2YKTA

Crystal structure of the i-bar domain of irsp53 (baiap2) in complex with an ehec derived tir peptide
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
231
structure length
225
Chain Sequence
SRSEEMHRLTENVYKTIMEQFNPSLRNFIAMGKNYEKALAGVTYAAKGYFDALVKMGELASESQGSKELGDVLFQMAEVHRQIQNQLEEMLKSFHNELLTQLEQKVELDSRYLSAALKKYQTEQRSKGDALDKCQAELKKLRKKPQKYSDKELQYIDAISNKQGELENYVSDGYKTALTEERRRFCFLVEKQCAVAKNSAAYHSKGKELLAQKLPLWQQACADPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords BRAIN-SPECIFIC ANGIOGENESIS INHIBITOR 1-ASSOCIATED PROTEIN 2
publication title Structural Basis for Complex Formation between Human Irsp53 and the Translocated Intimin Receptor Tir of Enterohemorrhagic E. Coli.
pubmed doi rcsb
source organism Homo sapiens
total genus 107
structure length 225
sequence length 231
ec nomenclature
pdb deposition date 2011-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08397 IMD IRSp53/MIM homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 2yktA00
3HAHA 2D4CA 2C08A 4DCNC 3QWEA 1I4LA 2Z0VA 3QNIA 4AKVA 3Q0KA 2Z0OA 4FZSA 2Q12A 3PLTA 3QE6A 4WPCA 3M3WA 5C5BA 4AVMA 3DYTA 2D1LA 4H8SA 4DYLA 1ZWWA 4NQIA 3Q84A 2Q13A 3I2WA 2RAIA 2RAJA 3HAJA 4BNEA 1WDZA 3LLLA 4I1QA 2X3WA 2X3XA 2X3VA 2RAKA 2YKTA 4NSWA 3G9GA 1I4DA 2Z0NA 3SOGA 3SYVA 1X04A 4ATMA 5C5BB 2ELBA 1Y2OA 3HAIA 2EFLA 1URUA 3ABHA 3ACOA 3CAZA 1X03A 3OK8A 2EFKA 2FICA 2V0OA 1I49A 1I4TA 4WPEA
chains in the Genus database with same CATH superfamily
3KAWA 3DDFA 4R5JA 1I4LA 4F01A 1OA0A 4AKVA 1GN9A 2EWFA 2Z0OA 3I04A 3EJSA 3T49A 4WPCA 4AZGA 1SU6A 3CZSA 4KIKB 3CKDA 4NQIA 3Q84A 2FYVA 3C7NA 2ZXQA 4I1QA 4EZVA 4M0MA 4PO2A 4ATMA 3BUQA 1Y2OA 3DX3A 3OK8A 4EZWA 2RT6A 2QXLA 1YWMA 1E2UA 1GNTA 2ALWA 2WYHA 4UDXX 1SUFA 3DPPA 4F00A 5FIGA 2YIVX 2PY6A 2EFLA 3I01A 2ND0A 2OBLA 3L3OM 3QE6A 4R5IA 3T4AG 2X5CA 4AZ7A 2D1LA 2YL5A 4EZUA 2Q13A 4EZRA 3EJQA 4EZTA 4HR1B 5E84A 2X3VA 3T46A 2YI8A 4HY9A 1R34A 2QFFA 3ACOA 3L3PA 4AZIA 4IM3A 4EZXA 3DX1A 3M3WA 3CZNA 4IWQA 3I2WA 2X3WA 1JQKA 1QWUA 3BUIA 1PS3A 2YL6A 1QWNA 3D51A 4IM0A 4JNEA 3EJPA 1DKZA 3VEBA 1HWWA 1WDZA 2YLLA 4EZQA 3DPOA 4EZYA 3D52A 2FICA 2WYIA 3D4YA 4HR1A 1U00A 3GI7A 1O7DC 3ERCC 1O7DB 3DDGA 3EJTA 3HAIA 2F7OA 3D4ZA 3HAHA 4E81A 1QX1A 4JLCA 5KBPA 2OW6A 3UITA 5C5BA 3OWGA 3ER9B 4D8JA 4IW0A 2ELBA 3ABHA 3LVTA 2EFKA 4JWIA 3D2EA 3T48A 2OO2A 3DX4A 4AZCB 4IWOA 3LLLA 2YLAA 1GNLA 3B53X 4R5GA 5FLEX 3DX2A 3SYVA 3EJRA 2GF4A 3I39X 1TQUA 4FZOA 4KIKA 4EZPA 4HYBA 2YL9A 2EX3B 3QWEA 3RPMA 3QNIA 1SU7A 3DYTA 4DYLA 3B52X 2MI7A 3BUDA 3G9GA 4AZ5A 1E9VA 3BUPA 4EZSA 1DKYA 2N3KA 3O3MB 4EZNA 4NPHA 4JWEA 3PLTA 2Z8YA 4JWDA 1ZWWA 5TKYA 2O0I1 4R5LA 3QA8A 1HXKA 1TQWA 1X04A 2WINM 1DKXA 1TQTA 3OHXM 2D4CA 2F1AA 3BVXA 4R5KA 4EZZA 4B9QA 2YL8A 3CVRA 2OZNB 3EJUA 1R5EA 2RAJA 2JNSA 3VKHA 4UDYX 3VEAA 4JL9A 1URUA 3CAZA 1X03A 2F7QA 2OBMA 4WPEA 1E1DA 3BUBA 4G6QA 4DCNC 4AZHA 2Z0VA 2OW7A 3ER8C 1TQSA 3LMFA 3D50A 1OAOA 2GAFD 4JNFA 2X3XA 2RAKA 3F7WA 1HTYA 2JNKA 2QKWA 1OA1A 4FZSA 4JWCA 3KDRA 3O3OB 3T47A 3DPQA 4H8SA 4AZBA 1R33A 2LXYA 3D2FA 4NSWA 3ZEDA 3BVWA 3SOGA 3B51X 2C08A 3O3NB 2F7PA 3Q0KA 1TQVA 2Q12A 3BVTA 2Z0NA 4H6IA 4H6HA 2YIBA 2F1BA 3CV5A 3A98A 1I4TA 4E3CA 1MJGA 2KHOA 3RV1A 1W9MA 4IM2A 3BVUA 3BLBA 4IWPA 4AZ6A 2RAIA 3BVVA 3DX0A 5C5BB 3RV0A 2F7RA 4AZCA 1I49A 1ZYLA 4FM3A 2GA9D 3KAVA 3QNJA 1LQ7A 3FD9A 4AVMA 4EZOA 2F18A 4FZPA 3HAJA 4BNEA 2PMRA 4JN4A 2YKTA 1I4DA 1UPXA 1SU8A 2ND1A 2YIAA 2NCZA 2YI9A 2V0OA 2LM0A
chains in the Genus database with same CATH topology
3HAHA 2D4CA 2C08A 4DCNC 3QWEA 1I4LA 2Z0VA 3QNIA 4AKVA 3Q0KA 2Z0OA 4FZSA 2Q12A 3PLTA 3QE6A 4WPCA 3M3WA 5C5BA 4AVMA 3DYTA 2D1LA 4H8SA 4DYLA 1ZWWA 4NQIA 3Q84A 2Q13A 3I2WA 2RAIA 2RAJA 3HAJA 4BNEA 1WDZA 3LLLA 4I1QA 2X3WA 2X3XA 2X3VA 2RAKA 2YKTA 4NSWA 3G9GA 1I4DA 2Z0NA 3SOGA 3SYVA 1X04A 4ATMA 5C5BB 2ELBA 1Y2OA 3HAIA 2EFLA 1URUA 3ABHA 3ACOA 3CAZA 1X03A 3OK8A 2EFKA 2FICA 2V0OA 1I49A 1I4TA 4WPEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HAH A;  2D4C A;  2C08 A;  4DCN C;  3QWE A;  1I4L A;  2Z0V A;  3QNI A;  4AKV A;  3Q0K A;  2Z0O A;  4FZS A;  2Q12 A;  3PLT A;  3QE6 A;  4WPC A;  3M3W A;  5C5B A;  4AVM A;  3DYT A;  2D1L A;  4H8S A;  4DYL A;  1ZWW A;  4NQI A;  3Q84 A;  2Q13 A;  3I2W A;  2RAI A;  2RAJ A;  3HAJ A;  4BNE A;  1WDZ A;  3LLL A;  4I1Q A;  2X3W A;  2X3X A;  2X3V A;  2RAK A;  2YKT A;  4NSW A;  3G9G A;  1I4D A;  2Z0N A;  3SOG A;  3SYV A;  1X04 A;  4ATM A;  5C5B B;  2ELB A;  1Y2O A;  3HAI A;  2EFL A;  1URU A;  3ABH A;  3ACO A;  3CAZ A;  1X03 A;  3OK8 A;  2EFK A;  2FIC A;  2V0O A;  1I49 A;  1I4T A;  4WPE A; 
#chains in the Genus database with same CATH topology
 3KAW A;  3DDF A;  4R5J A;  1I4L A;  4F01 A;  1OA0 A;  4AKV A;  1GN9 A;  2EWF A;  2Z0O A;  3I04 A;  3EJS A;  3T49 A;  4WPC A;  4AZG A;  1SU6 A;  3CZS A;  4KIK B;  3CKD A;  4NQI A;  3Q84 A;  2FYV A;  3C7N A;  2ZXQ A;  4I1Q A;  4EZV A;  4M0M A;  4PO2 A;  4ATM A;  3BUQ A;  1Y2O A;  3DX3 A;  3OK8 A;  4EZW A;  2RT6 A;  2QXL A;  1YWM A;  1E2U A;  1GNT A;  2ALW A;  2WYH A;  4UDX X;  1SUF A;  3DPP A;  4F00 A;  5FIG A;  2YIV X;  2PY6 A;  2EFL A;  3I01 A;  2ND0 A;  2OBL A;  3L3O M;  3QE6 A;  4R5I A;  3T4A G;  2X5C A;  4AZ7 A;  2D1L A;  2YL5 A;  4EZU A;  2Q13 A;  4EZR A;  3EJQ A;  4EZT A;  4HR1 B;  5E84 A;  2X3V A;  3T46 A;  2YI8 A;  4HY9 A;  1R34 A;  2QFF A;  3ACO A;  3L3P A;  4AZI A;  4IM3 A;  4EZX A;  3DX1 A;  3M3W A;  3CZN A;  4IWQ A;  3I2W A;  2X3W A;  1JQK A;  1QWU A;  3BUI A;  1PS3 A;  2YL6 A;  1QWN A;  3D51 A;  4IM0 A;  4JNE A;  3EJP A;  1DKZ A;  3VEB A;  1HWW A;  1WDZ A;  2YLL A;  4EZQ A;  3DPO A;  4EZY A;  3D52 A;  2FIC A;  2WYI A;  3D4Y A;  4HR1 A;  1U00 A;  3GI7 A;  1O7D C;  3ERC C;  1O7D B;  3DDG A;  3EJT A;  3HAI A;  2F7O A;  3D4Z A;  3HAH A;  4E81 A;  1QX1 A;  4JLC A;  5KBP A;  2OW6 A;  3UIT A;  5C5B A;  3OWG A;  3ER9 B;  4D8J A;  4IW0 A;  2ELB A;  3ABH A;  3LVT A;  2EFK A;  4JWI A;  3D2E A;  3T48 A;  2OO2 A;  3DX4 A;  4AZC B;  4IWO A;  3LLL A;  2YLA A;  1GNL A;  3B53 X;  4R5G A;  5FLE X;  3DX2 A;  3SYV A;  3EJR A;  2GF4 A;  3I39 X;  1TQU A;  4FZO A;  4KIK A;  4EZP A;  4HYB A;  2YL9 A;  2EX3 B;  3QWE A;  3RPM A;  3QNI A;  1SU7 A;  3DYT A;  4DYL A;  3B52 X;  2MI7 A;  3BUD A;  3G9G A;  4AZ5 A;  1E9V A;  3BUP A;  4EZS A;  1DKY A;  2N3K A;  3O3M B;  4EZN A;  4NPH A;  4JWE A;  3PLT A;  2Z8Y A;  4JWD A;  1ZWW A;  5TKY A;  2O0I 1;  4R5L A;  3QA8 A;  1HXK A;  1TQW A;  1X04 A;  2WIN M;  1DKX A;  1TQT A;  3OHX M;  2D4C A;  2F1A A;  3BVX A;  4R5K A;  4EZZ A;  4B9Q A;  2YL8 A;  3CVR A;  2OZN B;  3EJU A;  1R5E A;  2RAJ A;  2JNS A;  3VKH A;  4UDY X;  3VEA A;  4JL9 A;  1URU A;  3CAZ A;  1X03 A;  2F7Q A;  2OBM A;  4WPE A;  1E1D A;  3BUB A;  4G6Q A;  4DCN C;  4AZH A;  2Z0V A;  2OW7 A;  3ER8 C;  1TQS A;  3LMF A;  3D50 A;  1OAO A;  2GAF D;  4JNF A;  2X3X A;  2RAK A;  3F7W A;  1HTY A;  2JNK A;  2QKW A;  1OA1 A;  4FZS A;  4JWC A;  3KDR A;  3O3O B;  3T47 A;  3DPQ A;  4H8S A;  4AZB A;  1R33 A;  2LXY A;  3D2F A;  4NSW A;  3ZED A;  3BVW A;  3SOG A;  3B51 X;  2C08 A;  3O3N B;  2F7P A;  3Q0K A;  1TQV A;  2Q12 A;  3BVT A;  2Z0N A;  4H6I A;  4H6H A;  2YIB A;  2F1B A;  3CV5 A;  3A98 A;  1I4T A;  4E3C A;  1MJG A;  2KHO A;  3RV1 A;  1W9M A;  4IM2 A;  3BVU A;  3BLB A;  4IWP A;  4AZ6 A;  2RAI A;  3BVV A;  3DX0 A;  5C5B B;  3RV0 A;  2F7R A;  4AZC A;  1I49 A;  1ZYL A;  4FM3 A;  2GA9 D;  3KAV A;  3QNJ A;  1LQ7 A;  3FD9 A;  4AVM A;  4EZO A;  2F18 A;  4FZP A;  3HAJ A;  4BNE A;  2PMR A;  4JN4 A;  2YKT A;  1I4D A;  1UPX A;  1SU8 A;  2ND1 A;  2YIA A;  2NCZ A;  2YI9 A;  2V0O A;  2LM0 A; 
#chains in the Genus database with same CATH homology
 3HAH A;  2D4C A;  2C08 A;  4DCN C;  3QWE A;  1I4L A;  2Z0V A;  3QNI A;  4AKV A;  3Q0K A;  2Z0O A;  4FZS A;  2Q12 A;  3PLT A;  3QE6 A;  4WPC A;  3M3W A;  5C5B A;  4AVM A;  3DYT A;  2D1L A;  4H8S A;  4DYL A;  1ZWW A;  4NQI A;  3Q84 A;  2Q13 A;  3I2W A;  2RAI A;  2RAJ A;  3HAJ A;  4BNE A;  1WDZ A;  3LLL A;  4I1Q A;  2X3W A;  2X3X A;  2X3V A;  2RAK A;  2YKT A;  4NSW A;  3G9G A;  1I4D A;  2Z0N A;  3SOG A;  3SYV A;  1X04 A;  4ATM A;  5C5B B;  2ELB A;  1Y2O A;  3HAI A;  2EFL A;  1URU A;  3ABH A;  3ACO A;  3CAZ A;  1X03 A;  3OK8 A;  2EFK A;  2FIC A;  2V0O A;  1I49 A;  1I4T A;  4WPE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...