1R5EA

Solution structure of the folded core of pseudomonas syringae effector protein, avrpto
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
105
structure length
105
Chain Sequence
DNVTSSQLLSVRHQLAESAGLPRDQHEFVSSQAPQSLRNRYNNLYSHTQRTLDMADMQHRYMTGASGINPGMLPHENVDDMRSAITDWSDMREALQHAMGIHADI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords avirulence protein
publication title The solution structure of type III effector protein AvrPto reveals conformational and dynamic features important for plant pathogenesis.
pubmed doi rcsb
source organism Pseudomonas syringae
total genus 35
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2003-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11592 AvrPto Central core of the bacterial effector protein AvrPto
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.140 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 AvrPto 1r5eA01
1R5EA 2QKWA
chains in the Genus database with same CATH superfamily
4WPEA 3B51X 4EZQA 2RT6A 5TKYA 3QNIA 3EJTA 4JNFA 1TQUA 4AZCB 2ND0A 3DYTA 4IWQA 3HAIA 2PY6A 3O3OB 4PO2A 3DX4A 2GF4A 3T4AG 3F7WA 2PMRA 3QWEA 4JNEA 4AVMA 3D52A 4G6QA 3DX2A 4EZUA 2O0I1 3SOGA 3RV0A 2RAJA 4IWPA 4E81A 2ND1A 1HXKA 2YL9A 4AZ6A 3DX0A 4HYBA 4NPHA 2F7QA 3Q0KA 1I49A 1MJGA 4EZYA 1PS3A 2QXLA 4HR1A 1YWMA 2N3KA 2X3WA 1WDZA 1QX1A 3B53X 1DKZA 4HY9A 4EZXA 3KAWA 3CKDA 2F1BA 3CZSA 1TQVA 1E2UA 4E3CA 3EJRA 4EZNA 4HR1B 3I39X 5C5BA 5FLEX 2WYHA 2GAFD 1SUFA 4JL9A 1O7DB 3CV5A 2F7PA 2OW7A 3BVVA 3LMFA 2JNSA 4F00A 4IM0A 3FD9A 4M0MA 1HTYA 3T47A 4AZGA 3VKHA 3QNJA 2YL8A 3BUQA 3BVUA 5C5BB 3BVXA 1UPXA 3HAJA 2EWFA 3OK8A 2EX3B 3KDRA 4WPCA 3T46A 3QE6A 4DYLA 3CVRA 2Q12A 3DDGA 1I4TA 3O3NB 1U00A 2WYIA 4FZPA 3ABHA 3RPMA 2X3XA 3PLTA 2C08A 3C7NA 4FZSA 3ACOA 3G9GA 3I01A 2X3VA 4FZOA 1X04A 1SU7A 2X5CA 3B52X 3LVTA 3ER9B 4H6HA 2D1LA 3KAVA 4BNEA 1SU8A 4IW0A 3I04A 5KBPA 2GA9D 4IM2A 2YI9A 1X03A 4JWEA 2YLAA 3QA8A 3BUPA 1QWNA 2V0OA 3VEAA 3D51A 4IM3A 2EFLA 2WINM 3BVWA 2Z8YA 4IWOA 4JWDA 2OBLA 2QKWA 1E1DA 2YL5A 4JLCA 3ER8C 4JWCA 4R5IA 3BUDA 4EZRA 2F18A 2ALWA 4KIKA 4EZSA 4UDYX 3UITA 1TQSA 1I4DA 2JNKA 1Y2OA 2YIVX 3I2WA 1HWWA 2Z0VA 2ZXQA 1R5EA 3T49A 3T48A 2RAIA 4EZZA 3M3WA 1QWUA 3RV1A 4NSWA 2Q13A 3BUBA 3BLBA 2OZNB 2YI8A 4KIKB 4AKVA 1I4LA 4DCNC 4EZTA 3L3PA 2OO2A 4I1QA 3A98A 1DKYA 3Q84A 3EJPA 1LQ7A 1TQTA 3ERCC 1ZYLA 3D2FA 4EZVA 3EJSA 2Z0NA 2MI7A 1GNTA 2YL6A 2OBMA 2OW6A 1URUA 3D2EA 1OA0A 2F1AA 4JN4A 2YLLA 3DPPA 1R34A 3CAZA 2Z0OA 5E84A 3D4YA 4H8SA 2FICA 1R33A 4FM3A 2KHOA 3BUIA 3LLLA 2FYVA 3O3MB 3OHXM 4EZPA 1O7DC 4JWIA 2ELBA 1OAOA 2YIBA 3D50A 4AZIA 4R5KA 2NCZA 3BVTA 4R5LA 3DPQA 4H6IA 3SYVA 3D4ZA 3VEBA 4R5JA 3HAHA 1OA1A 3DX1A 4AZHA 4B9QA 2LM0A 5FIGA 2F7OA 2YIAA 1GNLA 1DKXA 4AZ5A 2YKTA 4F01A 2QFFA 1SU6A 4EZWA 3DDFA 1E9VA 4NQIA 3EJUA 1W9MA 1JQKA 3DX3A 2D4CA 1GN9A 1ZWWA 4AZCA 3GI7A 3ZEDA 4ATMA 4D8JA 4R5GA 3CZNA 3EJQA 2EFKA 1TQWA 2RAKA 3L3OM 4UDXX 3OWGA 2LXYA 2F7RA 4AZBA 4EZOA 3DPOA 4AZ7A
chains in the Genus database with same CATH topology
1R5EA 2QKWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R5E A;  2QKW A; 
#chains in the Genus database with same CATH topology
 4WPE A;  3B51 X;  4EZQ A;  2RT6 A;  5TKY A;  3QNI A;  3EJT A;  4JNF A;  1TQU A;  4AZC B;  2ND0 A;  3DYT A;  4IWQ A;  3HAI A;  2PY6 A;  3O3O B;  4PO2 A;  3DX4 A;  2GF4 A;  3T4A G;  3F7W A;  2PMR A;  3QWE A;  4JNE A;  4AVM A;  3D52 A;  4G6Q A;  3DX2 A;  4EZU A;  2O0I 1;  3SOG A;  3RV0 A;  2RAJ A;  4IWP A;  4E81 A;  2ND1 A;  1HXK A;  2YL9 A;  4AZ6 A;  3DX0 A;  4HYB A;  4NPH A;  2F7Q A;  3Q0K A;  1I49 A;  1MJG A;  4EZY A;  1PS3 A;  2QXL A;  4HR1 A;  1YWM A;  2N3K A;  2X3W A;  1WDZ A;  1QX1 A;  3B53 X;  1DKZ A;  4HY9 A;  4EZX A;  3KAW A;  3CKD A;  2F1B A;  3CZS A;  1TQV A;  1E2U A;  4E3C A;  3EJR A;  4EZN A;  4HR1 B;  3I39 X;  5C5B A;  5FLE X;  2WYH A;  2GAF D;  1SUF A;  4JL9 A;  1O7D B;  3CV5 A;  2F7P A;  2OW7 A;  3BVV A;  3LMF A;  2JNS A;  4F00 A;  4IM0 A;  3FD9 A;  4M0M A;  1HTY A;  3T47 A;  4AZG A;  3VKH A;  3QNJ A;  2YL8 A;  3BUQ A;  3BVU A;  5C5B B;  3BVX A;  1UPX A;  3HAJ A;  2EWF A;  3OK8 A;  2EX3 B;  3KDR A;  4WPC A;  3T46 A;  3QE6 A;  4DYL A;  3CVR A;  2Q12 A;  3DDG A;  1I4T A;  3O3N B;  1U00 A;  2WYI A;  4FZP A;  3ABH A;  3RPM A;  2X3X A;  3PLT A;  2C08 A;  3C7N A;  4FZS A;  3ACO A;  3G9G A;  3I01 A;  2X3V A;  4FZO A;  1X04 A;  1SU7 A;  2X5C A;  3B52 X;  3LVT A;  3ER9 B;  4H6H A;  2D1L A;  3KAV A;  4BNE A;  1SU8 A;  4IW0 A;  3I04 A;  5KBP A;  2GA9 D;  4IM2 A;  2YI9 A;  1X03 A;  4JWE A;  2YLA A;  3QA8 A;  3BUP A;  1QWN A;  2V0O A;  3VEA A;  3D51 A;  4IM3 A;  2EFL A;  2WIN M;  3BVW A;  2Z8Y A;  4IWO A;  4JWD A;  2OBL A;  2QKW A;  1E1D A;  2YL5 A;  4JLC A;  3ER8 C;  4JWC A;  4R5I A;  3BUD A;  4EZR A;  2F18 A;  2ALW A;  4KIK A;  4EZS A;  4UDY X;  3UIT A;  1TQS A;  1I4D A;  2JNK A;  1Y2O A;  2YIV X;  3I2W A;  1HWW A;  2Z0V A;  2ZXQ A;  1R5E A;  3T49 A;  3T48 A;  2RAI A;  4EZZ A;  3M3W A;  1QWU A;  3RV1 A;  4NSW A;  2Q13 A;  3BUB A;  3BLB A;  2OZN B;  2YI8 A;  4KIK B;  4AKV A;  1I4L A;  4DCN C;  4EZT A;  3L3P A;  2OO2 A;  4I1Q A;  3A98 A;  1DKY A;  3Q84 A;  3EJP A;  1LQ7 A;  1TQT A;  3ERC C;  1ZYL A;  3D2F A;  4EZV A;  3EJS A;  2Z0N A;  2MI7 A;  1GNT A;  2YL6 A;  2OBM A;  2OW6 A;  1URU A;  3D2E A;  1OA0 A;  2F1A A;  4JN4 A;  2YLL A;  3DPP A;  1R34 A;  3CAZ A;  2Z0O A;  5E84 A;  3D4Y A;  4H8S A;  2FIC A;  1R33 A;  4FM3 A;  2KHO A;  3BUI A;  3LLL A;  2FYV A;  3O3M B;  3OHX M;  4EZP A;  1O7D C;  4JWI A;  2ELB A;  1OAO A;  2YIB A;  3D50 A;  4AZI A;  4R5K A;  2NCZ A;  3BVT A;  4R5L A;  3DPQ A;  4H6I A;  3SYV A;  3D4Z A;  3VEB A;  4R5J A;  3HAH A;  1OA1 A;  3DX1 A;  4AZH A;  4B9Q A;  2LM0 A;  5FIG A;  2F7O A;  2YIA A;  1GNL A;  1DKX A;  4AZ5 A;  2YKT A;  4F01 A;  2QFF A;  1SU6 A;  4EZW A;  3DDF A;  1E9V A;  4NQI A;  3EJU A;  1W9M A;  1JQK A;  3DX3 A;  2D4C A;  1GN9 A;  1ZWW A;  4AZC A;  3GI7 A;  3ZED A;  4ATM A;  4D8J A;  4R5G A;  3CZN A;  3EJQ A;  2EFK A;  1TQW A;  2RAK A;  3L3O M;  4UDX X;  3OWG A;  2LXY A;  2F7R A;  4AZB A;  4EZO A;  3DPO A;  4AZ7 A; 
#chains in the Genus database with same CATH homology
 1R5E A;  2QKW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...