA 1OUYA 1YXXA 3ZM9A 3D2KA 1U5QA 2JBPA 3HL7A 3A99A 4YO6A 5AX3A 3DK3A 4R7IA 1UU7A 5AUZA 3GCSA 3VJNA 3UMXA 5EW3A 4AT3A 3NNXA 3F6XA 3PRFA 4BGQA 3E7VA 1Z9XA 4D2VA 3FC2A 3RGFA 3EMGA 2PVFA 3H30A 4GV1A 4ZOGA 5AP4A 3DPKA 4FG7A 5F94A 5JKGA 3S1HA 3KRLA 1KE5A 3ITZA 4R7BA 2F2UA 2Z8CA 4QP3A 3T9TA 5IISA 2Z02A 3R30A 5AAGA 2IPXA 3IDPA 5I3RA 3UJGA 3DKGA 3BLRA 4H05A 3MGYA 3NIZA 2VNWA 4FT5A 4LGGA 4RVMA 3ZO4A 5C26A 4USFA 2XJ0A 4WG4A 3GBZA 3PVGA 5HBHA 3TNIA 5HU3A 4JAIA 4TY1A 3TCPA 3W33A 3U4UA 4KKEA 2RF9A 3NVMB 3ENHA 5AR4A 4FTMA 2BHHA 3LHJA 4ZLOA 3EWHA 3UNZA 3AC2A 3W16A 3CLYA 3GU5A 1WVYA 3UG1A 4M66A 1SNXA 5ANDA 3FXZA 5F9EA 5EM7A 3UIMA 3EQPA 3UDBA 2IVTA 1B38A 1P14A 2ERKA 1OPLA 2UZWE 3PP1A 3QQKA 3TNHA 1KE9A 4LMNA 5JGBA 3ATSA 2YERA 5CVHA 2JIIA 4HNFA 5L6OA 3D15A 2VTSA 1W83A 3ZFXA 3OZ6A 4JDHA 2XNEA 4KAOA 3BE9A 5EQPA 4FSYA 2WTJA 4AWIA 4YJUA 2JD5A 4G9RA 3W2PA 4MCVA 4FSUA 4MXCA 3OCGA 3AC4A 3EOCA 3FYKX 3RVGA 4RLKA 4U7ZA 3UIXA 2VN9A 4M84A 3O7LB 3SAYA 3W10A 4EI4A 3TDWA 4QRCA 5J87A 1FOTA 4PDPA 2R3FA 4TW9A 2XYUA 3BV3A 4PTCA 3QWKA 5CEIA 4D0XA 1P4OA 4NFMA 4FF8A 4S34A 3BHHA 3O50A 4NJ3A 4TNBA 2QODA 3GVUA 4XH6A 4MKCA 2ITYA 4DT9A 4WSYA 2C0IA 5AIRA 4QMUA 4JDKA 4OBPA 2BDJA 4KRCA 3FAAA 4FZDB 4L7FA 4XV9A 2CNUA 4H3PA 4I41A 4Y85A 3BKBA 2VWUA 3R63A 2YAAA 5AUVA 4KA3A 1ZYDA 4O0TA 2X4ZA 3S4QA 2ZJWA 3GQLA 4E93A 4Z9LA 4DCAA 5E8SA 3IDCA 1WBSA 5CY3A 5EFQA 3U4WA 3HRBA 4FV6A 3BQCA 1DI8A 3BE2A 4TPTA 3SX9A 4BDJA 2VX0A 2HZIA 1T45A 5FM3A 4J96A 5LMKC 5HTBA 1IEPA 1O9UA 2RFEA 3UIUA 1OL2A 2ZDTA 3MA3A 5FGKA 3WYXA 3PUPA 5FBOA 4J52A 5AP0A 4BI0A 2FSLX 4PMPA 3UO6A 4MEDA 5HE3A 2H6DA 4ZXTA 3C5UA 2FSOX 3QHRA 3QUDA 3ZLXA 5L3AA 4FTNA 3Q60A 4RC2A 2JKMA 4I5PA 5JFWA 2YCRA 3RHKA 4EHGA 4F6SA 2BROA 1OPJA 2P55A 2W1DA 3MVLA 5HBEA 4GIIA 3FMNA 5DN3A 1XH6A 4Y5QA 4RIXA 4YU2A 4I24A 4GU9A 5DEWA 1V0BA 3D5WA 4ITJA 3HV3A 5LCJA 2XNBA 4IIRA 3C0GA 4ITIA 1XH7A 4NW5A 1KUTA 1VZOA 3SOAA 4QPAA 2J0JA 3DAJA 5E1SA 5D7VA 4C62A 3HYHA 3QKLA 3MIAA 5CYIA 2QI8A 3COIA 4JJRA 4G2FA 5JQ8A 5AMNA 2UW0A 3AGLA 1PXJA 5HESA 2W4KA 3LZBA 4IWDA 5H8EA 4A07A 2FYSA 4D1ZA 4UN0C 5A6NA 5JMSA 2FH9A 1E9HA 4RJ7A 4D2RA 3F82A 3KN6A 1YXSA 2WHBA 2YDIA 4IZYA 4XHKB 4X0MA 3FXXA 5E8VA 3OWLA 2CKEA 3CP9A 1PXNA 2C6EA 3D5VA 3L9MA 2WTIA 3FSFA 4IC8A 2GDOA 4MBJA 5BX0A 2YWPA 3ZO1A 3CTQA 4AW1A 4IAAA 3DDQA 4JRNA 4YC8A 3FEGA 4X7QA 5CLPA 4D58A 4PMTA 4QP7A 4AGUA 1V1KA 2CDZA 2ITNA 3OTUA 2VZ6A 4GU6A 1GOLA 2GNIA 1OITA 4C57A 4WNPA 4C37A 2EB2A 3GXLA 3EQGA 4CQGA 3BYOA 3M11A 3CSVA 4C59A 5BMMA 4KINA 3W2CA 2H96A 5H9BA 4C4EA 4DGNA 3KEXA 3QTZA 5CEKA 2F7XE 1OZ1A 4L53A 2PMIA 3O8UA 4IX4A 2EU9A 2OF2A 5JFVA 1YI6A 3AXWA 3DLZA 3Q2JA 2W1GA 3HDNA 4JR3A 3V5QA 1YXVA 2IZTA 4F1OA 5HORA 4KKGA 3PPZA 2UV2A 4B9DA 4YUQA 3PZEA 3VUDA 3W2OA 4GFMA 3QX2A 2HY0A 2XK8A 5LVPA 4DFBA 5LVOA 4LUEA 3AC5A 4YPSA 3OG7A 4ZY4A 3K3IA 2JIVA 3QGWA 4F9CA 3R9NA 4FV7A 4HGLA 3NGAA 2NNWB 2ETRA 2R9SA 1KV1A 2YCFA 4BWXA 4WUNA 4O81A 4O38A 2VX1A 3QRIA 2WQBA 4EWQA 3O17A 3PXRA 5M44A 4BTKA 1G8SA 5GJFA 3EFKA 2CCHA 4NZWB 2UZVA 4Z3VA 4YZMA 4ZP5A 3RZBA 4M8TA 3UIBA 4GG5A 4BY9E 4IWOA 4IAZA 4NCTC 4NKSA 2XK6A 2ITXA 3ORPA 3G5DA 3LCTA 3PXKA 4U3ZA 4L46A 5HO6A 1SVHA 5I9XA 2VO0A 4CG8A 3RPOA 4Y73A 4MD7E 4Y5HA 2XEYA 3FDNA 4TXCA 4CMTA 2WMWA 3BWJA 4CG9A 4BIBA 3PSCA 1MRYA 2QOIA 4U81A 2YIXA 3AC8A 4DFNA 3NS9A 4H1JA 3VHEA 4MAOA 2J7TA 1KOAA 3KXNA 2PVYA 5IQHA 2XKEA 5HEZA 3VW8A 5GZ8A 2B9IA 1JKSA 4L9IA 1Q41A 1H1SA 3TNQB 4OTFA 2J0KA 3UQGA 2PUIA 3MFUA 3B8RA 3FL4A 3QX4A 4CYJA 1GAGA 5E1EA 5DHJA 3O7LD 4FX3A 3N51A 1WBWA 3KF7A 4KIKB 3P7BA 3F5UA 3EL7A 3LE6A 2WEIA 4IJPA 3EN4A 4BCHA 2FGIA 4FTIA 3R9HA 5CU2A 5G1XA 4DGMA 4G5JA 5DE2A 1FQ1B 3WYYA 4O7WA 4ZK5A 4EKLA 5A54A 2OI4X 4FTAA 3SV0A 4EYJA 3MH1A 2VGPA 2PY3A 4RWIA 2YN8A 2UW9A 1FVTA 4AXAA 2J6MA 2Z7RA 2VWWA 4S30A 2E9PA 2C6TA 3L8XA 4GUBA 4QP4A 4U79A 3F7WA 3OWKA 2J0MB 4ZIMA 4A06A 3RWPA 3HEGA 4ZTRA 4L42A 4IXPA 4IANA 5T3QA 4C35A 4ZSGA 2P2HA 3NW5A 1YOLA 4NM7A 2F9GA 3R8VA 2C1BA 4NCTA 3BYUA 2PPQA 1A06A 2XBAA 2B9JA 1ZYLA 4AN2A 3L1SA 3P86A 4O0WA 4O0YA 5IUGA 3NUYA 3R22A 3VUTA 5HIDA 2J50A 2B53A 3NEWA 2PULA 4RX7A 5GHVA 5KMMA 3NNUA 2P3GX 4C4FA 3TACA 3KXGA 4X2FA 3ZUTA 2VO3A 2O63A 4AN3A 2BIYA 3IECA 5CQUA 2OKRA 2B9HA 4EOMA 5KUPA 4CRSA 4L7SA 1YI4A 2JKOA 5K9IA 3V6RA 2F4JA 3FLZA 4FT0A 5TO8A 3QZGA 1P5EA 4EQUA 4XBUA 3Q5IA 2JDRA 1CKPA 3OMVA 2FO0A 1Q5KA 3QQLA 1NY3A 3SXRA 4MH7A 3MBLA 3BU6A 3E8EA 2GNHA 3DV3A 4O96A 3ZXZA 5KHXA 2PZPA 3CGFA 3ORLA 5AUYA 2WU7A 4FODA 2GHGA 2WTKB 2ZYBA 3KMWA 4FYNA 5J9ZA 3FI8A 3R6XA 3PG1A 3FQSA 2QR8A 3GC0A 4PTGA 3WF6A 4PDOA 5IEYA 4O0VA 2BFYA 2R0IA 5H8BA 5HG5A 4FR4A 3QD3A 4QD6A 3AMBA 5FEEA 4O7ZA 4I0RA 1XQZA 2JC6A 3VS0A 2QOBA 4C4GA 5TR6A 5M56A 4WRSA 3DFAA 4JRVA 2RIOA 2OGVA 3VS3A 4BCMA 1MQBA 4I0SA 5TF9A 2JKKA 4XP0A 3POOA 1JQHA 2QO9A 3U8WA 3WZJA 3QQUA 1XBCA 4PNIA 3W1FA 3D9VA 1PRYA 1ZMUA 3B2TA 3RAHA 3CS9A 3UVQA 3PIXA 4GFGA 3RM7A 3PXFA 1I09A 1QMZA 3E5AA 2WU6A 5IPJA 2A19B 2O2UA 2OIQA 4NL0A 5IA1A 2R3JA 3UMWA 2GNLA 2YZAA 4LOOA 3ZHPC 5AA8A 3I60A 2ERZE 2AC5A 4HGTA 5I4NA 4RIWB 4IACA 3UQFA 2JFMA 3HV6A 5C8NA 3LAUA 3U9NA 2PUUA 4BDKA 4AOIA 3BGZA 4F1TA 3EZVA 4BZNA 4QYEA 5AADA 3QD4A 3Q9XA 4U8ZA 5HLNA 5CSWA 4TWPA 3UP2A 3ZSIA 4D2TA 4YJPA 3QYWA 3VS2A 3M2WA 4O6EA 4HGSA 3JUHA 3KFAA 4Q5EA 4TKSA 1I44A 1UWJA 2C3KA 4WRGA 4CFXA 1OECA 4G34A 4B0GA 4OUCA 3NDMA 2PVLA 3F2NA 2HWOA 4TYEA 2CNVA 2P2IA 3KB7A 5T68A 5LWNA 3TN8A 3BGQA 2XK4A 3L8VA 3MN3A 4I92A 4MXZA 3ETAA 4S2ZA 4BDFA 4U80A 4F9WA 4O7SA 4F0GA 1JVPP 2Y9QA 4FIJA 4GEOA 1WVWA 3BIZA 5I9WA 2QO2A 1QL6A 2ITVA 2WTKC 2XKDA 1GIHA 2UW3A 2B1PA 3O0GA 3R7YA 1NVQA 4AA4A 3WI6A 4ASXA 4OAUC 1PMVA 4YO4A 3MH0A 4NH1A 3AOXA 5CU3A 5AP5A 3IGOA 4XBRA 3LJ1A 2XVDA 4F6WA 1VEBA 3G9LX 3I4BA 5L6WL 5JGDA 3E3PA 4JOAA 4JR7A 2VUWA 5EM8A 4RLLA 4RX8A 3MA6A 3GCPA 4W4XA 4RFYA 4O7NA 4LMUA 1ZMWA 5JZJA 5HVYA 2QLUA 2GMXA 4D2WA 3QRKA 4M14A 4I4EA 5LVMA 5EKOA 4G31A 5DT0A 4IX5A 5M51A 2BZJA 3D5XA 4R5YA 2BZKB 1H4LA 5GZ9A 4CCBA 4U0IA 4EHZA 4YJTA 1XHAA 4I6FA 3O2MA 3H0ZA 3C50A 3D4QA 2W1ZA 4D55A 2J0LA 2V7AA 4EC8A 4FVRA 1G5SA 2EXMA 5FUTA 4FIFA 4Y8DA 3OD6X 3C9WA 5EDPA 1URWA 5IQEA 3NAXA 2R4BA 5FXSA 1J1CA 3CY3A 3FLWA 3FSKA 3NYXA 2VO7A 3ORZA 4EH7A 3NUPA 2RFNA 1HOWA 4U45A 1GIIA 2HXQA 4ANSA 4A7CA 3D2IA 5EOBA 1JKLA 5LMBA 1U54B 1YQJA 3FKNA 3GC7A 4O1OA 4BTJA 5A4CA 5DIAA 2JDOA 3BV2A 4FTTA 2GCDA 4M0YA 2EB3A 1BI7A 4JXFA 3WF7A 4CQEA 4YMJA 4ZJVA 3GFWA 3ZZEA 3KGAA 3QZHA 2C47A 2VAGA 5FTOA 3H10A 3VF8A 2IW9A 4A9RA 2V7OA 2ZM3A 3E87A 4AGDA 5KHWA 2W5HA 4O2ZA 2Z2WA 4FSMA 3A62A 4J1RA 4F09A 4FKIA 5IU2A 2X39A 4IZ7A 4E4LA 4MQ2A 4D5KA 4K8AA 3TUCA 1ATPE 4QP8A 3VO3A 4E5BA 3WF8A 4BDIA 4ZMEA 2GS7A 4Q9ZA 2PSQA 4AT4A 4GSBA 1W98A 2R0UA 4EUUA 4QMLA 4CKRA 2OICA 2VTAA 1BL7A 5BYLA 3DDPA 4F99A 2A0CX 3L8SA 2NRYA 3K2LA 3M1SA 3QYZA 4MVFA 2Q83A 1HCLA 4UXLA 3R7EA 1XH4A 3P79A 4ENXA 4GMYA 4RGJA 2IZSA 4FOCA 1R39A 2O65A 3C13A 4X3FA 3DS6A 4MXOA 4S33A 5IA5A 3R8ZA 2W9FB 2VU3A 4BKJA 4OTGA 4BWKA 2R3KA 2VTNA 4PWNA 4MBIA 2OH4A 4FTOA 3U6HA 3Q4UA 2GHMA 3ZLWA 3MW1A 4MQ1A 4O0RA 4RIYB 3CKWA 2GQSA 4IH8A 4GYGA 2HW7A 3FZPA 3AT3A 2BCJA 3SRVA 2WZJA 2I6LA 5EYMA 4ZTQA 3V04A 3ZO3A 1G3NA 4XLVA 3RCDA 4BCOA 4YR8A 1ZY4A 2BILB 2HZNA 3MIYA 2YIWA 5B2KA 2XZSA 4UMRA 1M2QA 1ZZLA 5HD4A 5K0KA 3EHAA 2WMQA 4F4PA 4TN6A 4RWJA 4L67A 5ANIA 5TOZA 3SXFA 2YM7A 4V04A 1CKJA 3KRRA 4XRJA 1WVXA 5DRBA 4PMMA 1R78A 3DA6A 4HYIA 4FTJA 3AMAA 1NXKA 4IVDA 4R3PA 3C51A 4NW6A 4YTIA 3NCZA 3GOKA 4GVAA 4IEBA 4D0WA 1WAKA 3KC3A 4PX6A 1XWSA 4XUFA 5LOHA 3LXLA 3A7IA 5BNJA 2RKUA 2IO6A 4R5SA 2XM9A 3RINA 3Q4TA 4BKZA 5FXRA 4MD8E 2I7QA 5E8YA 4W4YA 3LMGA 2Z7SA 2YLEA 1VYZA 4KKHA 4N70A 5FG8A 3VULA 5I9VA 2C0TA 5DH3A 3BU3A 4ZZMA 4QMSA 1GY3A 2WB8A 1JNKA 3JXWA 2W9ZB 5D10A 1MUOA 5AX9A 2CJMA 3PP0A 2X6EA 3QRTA 2XNOA 2B0QA 4GVJA 2XNGA 4EQMA 3KULB 5HLPA 4UALA 4OTWA 2HZ0A 5ANOA 5C8KA 1K2PA 5L6PA 2JDTA 4WG5A 2XRWA 4WKQA 4MF0A 3QAME 3QTSA 3GP0A 3D7TB 3BYSA 2R7IA 3FL5A 4FNYA 4YTHA 4ZSLA 5KBRA 2HYYA 4MWIA 2NO3A 4ZLYA 1URCA 5HIEA 1YWRA 4CYIA 2GSFA 4F70A 2BZIB 4PPBA 3QF9A 2XMYA 1XJDA 3QA8A 4IWPA 5HE2A 5J5TA 5IQCA 3Q5ZA 3GFEA 3R04A 1AGWA 2PE1A 2UW7A 3MPAA 3VBTA 2PVMA 4EK6A 2LGCA 4RRVA 3PY0A 5CANA 4RQVA 2HY81 5EH0A 2Y6OA 4QMZA 4KIPA 3OCTA 4M0ZA 2W0JA 5CU4A 5DT3A 3V5TA 4YSJA 4O2PA 4X3JA 4CFUA 2V22A 3FHIA 3PXYA 4HCTA 3LXPA 3ZBFA 3GCUA 3Q53A 3DNEA 3QQHA 4G1WA 4FC0A 4IVAA 4HYUA 1W84A 3PE2A 4AOTA 2WELA 1J91A 1JOWB 1Q8YA 4PDYA 5IDPA 3TZ7A 3GT8A 3TUDA 3R73A 4MYGA 3O8TA 4FK3A 4BGGA 1OM1A 3QXPA 4FICA 1J7UA 2IVSA 4FV3A 3FBVA 4L8MA 3ZBXA 4FTCA 5AP1A 3AG9A 2R3QA 1Q8WA 5DLSA 2UZLA 2WMVA 3LIJA 3QUPA 3P4KA 2VWIA 5C9CA 3C4XA 4ONAA 3SA0A 3JYAA 3R21A 1W7HA 4QYFA 2X2MA 1LR4A 5HQ0A 5C01A 1U46A 5KMNA 4H3QA 4DBXA 3BYMA 4LYNA 5DPVA 3REPA 4C3RA 2HK5A 3LCKA 4E4XA 4ZTHA 2RG5A 2PMNX 4FKRA 1H26A 4FGRA 4ZS4A 2BRMA 5I9UA 4XX9A 3UE4A 2YWVA 4GT3A 2GTMA 1WBTA 4ID7A 1J1BA 5FDPA 5KBQA 2DQ7X 2R3OA 2PL0A 4FT7A 3EQFA 1ZLTA 4WIHA 4ANQA 4Z7HA 3KN5A 4UWCA 1ZYSA 4LOQA 2WNTA 3PJ1A 1WCCA 3MH2A 4J53A 5BPYA 5LXMA 3KVWA 3FJQE 4IVBA 2W5AA 3NW6A 5KMKA 4FKVA 5HCYA 5ETFA 2C6IA 4DTKA 2VX3A 4ZTMA 2I40A 4G6OA 3THBA 3TUBA 5KZ0A 3C0IA 4RIYA 2W17A 3RPYA 3S95A 5A6OA 5KKRC 3KY2A 1PYEA 2JAVA 4FIHA 4X21A 1JAMA 2ZAZA 4CFFA 5EK7A 2VWVA 4JG7A 3RBWA 4QP9A 3IW4A 3BBWA 5I9ZA 4ANLA 4WD5A 4UYAA 4V05A 4YJQA 1Q3DA 4QNAA 3RNIA 1QPCA 3E92A 3DTWA 1GZNA 3U54A 4D2SA 2C3LA 3UNJA 4UY9A 4I0TA 4CZYB 3HLLA 4FK6A 4CZUA 5J9YA 3HP5A 4LRKA 5IQIA 4HNIA 4FVQA 1M17A 3G51A 5CAQA 4RWKA 4NM5A 4XG2A 3PA5A 2H9VA 4GKIA
chains in the Genus database with same CATH superfamily
2JITA 1YHVA 4ZAUA 2QCSA 2OZAB 3BL9A 2KTYA 3TNPC 5CF4A 3RKBA 4YP8A 4LI5A 2NPQA 4QMOA 4K6ZA 5IH5A 5B7VA 1Y57A 2XJ2A 3NUXA 4QP1A 1YHWA 4A4LA 4MNEA 2XB7A 4JQEA 4TT7A 3QC9A 3G0FA 1QWNA 2BHEA 2YDJA 3IPHA 3QCYA 2PVHA 3SLSA 3RWQA 1V0OA 4M15A 5IMEA 3CY2A 4YHTA 4JBVA 4WT6A 5HCXA 3F69A 5LJJA 3ZSHA 4QEBA 4QMWA 2VTJA 2CLXA 2JDVA 3TKUA 5FP5A 4EZYA 4EK3A 5HO8A 5LQFA 4FV5A 3TMOA 3HUBA 3A8XA 1OVEA 3MI9A 2RL5A 3NLBA 4LRMA 2WMUA 4WG3A 3T3UA 3UOLA 3VUMA 4I6LA 3G0EA 3EFWA 3Q32A 4JIKA 4OTDA 4FSNA 5ANKA 3D14A 3ZZWA 3O3NB 3T8OA 1YI3A 4AE9A 3FZ1A 3R7VA 2O0I1 1JKTA 1GNGA 1O6LA 2PHKA 3QGYA 5HZNA 4YJOA 4DEGA 2Y4IB 4IM3A 2F1BA 3P9JA 5C8MA 3KU2A 4A9UA 2VTHA 3FV8A 4HJOA 4LL0A 4FIEA 4EH6A 3RAIA 4DH8A 5HNGA 4J7BA 4MBLA 2J5FA 1CKIA 5GINE 4QDVA 4DINA 3P7AA 3ZEPA 5HVKA 4QTDA 4FKUA 4DFUA 3WARA 4NM0A 4HYBA 2I0EA 4WNKA 2JFLA 3BEGA 4I21A 1OKWA 4RFZA 4DG0E 4E6DA 4HCVA 2X5CA 4FZPA 3G15A 2B55A 3CTHA 4DEIA 4HOKA 5CX9A 4U5JA 5IA4A 2CGVA 5DYJA 5IQBA 3Q0KA 4D8JA 3TIYA 1H0VA 3FHRA 1FMKA 4BZOA 3I6WA 4D4YA 2QR7A 3FMEA 2VTPA 2XK9A 4IAFA 4I5HA 3FXWA 3R28A 3TZ8A 1Q8ZA 3A8WA 3UTOA 4DEHA 5HLWA 3HAHA 2QURA 4IFGA 2ZM4A 5EDRA 3KXXA 5HGIA 1SYKA 3R8LA 5BYYA 2Y6MA 5FTQA 4FMQA 1G8KA 3NVKI 4WHZA 3OROA 2WAJA 3I6UA 1UWHA 4UBAA 4KBKA 1MQ4A 5GIOE 3FQHA 2UUEA 4J8NA 5C27A 3VUHA 3M42A 4M7IA 3ZC5A 1OMWA 5D11A 5HTCA 4IFCA 2W1IA 2OIBA 1YRPA 5F95A 4ASDA 3TJCA 3LMIA 3SVVA 3R02A 2D1LA 1IA8A 3R8MA 3F3TA 4QMPA 3OT8A 5ETCA 5J7HA 5FP6A 4HVGA 2YIVX 3BUIA 4PQNA 3I5NA 4AACA 2GNGA 2YIYA 5IMXA 4EOKA 4BJJA 4P2KA 4DYMA 3A7FA 4CV8A 3NUSA 3O51A 3ZONA 2HAKA 4FEQA 4IM0A 4I6QA 1DKXA 2GU8A 3PSBA 5FQDC 5TKYA 2G01A 4OLIA 1H24A 3I5ZA 2X81A 3QKKA 5K0XA 4FZAB 2OBJA 3P7CA 2QQ7A 3WBLA 1LPUA 2EVAA 4LRJA 4WOVA 2X7FA 1JLUE 3NWWA 4CCUA 4D4SA 3UITA 3QCSA 4I22A 4ALVA 3F5PA 3EQDA 5AFVA 4UXQA 2XJ1A 4M69B 4D5HA 2PYWA 4C3PA 1U59A 4E3CA 4BJJB 2QOQA 4ERWA 4L3LA 4J97A 3BHYA 5E9EA 3Q84A 1H01A 2YISA 3PFQA 4MNEB 3W2QA 4DEAA 4C0TA 4F64A 3BLAA 3H9FA 4WSQA 3PVWA 4DBXA 1OKVA 3MFRA 3EN5A 2P0CA 3UC3A 5EYDA 2WMBA 3IOKA 4AZBA 2UZEA 4JBOA 3FMHA 4CNHA 4DFLA 2F7OA 4KD1A 2QOHA 4C2VA 4DLJA 1IAHA 2BTRA 4J98A 3MV5A 2VWZA 4CMUA 1KWPA 4F0FA 2FICA 4IZAA 1OAOA 2RT6A 4ENYA 4XP2A 3KXMA 3LM5A 1YDSE 4NTTA 4F7NA 4YTFA 4HY9A 4AAAA 1HCKA 2BRHA 3PA3A 5JH6A 3GU8A 2E2BA 3V51A 5AM6A 3ALNA 3MY0A 2WXVA 2C5YA 2XBJA 3F2AA 2C5XA 4C61A 3AKKA 3DKOA 4OTPA 3I81A 5IKWA 4E6QA 3MYGA 4ZY5A 4HGEA 4JQ8A 5C03A 4X2NA 3G9GA 3Q4CA 3MDYA 4O91A 5F1ZA 1FVVA 4W4VA 4AF3A 1W82A 1IA9A 5EHLA 2I1MA 5TT7A 2YCQA 5FTGA 3HV4A 4LG4A 2YM8A 3R8UA 1FGIA 2BDWA 3EN7A 4EHVA 5A4QA 5DMZA 3I04A 3H4JA 4BYJA 4ZZOA 4B99A 4LGHA 4W9WA 4FKSA 4IQ6A 2ND1A 3I7BA 4F7JA 2WMTA 4CRLA 1UU8A 2A98A 2REIA 3OS3A 1SM2A 4KSPA 4L01A 2FVDA 3ZM4A 2I0VA 4DH7A 2WGJA 3R9OA 2ZVAA 1OUKA 4RPVA 5JSMA 3VBWA 4E1ZA 3BL7A 2VWXA 5FLEX 2OK1A 3V01A 1ZARA 4BDBA 5A4EA 4PY1A 3TTJA 4E7WA 4LGDA 1P4FA 1YWVA 4G16A 4K77A 5DT4A 4AOJA 2WMXA 5AUXA 5J1WA 3RPRA 3Q6UA 1XMLA 2OWBA 3DK7A 3QWJA 4MHAA 3GUBA 4CKJA 5DNRA 2PY6A 3SW4A 2CGWA 4MF1A 2P4IA 4XLIA 2YLFA 1TQWA 4I3ZA 2ITZA 3KULA 3UYSA 5KKRB 4BI2A 2AYPA 3ACOA 5JK3A 4ANMA 4C02A 3BZ3A 1UA2A 4FKQA 4P4CA 5AV0A 5HNBA 5C4KA 5AP6A 4MD9E 4NM3A 3ZEWA 4QMMA 2C6LA 3PJ8A 5DRDA 3PXZA 4QTEA 3QHWA 4Y46A 3AD6A 4EH4A 5CZIA 3SXSA 4RZWA 3TL8A 4CFWA 3PJ2A 4KB8A 3GU4A 4LM5A 2F7EE 3DXNA 4XRLA 2X0OA 3ZMMA 3UOHA 3ZRMA 2UVZA 2XYNA 3EQBA 3FKLA 4EZ7A 2VNYA 1Y8GA 4EH8A 5HNIX 2F18A 4QMTA 3OXZA 5FRIA 3L9NA 5H2UA 3E88A 4MX9A 5IA3A 1E1XA 3I39X 4OBOA 1R33A 3K54A 5HKMA 3UG2A 2QO7A 3DQXA 4RJ5A 4D4RA 4DE4A 4U3YA 3VVHA 1DAYA 1SVGA 2OFVA 3P1AA 3QE6A 1PYXA 3FZOA 4N6ZA 1UNGA 5CSHA 4ALWA 3QD2B 1VR2A 4Z55A 1QPJA 2X8DA 3BRBA 4DLIA 4PTEA 4XS2A 4CKIA 5CXHA 3UGCA 4W8EA 3O3OB 1YVJA 5K4IA 4P5ZA 3DPOA 3BX5A 4ACCA 3I79A 5AP7A 3OCSA 3TJDA 4O22A 2HW6A 3QTUA 1KE8A 4FBXA 3SRVB 2VTQA 4AW2A 2PZYA 4JBPA 5IQGA 3AKLA 4K2RA 3V5JA 5JQ5A 1PF8A 1V0PA 3OC1A 1Q8UA 2GS6A 3PY1A 4TWNA 4FTQA 3N4VA 5AP2A 3HA6A 4X3FB 3ZSGA 4D9UA 2X7GA 2HELA 4QMVA 4B8LA 1UU3A 2CKOA 4OAVB 1R1WA 4NFNA 5GJDA 3GOPA 4M67A 4N57A 1Q97A 2EXCX 4HZRA 5E90A 3U9CA 4BDCA 4DFZE 2WYHA 3DZQA 2BUJA 2XIZA 3ZLYA 4R78A 4E6AA 3AC3A 4C4IA 2ZB1A 2VTMA 4F9AA 3WF9A 5HG7A 3B52X 3ORTA 2Y4IC 4FUXA 3BCEA 4IM2A 5I9YA 3PSDA 3ROCA 5M4UA 5CEQA 3KMMA 5EKNA 4O84A 3VUKA 3JVSA 2YEXA 5HICA 1S9JA 4EZNA 4L52A 2QOFA 3NPCA 1YDRE 3SG8A 3ZEDA 2W7XA 5CSPA 4QPSA 3U51A 2O64A 3IOPA 3S3IA 4W9XA 4O7LA 3EJSA 4IB5A 1JPAA 4PUZA 1WFCA 3CEKA 1ZOEA 3VIDA 1URUA 3SC1A 3G33A 4J99A 5DEYA 5I3OA 4EBVA 4IDTA 2WTDA 2YAKA 3FE3A 3RI1A 3E93A 1RDQE 4LUDA 3OWPA 3UP7A 3UZRA 4RIXB 4FSZA 4QMXA 4YJVA 5ANEA 2IZRA 3AD5A 2IJMA 3A7HA 4YZBA 5HOAA 3RNYA 4BTMA 4USEA 3TDVA 4J71A 3AGMA 3KA0A 2ONLC 4K18A 4ZY6A 3ENMA 4CXAA 1M7QA 1F5QA 3T3VA 3C4CA 1Z57A 3FPMA 1RQQA 4I5MA 4FE2A 3A7GA 3Q3BA 5CI7A 5IH6A 2GQRA 3BI6A 4JX7A 4M3QA 1T46A 3TNWA 4AXCA 4DHIB 4KIKA 2W1CA 2X2LA 4MXYA 4XG3A 2WQNA 4IWQA 3NAYA 3H9RA 4R7HA 2BTSA 5DI1A 1BMKA 3RK5A 4HYSA 4XCUA 3AMYA 4FVPA 1JSUA 1PXKA 4PRJA 2UZTA 2A27A 2B52A 2YM3A 1LEWA 3EN9A 4HYHA 3ULZA 3HUCA 3BYVA 4FKWA 5A4TA 4AZCA 3MTFA 4DCEA 5DR9A 4YJNA 5CALA 1YWNA 4MXAA 4WUAA 4I1QA 4O4CA 3V6SA 2XKFA 1OB3A 1O6KA 1H1RA 2PZ5A 4FV0A 3DX2A 5E8ZA 3VAPA 4FTKA 1E1VA 4AN9A 4EHEA 4F78A 4FM3A 4B7TA 3ER8C 4EZWA 3BVWA 1YKRA 1EH4A 4FSRA 4EOQA 2YIRA 4C4HA 5FEQA 3QA0A 2PWLA 4RJ8A 3D4ZA 3PVUA 4JQ7A 4YZCA 2JAMA 2OF4A 2R3LA 2VRXA 3JY9A 4I23A 4F7SA 3U87A 2WMSA 4RQKA 3BHVA 2W1FA 2FSMX 2W4JA 4BCPA 3P0MA 4TYGA 2VTRA 2YITA 3FZSA 4DTBA 3D50A 4AA5A 1QPDA 3QTQA 1QWUA 3F66A 2XA4A 3LJ2A 5DWRA 3OEFX 4XYFA 2PE0A 3FMKA 5EW9A 2XEZA 4DEBA 5K5NA 2EX3B 3HGKA 4JWEA 1Q3WA 4AQCA 1REKA 4EZPA 1FPUA 3IDBA 4BCNA 3DX0A 5CSVA 3PE1A 4AGCA 4QYYA 1OBGA 4B4LA 2OZOA 5CASA 1YOJA 4ARKA 4J8MA 1OIUA 4K11A 2J0IA 5TKDA 3C4WA 3JS2A 5AJQA 4BCQA 4TYIA 5ETAA 3U55A 1JBPE 2V5QA 2X0GA 2GPHA 2QKRA 3C0HA 4AVMA 2Z7LA 4HW7A 4DFYA 4MK0A 2BAKA 4FNWA 4G5PA 5CS6A 5LVLA 3EB0A 1TVOA 3MTLA 2CKPA 3POZA 5KBPA 3CIKA 2PE2A 1ZAOA 2QVSE 3H9OA 2OH0E 4JL9A 3WZEA 4QQ5A 5BUEA 3FD9A 4M97A 3N9XA 4RBLA 5CT0A 3ATTA 4BB4A 2RG6A 4AAYA 4RIOA 4YNEA 2Q12A 4MXXA 4PL4A 4EZUA 1TQUA 4NEUA 3DBCA 4Y72A 3C5IA 3PA4A 2W1EA 2A4LA 2J51A 2XK3A 3ZTXA 3CAZA 3OCBA 5L2IA 5DA3A 2PUNA 4GCJA 4CMOA 4QP2A 2QHNA 2IEWA 4YZNA 2OZAA 4FEWA 3FLQA 2IF8A 2ZB0A 1H8FA 1DAWA 3TI1A 3OOGA 2KULA 4FKOA 2CMWA 4GG7A 3M3WA 1OIRA 4QQTA 3G6GA 4BBFA 4HVHA 2XKCA 1E9VA 1TQPA 4XP3A 3CPBA 5J9LA 2VTOA 2QG7A 3C7QA 4Z7GA 2YM4A 4RIWA 3LJ0A 2R5TA 4M0MA 5M07A 2BVAA 2FSTX 1O7DC 3VRZA 2W5BA 2CN5A 3U6JA 3ZDIA 3ORXA 2OSCA 3O23A 3N4UA 4HCUA 1YHSA 3GQIA 2Y7JA 4NSTA 3R9RA 3H3CA 1UKIA 4NU1A 5FM2A 5M4IA 2G2FA 1M2RA 1Q24A 2R3RA 3RHXA 2OBMA 4KIOA 5ACBC 3F7ZA 2HWPA 1YDTE 3RV1A 1WBOA 4F63A 4O21A 3UNKA 2WD1A 4PO2A 4D28A 3LQ3A 1ZY5A 2G2HA 2G15A 4Z16A 2VWYA 4IAIA 3OW4A 4R5IA 3HRFA 4NKAA 4V01A 2PMOX 2XP2A 2R3NA 1ZYCA 3GENA 5EHOA 3S2PA 3VUGA 1AD5A 5IF1A 2AEGA 1WZYA 2YHVA 4UX9A 1TQIA 3CPCA 4BF2A 4FEVA 4L43A 3R7IA 4TNDA 4YLLA 4HVSA 1IG1A 2LXYA 2FUMA 5FDXA 2PMRA 2H34A 4FSWA 4IVCA 3LFAA 2UZOA 4C3FA 4O0UA 5KMJA 4E5WA 3T47A 3ODZX 3ZLSA 2F7RA 3AKJA 4JG8A 3GNIB 4FOBA 4IJ9A 5G6VA 5L8LA 5JGAA 3BGPA 3OUKA 3DKFA 3R1YA 4ZTSA 4BZDA 1Y6AA 4FTLA 4KRDA 4QNYA 2X7OA 2J4ZA 3C4EA 4CFMA 5HBJA 1ZZ2A 3ORKA 1B39A 5M06A 1TKIA 4BIEA 5J1VA 3R2BA 4BRXA 2D4CA 5C5BB 3E8DA 3PPJA 2YA9A 5FWKK 2WQOA 5HTIA 1L3RE 2VTLA 4FI1A 4W4WA 4XV2A 2OJGA 4PP9A 2Q13A 2YCSA 1NT2A 3GC9A 4ACDA 3W8LA 2WKMA 5EI6A 4RJ4A 4AUAA 5KX8A 2YACA 4FTUA 3KREA 1G8AA 2ZDUA 2OXDA 4ZTNA 1A9UA 5E8TA 4O83A 5ICPA 5JFSA 5D9HA 4FV8A 2V62A 3PPKA 1XO2B 4PPAA 5K5XA 5CVFA 3QD0A 2BALA 3IW7A 3LPBA 4X6RA 3ROYA 4RX5A 3GCVA 4YJRA 3LFNA 4M68A 4ANNA 4O82A 3AD4A 3R83A 3OWJA 3OXIA 3LFQA 2EUFB 3QTIA 3ERCC 1I49A 3DY7A 3PLSA 3BLQA 1XH5A 1MP8A 2QC6A 1WDZA 2ONLA 4I94A 2C6KA 3KXZA 4ALUA 4K0YA 3KQ7A 3B8QA 3DB6A 3F88A 2W05A 1MRVA 4L00A 3SOCA 3G9NA 3DX1A 3GEQA 2JBOA 5BUJA 3D94A 2F57A 3BWFA 3VBYA 3QU0A 3W18A 4LDTA 4WA9A 1SNUA 3EQHA 3QQFA 3KIOC 5CEPA 3A7JA 1P2AA 2UW6A 3NRMA 3UC4A 2QLQA 2C6MA 2XAOA 4BGHA 1PXPA 4IB3A 4K1BA 4FYOA 5F4NA 4BDGA 4IZ5A 5IA0A 4QO9A 4YZ9A 4JG6A 3W32A 4AZTA 5AAEA 4WPCA 5CZHA 3QBNA 3W0QA 3IQ7A 5M09A 3C4ZA 3IONA 1MRUA 4FNXA 5BVEA 3UVRA 1R34A 3VQHA 2O3PA 4QTCA 3ID6C 3ABHA 3DBQA 3QCXA 3FMMA 4FKLA 3CJFA 1S9IA 2OFUA 4JDIA 3UYTA 3FLNC 3TG1A 2YDKA 4CFNA 4H3BA 4LL5A 4PMSA 3WF5A 4FSQA 3WIGA 2C4GA 2I0YA 5CNNA 3QQGA 5BVDA 5L4QA 1W2DA 3DGKA 3QLGA 3UDSA 1H08A 1Y6BA 2BZHB 3G6HA 3KMUA 1GZOA 2UW8A 4MNFA 3VN9A 3LFSA 4C34A 3GC8A 3CE3A 4YPDA 5CAVA 3OY3A 4OTHA 1JKKA 5LARA 3PY3A 4A9SA 4O6LA 2X9EA 4RJ6A 3ZRLA 1PJKA 2OLCA 3FC1X 4BDEA 4O7YA 4R5LA 1PXIA 3OW3A 3QNIA 3WILA 2EFLA 3FMDA 4RVTA 5J8IA 5M08A 4CSVA 1PY5A 5JN2A 4S32A 3WIKA 5AAFA 1RE8A 4QDEA 3COHA 4O86A 2J9MA 5AV3A 4AT5A 4O4DA 4G3DA 5E7RA 4F08A 4QOXA 4BWPA 5CF5A 3PVBA 1KSWA 4ACGA 1Y2OA 4DTAA 2WQEA 4XEYA 3A98A 4XJ0A 4NQIA 1RJBA 2BMCA 3IG7A 2CGXA 4DFXE 4S31A 3FI3A 4H39A 3D7ZA 4BVUA 2C3IB 4DHFA 4G9CA 1JSVA 5LMKA 3FI2A 4AZEA 3NR9A 2R3PA 1Z5MA 4IX3A 3P5KA 5CT7A 4BCIA 3UQCA 2XCHA 1J7IA 3UDTA 3WOWA 1XR1A 2ESMA 2GTNA 3LW0A 3V8SA 2Z7QA 1UV5A 3E3BX 4YC6A 2XH5A 3LQ8A 1R5EA 5AP3A 3ZO2A 3TXOA 3LCOA 3EKNA 1LQ7A 2DS1A 3PG3A 4DA5A 4GKHA 3RPVA 3MSSA 4MUQA 4DCNC 4X6QC 4IX6A 4DDGA 4L3JA 2EXEA 2IVVA 4XV3A 4UMPA 4K33A 5BVNA 5M53A 4YC3A 3ZRKA 2PVJA 2VD5A 3BVXA 4BBEA 4RFMA 4KBCA 2QG5A 3P08A 3Q9YA 5EI2A 2AUHA 2CCIA 1SZMA 2C6OA 4G17A 3R1NA 3PJ3A 4FA2A 3ML1A 2O0UA 2R3GA 2CLQA 3DK6A 2V0OA 3PZHA 2WOTA 4JNEA 3HAVA 1CMKE 4KSQA 2WPAA 2YKTA 1H28A 3VQUA 2WIPA 1TQSA 5GNKA 2DUVA 5LCKA 4YTCA 4R5KA 1WBVA 2GHLA 2UVYA 3VBQA 4BHNA 5GIPE 4WO5A 2YABA 1QPEA 1R3CA 3HMMA 5DR2A 4U44A 3HA8A 3G90X 1DKYA 4FZSA 3NNWA 4YGAA 4PL3A 4ZS0A 3BQRA 3HMNA 3E8CA 5KE0A 4TYJA 1ERKA 2EWAA 2ITQA 3DFCB 3D83A 3Q52A 4GJ3A 5J79A 1R0PA 5I0BA 2OU7A 2PK9A 3KF4A 3PFYA 1GJOA 1YXTA 4EL9A 1OIQA 3EKKA 3DJ6A 3QTWA 4CLIA 4CV9A 1K9AA 3EQIA 3LCSA 1IAJA 2VGOA 1HTYA 2ITPA 3UO4A 4FV4A 4GW8A 1XH8A 3PWYA 5AUWA 1H1QA 3EH9A 4EOPA 4AZCB 1APME 4A4OA 4DC2A 3DXQA 3R1SA 2UZDA 4K9YA 4F7LA 4GL9A 4DF3A 2BRBA 5IDNA 5B2LA 4TYHA 4F9BA 3QKMA 4IC7A 3RPSA 2YI9A 4KUJA 3II5A 2UW5A 3HMOA 4RX9A 3ZOSA 4E26A 4X2GA 3NSZA 3TZ9A 4RWLA 3KCKA 5E8UA 4C4JA 3I1AA 2QFFA 4JNFA 4BNEA 2RFDA 3EYGA 3NYNA 4EORA 3G2FA 3LXNA 3EJ1A 1CTPE 2NCZA 5LMAA 4NIFB 4AW5A 4E81A 4BHZA 4ZSEA 4ERKA 5L2TA 4FT9A 2JIUA 2R7BA 2ETMA 2JLDA 2X4FA 3EFLA 4OR5A 4BFMA 3V3VA 4FKJA 5CWZA 1IR3A 1TQMA 4II5A 5D41A 4U40A 4C8BA 4DGLC 2Q0BA 5BVFA 1SVEA 5BQ0A 3D51A 4AZ7A 3FWQA 3JVRA 5E84A 2YFXA 4AX8A 2W4OA 2Y0AA 4WBBB 4OW8A 2R64A 5DOSA 2BKKA 3FYJX 3MS9A 4RT7A 1W2FA 1ND4A 3F2RA 3OTVA 2H8HA 2QOLA 2UW4A 3NYOA 1TFFA 5DGZA 4DH1A 2HZ4A 2O8YA 4NIFA 3ZDUA 3AT2A 5B2MA 4L3PA 4EOIA 1OPKA 1H07A 3K3JA 4RA4A 3OHXM 4DG3E 4EZOA 4FV1A 2ITWA 3FLSA 2OO2A 2F7ZE 2OO8X 5DVRA 5JT2A 4GT4A 5CAUA 1VLRA 2CPKE 5BVWA 4FGBA 5BYZA 4BL1A 3IK3A 5E8XA 2QU6A 4M13A 4XG8A 4A4XA 4APCA 3LMHA 3QTRA 3QTXA 4IBMA 3NX8A 3ZH8A 3H0YA 3QL8A 3S0OA 3OFMA 4KBAA 4O7VA 3TT0A 2CHLA 1OKZA 3MVJA 5AIKA 3NZ0A 3V5LA 4C38A 3E64A 4ZJJA 4MWHA 3ZUUA 2CNQA 3KRXA 5CVGA 2OXYA 4H36A 1F3MC 4OGRA 1I4DA 2YM5A 3FZTA 5EQYA 4UZDA 3SG9A 2X3XA 4JAJA 2HENA 3PXQA 3SD0A 1YXUA 3GCQA 3LLTA 3R01A 3T9IA 3VS5A 5IQDA 1PW2A 5HD7A 5EM6A 2W06A 3KKVA 1NW1A 3NMUF 5CNOA 4YSMA 4JT3A 5CF8A 1H27A 3F3UA 3FZRA 2JGZA 4FV2A 4R1YA 3RALA 5A46A 4Q2AA 5EG3A 2QNJA 3V5PA 3RK7A 3BVVA 4GFOA 3LMFA 3KCFA 3ANRA 4BBMA 4OTIA 5ANJA 5A3XA 3CQUA 1Q99A 4XV1A 3Q9WA 4BCFA 4C36A 2WOUA 3TEIA 5IEVA 4M69A 2QD9A 3HZTA 4FTRA 1TQVA 2PU8A 3CD3A 3O8PA 2F7QA 4D1XA 1A48A 2WMRA 5HO7A 3UO5A 4CTCA 5D1JA 3UOJA 3S00A 5AR3A 3W0OA 4JWDA 3K5UA 5HG9A 4N0SA 5C1QB 3BBTB 2OJ9A 3QXOA 4FT3A 2UVXA 3V8TA 3L8PA 1OL7A 4ZTLA 4EH2A 2VTTA 4AZGA 2CKQA 3A61A 4FJVA 4QP6A 1UKHA 1KV2A 4B6LA 4WNMA 3I7CA 4EK4A 1H1PA 3D7TA 5JEBA 2ELBA 3DBDA 2XIXA 3QLFA 5FBNC 4QPMA 3BPRA 3QZIA 3CQWA 4GS6A 5IA2A 5C4LA 3DDGA 4G3CA 3FUPA 4EZVA 4RVLA 4LOPA 4DGGA 3FLYA 4UMUA 4AZHA 4EZSA 1L8TA 2X6DA 4U9AA 1PXLA 2B9FA 4LV8A 3OHTA 3WZDA 3HNGA 2XS0A 3ANQA 3IW5A 4P7EA 4LQMA 5FEDA 2JEDA 3QUEA 4N6YA 3ZXTA 4RZVA 3W0SA 4FL1A 4RJ3A 3KK8A 3RAKA 5IZFA 5L2WA 2GNJA 3HDMA 4CFVA 3HECA 3LVTA 1LEZA 3ULIA 4GT5A 4GK4A 4EEVA 4G6LA 2ND0A 2IG7A 1JWHA 2BKZA 3LFDA 3R8PA 4JIAA 1M7NA 5AWMA 2ITTA 3BLHA 5BV3A 3PDTA 1YOMA 5AR7A 4CT2A 3TKHA 4DEDA 4EQCA 5K4JA 2WO6A 4IAYA 3ZFMA 3MY1A 4KIQA 5EM5A 4O1PA 4FL2A 3COMA 2QXLA 3BVTA 1OGYA 3PIYA 5HVJA 4E4NA 4EK5A 2XCKA 2CGUA 5DR6A 3CXWA 1OL1A 5JZNA 2F2CB 2Z60A 3MJ1A 4FG8A 3DJ7A 4HPUE 5HE1A 4EWHA 5M4FA 3WZKA 4IHPA 1U4DA 3RM6A 5HG8A 2C5VA 3NNVA 4E5AX 5IG1A 4HR1B 2RAJA 4DG2E 1ZRZA 1VJYA 3DOGA 2F49A 2VTIA 4JVGA 2OJFE 5AV1A 4X2KA 4YURA 3TM0A 3FI4A 3MB7A 2RFSA 4EJ7A 2OJJA 3QZFA 3VUIA 3OF0A 1X04A 2BAQA 3JY0A 3P78A 3Q6WA 4V0GA 4QTAA 3CJGA 3EZRA 2OG8A 3ZCLA 2DWBA 1PHKA 2V55A 2IN6A 3ZUVA 3HRCA 4A9YA 3NYVA 4OTQA 2JKQA 4UYNA 3UZPA 5B0XA 2VV9A 3VJOA 5ANGA 4PL5A 4EOOA 4O4EA 2Q0NA 1U54A 4FZOA 4IDVA 3GGFA 4AZSA 4QT1A 3VNTA 2OW3A 4IADA 2ZMDA 4NTSA 4C7TA 4ZSJA 4F65A 1FGKA 2BIKB 2X9FA 4OBQA 5H3QA 2C0OA 2WTCA 4X3FC 3VS6A 1PXOA 1REJA 3CBLA 5KMIA 1WMKA 2QKWB 4YHFA 4IMYA 4L45A 4DGOA 3SOGA 3D5UA 3IO7A 4UMTA 5CSXA 2GNFA 2FA2A 4RA5A 2YZLA 5IQAA 3VWAA 4TL0A 3R00A 1XMMA 5A9UA 3UPXA 4ZSAA 2GF4A 5J5SA 5L8KA 4DITA 3L9LA 5E91A 1Y91A 3IW8A 1KOBA 4RC3A 3BEAA 4IB0A 4FKGA 4L44A 4BICA 2B4SB 3KL8A 3PTGA 4XG9A 3TZMA 1XKKA 4EOLA 3E7OA 4KWPA 4EH3A 2YJSA 5EW8A 4E4MA 2YM6A 1J3HA 5IUHA 3DT1A 4BC6A 3C4FA 5JFXA 2BAJA 4JBQA 4XG7A 4TRLA 4R6VA 2C1AA 4BIDA 4CTBA 1OBDA 1KE7A 1VYWA 2AC3A 4IW0A 3CC6A 4IE9A 5L2SA 3OK8A 4DBNA 4U97A 4HVDA 3R7UA 2BPMA 3DTCA 2FB8A 3AQVA 2B54A 3R1QA 4FUYA 3R2YA 1M14A 1ZYJA 3E8NA 4ZEGA 5HX6A 3O3MB 2A1AB 2W96B 2XRUA 4AE6A 3OBGA 3E63A 4R1VA 1IRKA 3QRUA 3Q9ZA 5ACKA 5KNJA 1FBNA 2WQMA 3ACJA 1UU9A 3VS7A