1R5EA

Solution structure of the folded core of pseudomonas syringae effector protein, avrpto
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
105
structure length
105
Chain Sequence
DNVTSSQLLSVRHQLAESAGLPRDQHEFVSSQAPQSLRNRYNNLYSHTQRTLDMADMQHRYMTGASGINPGMLPHENVDDMRSAITDWSDMREALQHAMGIHADI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords avirulence protein
publication title The solution structure of type III effector protein AvrPto reveals conformational and dynamic features important for plant pathogenesis.
pubmed doi rcsb
source organism Pseudomonas syringae
molecule tags Protein binding
total genus 35
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2003-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11592 AvrPto Central core of the bacterial effector protein AvrPto
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.140 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 AvrPto 1r5eA01
1R5EA 2QKWA
chains in the Genus database with same CATH superfamily
3HAIA 4JWEA 4AZIA 3RV0A 2YL8A 2MI7A 4EZTA 2NCZA 2Q12A 4EZZA 4HYBA 4EZRA 1URUA 3EJTA 3BVTA 2OBMA 2ELBA 3OHXM 1PS3A 3BVVA 3D50A 4JWCA 4NQIA 2WYHA 2YLAA 3BVXA 4JWIA 3DX4A 3DDFA 2ALWA 3BUBA 4AZCB 1W9MA 1I49A 1I4TA 3LVTA 4R5KA 2YIBA 2GA9D 2F1AA 3D4ZA 2OW7A 2YIVX 2F7QA 1TQSA 2OO2A 2EWFA 1OA0A 4EZPA 2LM0A 1QWNA 3RV1A 4WPCA 1HXKA 2JNKA 1GNLA 2D1LA 3LMFA 1QWUA 3D52A 2YIAA 1O7DC 2X3VA 1SU7A 3DPOA 5TKYA 3DX2A 3ABHA 1E1DA 4EZOA 4IWQA 2RAIA 2WYIA 3CZSA 3UITA 4EZYA 4EZNA 4AZHA 4WPEA 2OBLA 4UDXX 4IWOA 4EZUA 3T48A 4I1QA 5KBPA 3B53X 3KAVA 4AZGA 3B52X 3CAZA 1SU6A 3ERCC 2JNSA 4FZSA 4IW0A 2EFLA 2ZXQA 1JQKA 4EZSA 1DKYA 1GNTA 4EZQA 3D51A 4D8JA 4AZCA 3O3NB 3ACOA 1O7DB 4FM3A 2N3KA 2F18A 3A98A 4AKVA 4G6QA 4HR1A 2FICA 3VKHA 2C08A 4E81A 3LLLA 4IM0A 3DDGA 3OK8A 3DPQA 2EFKA 4EZVA 1U00A 1I4DA 3KAWA 1MJGA 4EZWA 3DX0A 1OAOA 4HR1B 1R5EA 4H8SA 5C5BB 3SOGA 1LQ7A 2YI9A 1HTYA 3T4AG 3DYTA 3I04A 4R5LA 4E3CA 2KHOA 1R34A 3I39X 3EJQA 3ZEDA 2X5CA 3BUPA 4F01A 2FYVA 4M0MA 1UPXA 1DKZA 1WDZA 2GAFD 1Y2OA 1QX1A 3O3MB 4FZOA 4JWDA 4JNEA 4AZBA 3VEAA 2ND0A 2WINM 3BUIA 3DX3A 3EJSA 2X3WA 2ND1A 2YI8A 4H6HA 2Q13A 3HAHA 2GF4A 2QFFA 3EJRA 1E2UA 3BVUA 4KIKA 3QWEA 2YL5A 3M3WA 3B51X 2YL6A 4DYLA 4IWPA 2YLLA 1TQUA 1OA1A 3T46A 3GI7A 4IM3A 3CZNA 2QKWA 4KIKB 3T49A 2Z8YA 2PY6A 3CKDA 5C5BA 3O3OB 3T47A 1I4LA 4B9QA 4NSWA 4FZPA 3HAJA 1ZYLA 2Z0OA 3QE6A 2LXYA 3I2WA 3D2EA 3CV5A 4JNFA 1HWWA 4AZ5A 4PO2A 3QNJA 3D2FA 4AZ7A 1X04A 3BUDA 2QXLA 4R5GA 2YKTA 1TQTA 4JLCA 3ER8C 3BLBA 2F1BA 3D4YA 1GN9A 3Q84A 2D4CA 3QNIA 3SYVA 2Z0VA 3BUQA 3DPPA 3KDRA 3OWGA 3I01A 1SUFA 2V0OA 3ER9B 3FD9A 4AZ6A 3PLTA 2PMRA 4NPHA 3Q0KA 2X3XA 4BNEA 2OW6A 3QA8A 3BVWA 3EJUA 4JL9A 3G9GA 2F7PA 2F7OA 4AVMA 3L3OM 3DX1A 3C7NA 4H6IA 4UDYX 5FLEX 2O0I1 2OZNB 4EZXA 4F00A 1ZWWA 2RAJA 3RPMA 1X03A 1TQWA 1SU8A 4HY9A 4JN4A 1TQVA 1DKXA 5FIGA 3VEBA 4R5JA 4R5IA 3EJPA 2EX3B 2YL9A 3L3PA 5E84A 1E9VA 4DCNC 2F7RA 2RAKA 3F7WA 3CVRA 1YWMA 2Z0NA 1R33A 2RT6A 4ATMA 4IM2A
chains in the Genus database with same CATH topology
1R5EA 2QKWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R5E A;  2QKW A; 
#chains in the Genus database with same CATH topology
 3HAI A;  4JWE A;  4AZI A;  3RV0 A;  2YL8 A;  2MI7 A;  4EZT A;  2NCZ A;  2Q12 A;  4EZZ A;  4HYB A;  4EZR A;  1URU A;  3EJT A;  3BVT A;  2OBM A;  2ELB A;  3OHX M;  1PS3 A;  3BVV A;  3D50 A;  4JWC A;  4NQI A;  2WYH A;  2YLA A;  3BVX A;  4JWI A;  3DX4 A;  3DDF A;  2ALW A;  3BUB A;  4AZC B;  1W9M A;  1I49 A;  1I4T A;  3LVT A;  4R5K A;  2YIB A;  2GA9 D;  2F1A A;  3D4Z A;  2OW7 A;  2YIV X;  2F7Q A;  1TQS A;  2OO2 A;  2EWF A;  1OA0 A;  4EZP A;  2LM0 A;  1QWN A;  3RV1 A;  4WPC A;  1HXK A;  2JNK A;  1GNL A;  2D1L A;  3LMF A;  1QWU A;  3D52 A;  2YIA A;  1O7D C;  2X3V A;  1SU7 A;  3DPO A;  5TKY A;  3DX2 A;  3ABH A;  1E1D A;  4EZO A;  4IWQ A;  2RAI A;  2WYI A;  3CZS A;  3UIT A;  4EZY A;  4EZN A;  4AZH A;  4WPE A;  2OBL A;  4UDX X;  4IWO A;  4EZU A;  3T48 A;  4I1Q A;  5KBP A;  3B53 X;  3KAV A;  4AZG A;  3B52 X;  3CAZ A;  1SU6 A;  3ERC C;  2JNS A;  4FZS A;  4IW0 A;  2EFL A;  2ZXQ A;  1JQK A;  4EZS A;  1DKY A;  1GNT A;  4EZQ A;  3D51 A;  4D8J A;  4AZC A;  3O3N B;  3ACO A;  1O7D B;  4FM3 A;  2N3K A;  2F18 A;  3A98 A;  4AKV A;  4G6Q A;  4HR1 A;  2FIC A;  3VKH A;  2C08 A;  4E81 A;  3LLL A;  4IM0 A;  3DDG A;  3OK8 A;  3DPQ A;  2EFK A;  4EZV A;  1U00 A;  1I4D A;  3KAW A;  1MJG A;  4EZW A;  3DX0 A;  1OAO A;  4HR1 B;  1R5E A;  4H8S A;  5C5B B;  3SOG A;  1LQ7 A;  2YI9 A;  1HTY A;  3T4A G;  3DYT A;  3I04 A;  4R5L A;  4E3C A;  2KHO A;  1R34 A;  3I39 X;  3EJQ A;  3ZED A;  2X5C A;  3BUP A;  4F01 A;  2FYV A;  4M0M A;  1UPX A;  1DKZ A;  1WDZ A;  2GAF D;  1Y2O A;  1QX1 A;  3O3M B;  4FZO A;  4JWD A;  4JNE A;  4AZB A;  3VEA A;  2ND0 A;  2WIN M;  3BUI A;  3DX3 A;  3EJS A;  2X3W A;  2ND1 A;  2YI8 A;  4H6H A;  2Q13 A;  3HAH A;  2GF4 A;  2QFF A;  3EJR A;  1E2U A;  3BVU A;  4KIK A;  3QWE A;  2YL5 A;  3M3W A;  3B51 X;  2YL6 A;  4DYL A;  4IWP A;  2YLL A;  1TQU A;  1OA1 A;  3T46 A;  3GI7 A;  4IM3 A;  3CZN A;  2QKW A;  4KIK B;  3T49 A;  2Z8Y A;  2PY6 A;  3CKD A;  5C5B A;  3O3O B;  3T47 A;  1I4L A;  4B9Q A;  4NSW A;  4FZP A;  3HAJ A;  1ZYL A;  2Z0O A;  3QE6 A;  2LXY A;  3I2W A;  3D2E A;  3CV5 A;  4JNF A;  1HWW A;  4AZ5 A;  4PO2 A;  3QNJ A;  3D2F A;  4AZ7 A;  1X04 A;  3BUD A;  2QXL A;  4R5G A;  2YKT A;  1TQT A;  4JLC A;  3ER8 C;  3BLB A;  2F1B A;  3D4Y A;  1GN9 A;  3Q84 A;  2D4C A;  3QNI A;  3SYV A;  2Z0V A;  3BUQ A;  3DPP A;  3KDR A;  3OWG A;  3I01 A;  1SUF A;  2V0O A;  3ER9 B;  3FD9 A;  4AZ6 A;  3PLT A;  2PMR A;  4NPH A;  3Q0K A;  2X3X A;  4BNE A;  2OW6 A;  3QA8 A;  3BVW A;  3EJU A;  4JL9 A;  3G9G A;  2F7P A;  2F7O A;  4AVM A;  3L3O M;  3DX1 A;  3C7N A;  4H6I A;  4UDY X;  5FLE X;  2O0I 1;  2OZN B;  4EZX A;  4F00 A;  1ZWW A;  2RAJ A;  3RPM A;  1X03 A;  1TQW A;  1SU8 A;  4HY9 A;  4JN4 A;  1TQV A;  1DKX A;  5FIG A;  3VEB A;  4R5J A;  4R5I A;  3EJP A;  2EX3 B;  2YL9 A;  3L3P A;  5E84 A;  1E9V A;  4DCN C;  2F7R A;  2RAK A;  3F7W A;  3CVR A;  1YWM A;  2Z0N A;  1R33 A;  2RT6 A;  4ATM A;  4IM2 A; 
#chains in the Genus database with same CATH homology
 1R5E A;  2QKW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...