1R5EA

Solution structure of the folded core of pseudomonas syringae effector protein, avrpto
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
105
structure length
105
Chain Sequence
DNVTSSQLLSVRHQLAESAGLPRDQHEFVSSQAPQSLRNRYNNLYSHTQRTLDMADMQHRYMTGASGINPGMLPHENVDDMRSAITDWSDMREALQHAMGIHADI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords avirulence protein
publication title The solution structure of type III effector protein AvrPto reveals conformational and dynamic features important for plant pathogenesis.
pubmed doi rcsb
source organism Pseudomonas syringae
molecule tags Protein binding
total genus 35
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2003-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11592 AvrPto Central core of the bacterial effector protein AvrPto
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.140 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 AvrPto 1r5eA01
2QKWA 1R5EA
chains in the Genus database with same CATH superfamily
4H6HA 5TKYA 2LM0A 3CVRA 3D50A 1OA0A 3B53X 4NSWA 3DPQA 4F00A 3CV5A 3A98A 3UITA 4AZCA 2F1AA 3Q84A 1SU8A 4EZNA 3T49A 1I4TA 3BUDA 3EJUA 4IM3A 4EZYA 4EZZA 3I2WA 1I4DA 2WYHA 2YI8A 2RAIA 4HY9A 3D52A 2F18A 4AKVA 1X03A 2ALWA 3ERCC 4FZSA 3PLTA 3VEBA 2WINM 2X3XA 3GI7A 3BVUA 2Z0VA 1JQKA 4UDYX 3I39X 1I49A 4H6IA 3DPPA 3BUPA 3EJQA 2YL8A 3T48A 3EJPA 3BLBA 2FYVA 4AZ7A 2GA9D 3CZSA 4G6QA 1YWMA 1W9MA 1SUFA 4EZQA 2MI7A 3C7NA 2ND1A 2Q13A 4WPCA 4HR1A 4AZHA 4DCNC 2GF4A 2QKWA 3T47A 3DX1A 3ZEDA 2YL9A 4FZPA 4HR1B 2WYIA 3EJRA 4JWDA 3LVTA 4R5IA 3L3PA 3DX0A 1HWWA 2OBMA 2PY6A 4R5KA 3ER9B 2Z0NA 3QE6A 4FM3A 1SU7A 3KAWA 3BVXA 4FZOA 4PO2A 1HTYA 4JL9A 4IWOA 3I04A 2YL5A 4AZ6A 2QXLA 3F7WA 1X04A 1O7DB 3D2FA 3DPOA 5FIGA 2F7RA 4JNFA 2D4CA 1QX1A 1HXKA 3T46A 1DKZA 2YLAA 2OW6A 2F7QA 1E9VA 2RAJA 3G9GA 3D2EA 2Z0OA 2OO2A 3OHXM 3BUQA 1E1DA 2EFKA 2YL6A 2EX3B 3ACOA 2YIAA 1Y2OA 2X3WA 4KIKA 1PS3A 3LMFA 3QNJA 3LLLA 4HYBA 3D51A 4AZ5A 3M3WA 3DX2A 1GNTA 3BUBA 3VEAA 2ELBA 4KIKB 4EZVA 3HAJA 1R5EA 1SU6A 4UDXX 3B51X 2LXYA 2V0OA 3QNIA 4AVMA 1QWUA 3ABHA 2ZXQA 2YLLA 2KHOA 1TQSA 4JWIA 2C08A 1UPXA 3O3NB 3RV0A 1ZWWA 1O7DC 3VKHA 4IWQA 4JLCA 2OZNB 2YI9A 4JN4A 3QA8A 4AZGA 3DYTA 1ZYLA 4EZUA 3BVTA 3DX4A 3DX3A 4D8JA 1GNLA 4JNEA 2OW7A 3O3OB 5KBPA 2RAKA 4NPHA 4ATMA 4R5LA 1DKXA 3DDFA 1TQTA 1OA1A 4WPEA 2YKTA 2PMRA 2X3VA 1URUA 5FLEX 3HAIA 3BVVA 2ND0A 4IM0A 2JNKA 2NCZA 3HAHA 4BNEA 3L3OM 2X5CA 4JWEA 4EZXA 3SYVA 1TQVA 1DKYA 1MJGA 3RV1A 4IW0A 2QFFA 2RT6A 1QWNA 2Q12A 3Q0KA 4JWCA 4EZSA 1I4LA 1WDZA 1TQWA 3I01A 3RPMA 2YIBA 4R5JA 3QWEA 3KDRA 4M0MA 4AZCB 1U00A 2EWFA 2N3KA 4EZOA 3CZNA 2YIVX 2F7PA 3D4ZA 5C5BA 2F1BA 2JNSA 3EJTA 2F7OA 4NQIA 2OBLA 4EZTA 3BVWA 4R5GA 5C5BB 3CAZA 4E81A 4DYLA 1E2UA 4H8SA 3D4YA 4EZPA 3DDGA 1LQ7A 3CKDA 2GAFD 3T4AG 4I1QA 4IWPA 4AZBA 1GN9A 1TQUA 4F01A 2EFLA 3SOGA 5E84A 3KAVA 3B52X 3ER8C 3O3MB 3OWGA 2Z8YA 1OAOA 3EJSA 1R34A 3OK8A 1R33A 3BUIA 4EZRA 2D1LA 4E3CA 4EZWA 3FD9A 2O0I1 4AZIA 4B9QA 2FICA 4IM2A
chains in the Genus database with same CATH topology
2QKWA 1R5EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QKW A;  1R5E A; 
#chains in the Genus database with same CATH topology
 4H6H A;  5TKY A;  2LM0 A;  3CVR A;  3D50 A;  1OA0 A;  3B53 X;  4NSW A;  3DPQ A;  4F00 A;  3CV5 A;  3A98 A;  3UIT A;  4AZC A;  2F1A A;  3Q84 A;  1SU8 A;  4EZN A;  3T49 A;  1I4T A;  3BUD A;  3EJU A;  4IM3 A;  4EZY A;  4EZZ A;  3I2W A;  1I4D A;  2WYH A;  2YI8 A;  2RAI A;  4HY9 A;  3D52 A;  2F18 A;  4AKV A;  1X03 A;  2ALW A;  3ERC C;  4FZS A;  3PLT A;  3VEB A;  2WIN M;  2X3X A;  3GI7 A;  3BVU A;  2Z0V A;  1JQK A;  4UDY X;  3I39 X;  1I49 A;  4H6I A;  3DPP A;  3BUP A;  3EJQ A;  2YL8 A;  3T48 A;  3EJP A;  3BLB A;  2FYV A;  4AZ7 A;  2GA9 D;  3CZS A;  4G6Q A;  1YWM A;  1W9M A;  1SUF A;  4EZQ A;  2MI7 A;  3C7N A;  2ND1 A;  2Q13 A;  4WPC A;  4HR1 A;  4AZH A;  4DCN C;  2GF4 A;  2QKW A;  3T47 A;  3DX1 A;  3ZED A;  2YL9 A;  4FZP A;  4HR1 B;  2WYI A;  3EJR A;  4JWD A;  3LVT A;  4R5I A;  3L3P A;  3DX0 A;  1HWW A;  2OBM A;  2PY6 A;  4R5K A;  3ER9 B;  2Z0N A;  3QE6 A;  4FM3 A;  1SU7 A;  3KAW A;  3BVX A;  4FZO A;  4PO2 A;  1HTY A;  4JL9 A;  4IWO A;  3I04 A;  2YL5 A;  4AZ6 A;  2QXL A;  3F7W A;  1X04 A;  1O7D B;  3D2F A;  3DPO A;  5FIG A;  2F7R A;  4JNF A;  2D4C A;  1QX1 A;  1HXK A;  3T46 A;  1DKZ A;  2YLA A;  2OW6 A;  2F7Q A;  1E9V A;  2RAJ A;  3G9G A;  3D2E A;  2Z0O A;  2OO2 A;  3OHX M;  3BUQ A;  1E1D A;  2EFK A;  2YL6 A;  2EX3 B;  3ACO A;  2YIA A;  1Y2O A;  2X3W A;  4KIK A;  1PS3 A;  3LMF A;  3QNJ A;  3LLL A;  4HYB A;  3D51 A;  4AZ5 A;  3M3W A;  3DX2 A;  1GNT A;  3BUB A;  3VEA A;  2ELB A;  4KIK B;  4EZV A;  3HAJ A;  1R5E A;  1SU6 A;  4UDX X;  3B51 X;  2LXY A;  2V0O A;  3QNI A;  4AVM A;  1QWU A;  3ABH A;  2ZXQ A;  2YLL A;  2KHO A;  1TQS A;  4JWI A;  2C08 A;  1UPX A;  3O3N B;  3RV0 A;  1ZWW A;  1O7D C;  3VKH A;  4IWQ A;  4JLC A;  2OZN B;  2YI9 A;  4JN4 A;  3QA8 A;  4AZG A;  3DYT A;  1ZYL A;  4EZU A;  3BVT A;  3DX4 A;  3DX3 A;  4D8J A;  1GNL A;  4JNE A;  2OW7 A;  3O3O B;  5KBP A;  2RAK A;  4NPH A;  4ATM A;  4R5L A;  1DKX A;  3DDF A;  1TQT A;  1OA1 A;  4WPE A;  2YKT A;  2PMR A;  2X3V A;  1URU A;  5FLE X;  3HAI A;  3BVV A;  2ND0 A;  4IM0 A;  2JNK A;  2NCZ A;  3HAH A;  4BNE A;  3L3O M;  2X5C A;  4JWE A;  4EZX A;  3SYV A;  1TQV A;  1DKY A;  1MJG A;  3RV1 A;  4IW0 A;  2QFF A;  2RT6 A;  1QWN A;  2Q12 A;  3Q0K A;  4JWC A;  4EZS A;  1I4L A;  1WDZ A;  1TQW A;  3I01 A;  3RPM A;  2YIB A;  4R5J A;  3QWE A;  3KDR A;  4M0M A;  4AZC B;  1U00 A;  2EWF A;  2N3K A;  4EZO A;  3CZN A;  2YIV X;  2F7P A;  3D4Z A;  5C5B A;  2F1B A;  2JNS A;  3EJT A;  2F7O A;  4NQI A;  2OBL A;  4EZT A;  3BVW A;  4R5G A;  5C5B B;  3CAZ A;  4E81 A;  4DYL A;  1E2U A;  4H8S A;  3D4Y A;  4EZP A;  3DDG A;  1LQ7 A;  3CKD A;  2GAF D;  3T4A G;  4I1Q A;  4IWP A;  4AZB A;  1GN9 A;  1TQU A;  4F01 A;  2EFL A;  3SOG A;  5E84 A;  3KAV A;  3B52 X;  3ER8 C;  3O3M B;  3OWG A;  2Z8Y A;  1OAO A;  3EJS A;  1R34 A;  3OK8 A;  1R33 A;  3BUI A;  4EZR A;  2D1L A;  4E3C A;  4EZW A;  3FD9 A;  2O0I 1;  4AZI A;  4B9Q A;  2FIC A;  4IM2 A; 
#chains in the Genus database with same CATH homology
 2QKW A;  1R5E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...