2YKTA

Crystal structure of the i-bar domain of irsp53 (baiap2) in complex with an ehec derived tir peptide
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
231
structure length
225
Chain Sequence
b'SRSEEMHRLTENVYKTIMEQFNPSLRNFIAMGKNYEKALAGVTYAAKGYFDALVKMGELASESQGSKELGDVLFQMAEVHRQIQNQLEEMLKSFHNELLTQLEQKVELDSRYLSAALKKYQTEQRSKGDALDKCQAELKKLRKKPQKYSDKELQYIDAISNKQGELENYVSDGYKTALTEERRRFCFLVEKQCAVAKNSAAYHSKGKELLAQKLPLWQQACADPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BRAIN-SPECIFIC ANGIOGENESIS INHIBITOR 1-ASSOCIATED PROTEIN 2
publication title Structural Basis for Complex Formation between Human Irsp53 and the Translocated Intimin Receptor Tir of Enterohemorrhagic E. Coli.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 107
structure length 225
sequence length 231
ec nomenclature
pdb deposition date 2011-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08397 IMD IRSp53/MIM homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 2yktA00
3M3WA 2RAKA 1X03A 2V0OA 4FZSA 2EFKA 4AVMA 4WPCA 2ELBA 4NSWA 3HAHA 2FICA 3PLTA 2X3VA 3SOGA 1I4LA 3HAJA 2RAJA 2YKTA 3LLLA 4NQIA 3SYVA 5C5BB 3Q84A 1WDZA 2D1LA 4ATMA 4H8SA 3QE6A 4BNEA 3G9GA 2X3WA 5C5BA 2RAIA 1URUA 3ACOA 3CAZA 3QWEA 1Y2OA 3ABHA 4DCNC 2Q12A 1I4DA 1ZWWA 3Q0KA 2D4CA 2Q13A 2Z0OA 3DYTA 2EFLA 3QNIA 1I4TA 4AKVA 1X04A 4WPEA 2X3XA 3HAIA 3I2WA 2C08A 4DYLA 2Z0VA 2Z0NA 3OK8A 4I1QA 1I49A
chains in the Genus database with same CATH superfamily
3VEBA 3CKDA 3L3PA 2EFKA 3LVTA 4M0MA 3ER9B 4JNEA 5C5BB 4D8JA 4HYBA 1DKYA 2RAIA 1W9MA 1TQWA 4R5JA 1OA1A 4FZOA 2LM0A 4EZTA 3VKHA 4EZQA 3QNJA 3OHXM 2PY6A 4B9QA 1TQUA 1GNTA 4KIKA 4EZYA 3D4ZA 4ATMA 4UDXX 2YIVX 4JWDA 3DYTA 3QNIA 3EJRA 4F01A 1OA0A 3BUQA 2OBMA 4R5IA 4PO2A 2F1BA 4HR1A 3I01A 3O3MB 5E84A 3DX2A 3BVUA 2QXLA 1SU6A 1GNLA 2F7QA 2OBLA 2O0I1 3A98A 4JLCA 1PS3A 2NCZA 1MJGA 4UDYX 2EFLA 1HWWA 3T47A 1DKZA 3BUBA 2OZNB 1SU7A 1R33A 3M3WA 4EZVA 2V0OA 4KIKB 3SOGA 4H6IA 2ND0A 4FZPA 2X5CA 3EJPA 4EZNA 2FYVA 4AZ7A 3FD9A 2Q13A 3EJSA 4HR1B 3BVVA 4IM2A 4I1QA 1O7DC 3D2FA 3HAHA 4IWPA 3VEAA 3T4AG 2PMRA 1E9VA 4R5GA 4FM3A 1R34A 3OWGA 4NQIA 3ZEDA 1R5EA 2YLLA 1SU8A 3DPOA 3DX0A 3D51A 1HTYA 1SUFA 2YI8A 3C7NA 5FLEX 3EJUA 1I4DA 4EZOA 1X04A 3T46A 1X03A 4FZSA 1HXKA 2OW7A 3RV0A 4R5KA 2JNKA 2F7RA 3DPPA 4JL9A 2GAFD 1O7DB 3GI7A 1E1DA 1Y2OA 3DPQA 3I39X 3CVRA 3UITA 2C08A 2Z0NA 2F7OA 3BUDA 2EX3B 4IW0A 2F7PA 2OO2A 1E2UA 3O3OB 3Q84A 2Z8YA 3QE6A 3B53X 1I4TA 4EZSA 3BUPA 3I04A 3CV5A 3B52X 3PLTA 2JNSA 3HAJA 4JWCA 3LLLA 2ND1A 2MI7A 4EZUA 2D1LA 2QKWA 3LMFA 3ACOA 2D4CA 4H6HA 4AZHA 3RPMA 2RAKA 3B51X 3L3OM 2YIAA 2ELBA 2YKTA 3CZNA 4BNEA 2EWFA 4IWOA 5FIGA 3DX3A 3D50A 4F00A 3EJTA 1URUA 3QA8A 4G6QA 2YL6A 2YL8A 3ABHA 3QWEA 5KBPA 1ZWWA 5TKYA 1TQVA 2Z0VA 2F18A 4JWIA 1TQSA 4AVMA 3DX4A 2WINM 2RAJA 2YL9A 1GN9A 1WDZA 1QX1A 3D2EA 3DDGA 3RV1A 3Q0KA 4AZ5A 3BVXA 3F7WA 2YL5A 4EZWA 1I4LA 1JQKA 2RT6A 4EZRA 4EZXA 1ZYLA 3DX1A 3BVTA 4AZ6A 2X3XA 3CZSA 2GF4A 4AZBA 2OW6A 3DDFA 3ERCC 2LXYA 4JNFA 1UPXA 2X3VA 2KHOA 4NPHA 1QWNA 1U00A 4H8SA 4E81A 4DCNC 3O3NB 3T48A 2Z0OA 3D4YA 1YWMA 1LQ7A 2ZXQA 4E3CA 4NSWA 2FICA 3ER8C 3SYVA 2YLAA 2X3WA 4IM0A 4AZCA 4JWEA 4EZZA 2F1AA 2WYHA 2GA9D 1I49A 3BVWA 2QFFA 4WPCA 2N3KA 2ALWA 4IM3A 4HY9A 2YIBA 3G9GA 3BUIA 5C5BA 3EJQA 3KAVA 3CAZA 3D52A 3T49A 2Q12A 1DKXA 4WPEA 3KAWA 3HAIA 3I2WA 1QWUA 3OK8A 4EZPA 4AZGA 4IWQA 4JN4A 1OAOA 4R5LA 3KDRA 4AZCB 3BLBA 1TQTA 4AZIA 4AKVA 2WYIA 2YI9A 4DYLA
chains in the Genus database with same CATH topology
3M3WA 2RAKA 1X03A 2V0OA 4FZSA 2EFKA 4AVMA 4WPCA 2ELBA 4NSWA 3HAHA 2FICA 3PLTA 2X3VA 3SOGA 1I4LA 3HAJA 2RAJA 2YKTA 3LLLA 4NQIA 3SYVA 5C5BB 3Q84A 1WDZA 2D1LA 4ATMA 4H8SA 3QE6A 4BNEA 3G9GA 2X3WA 5C5BA 2RAIA 1URUA 3ACOA 3CAZA 3QWEA 1Y2OA 3ABHA 4DCNC 2Q12A 1I4DA 1ZWWA 3Q0KA 2D4CA 2Q13A 2Z0OA 3DYTA 2EFLA 3QNIA 1I4TA 4AKVA 1X04A 4WPEA 2X3XA 3HAIA 3I2WA 2C08A 4DYLA 2Z0VA 2Z0NA 3OK8A 4I1QA 1I49A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M3W A;  2RAK A;  1X03 A;  2V0O A;  4FZS A;  2EFK A;  4AVM A;  4WPC A;  2ELB A;  4NSW A;  3HAH A;  2FIC A;  3PLT A;  2X3V A;  3SOG A;  1I4L A;  3HAJ A;  2RAJ A;  2YKT A;  3LLL A;  4NQI A;  3SYV A;  5C5B B;  3Q84 A;  1WDZ A;  2D1L A;  4ATM A;  4H8S A;  3QE6 A;  4BNE A;  3G9G A;  2X3W A;  5C5B A;  2RAI A;  1URU A;  3ACO A;  3CAZ A;  3QWE A;  1Y2O A;  3ABH A;  4DCN C;  2Q12 A;  1I4D A;  1ZWW A;  3Q0K A;  2D4C A;  2Q13 A;  2Z0O A;  3DYT A;  2EFL A;  3QNI A;  1I4T A;  4AKV A;  1X04 A;  4WPE A;  2X3X A;  3HAI A;  3I2W A;  2C08 A;  4DYL A;  2Z0V A;  2Z0N A;  3OK8 A;  4I1Q A;  1I49 A; 
#chains in the Genus database with same CATH topology
 3VEB A;  3CKD A;  3L3P A;  2EFK A;  3LVT A;  4M0M A;  3ER9 B;  4JNE A;  5C5B B;  4D8J A;  4HYB A;  1DKY A;  2RAI A;  1W9M A;  1TQW A;  4R5J A;  1OA1 A;  4FZO A;  2LM0 A;  4EZT A;  3VKH A;  4EZQ A;  3QNJ A;  3OHX M;  2PY6 A;  4B9Q A;  1TQU A;  1GNT A;  4KIK A;  4EZY A;  3D4Z A;  4ATM A;  4UDX X;  2YIV X;  4JWD A;  3DYT A;  3QNI A;  3EJR A;  4F01 A;  1OA0 A;  3BUQ A;  2OBM A;  4R5I A;  4PO2 A;  2F1B A;  4HR1 A;  3I01 A;  3O3M B;  5E84 A;  3DX2 A;  3BVU A;  2QXL A;  1SU6 A;  1GNL A;  2F7Q A;  2OBL A;  2O0I 1;  3A98 A;  4JLC A;  1PS3 A;  2NCZ A;  1MJG A;  4UDY X;  2EFL A;  1HWW A;  3T47 A;  1DKZ A;  3BUB A;  2OZN B;  1SU7 A;  1R33 A;  3M3W A;  4EZV A;  2V0O A;  4KIK B;  3SOG A;  4H6I A;  2ND0 A;  4FZP A;  2X5C A;  3EJP A;  4EZN A;  2FYV A;  4AZ7 A;  3FD9 A;  2Q13 A;  3EJS A;  4HR1 B;  3BVV A;  4IM2 A;  4I1Q A;  1O7D C;  3D2F A;  3HAH A;  4IWP A;  3VEA A;  3T4A G;  2PMR A;  1E9V A;  4R5G A;  4FM3 A;  1R34 A;  3OWG A;  4NQI A;  3ZED A;  1R5E A;  2YLL A;  1SU8 A;  3DPO A;  3DX0 A;  3D51 A;  1HTY A;  1SUF A;  2YI8 A;  3C7N A;  5FLE X;  3EJU A;  1I4D A;  4EZO A;  1X04 A;  3T46 A;  1X03 A;  4FZS A;  1HXK A;  2OW7 A;  3RV0 A;  4R5K A;  2JNK A;  2F7R A;  3DPP A;  4JL9 A;  2GAF D;  1O7D B;  3GI7 A;  1E1D A;  1Y2O A;  3DPQ A;  3I39 X;  3CVR A;  3UIT A;  2C08 A;  2Z0N A;  2F7O A;  3BUD A;  2EX3 B;  4IW0 A;  2F7P A;  2OO2 A;  1E2U A;  3O3O B;  3Q84 A;  2Z8Y A;  3QE6 A;  3B53 X;  1I4T A;  4EZS A;  3BUP A;  3I04 A;  3CV5 A;  3B52 X;  3PLT A;  2JNS A;  3HAJ A;  4JWC A;  3LLL A;  2ND1 A;  2MI7 A;  4EZU A;  2D1L A;  2QKW A;  3LMF A;  3ACO A;  2D4C A;  4H6H A;  4AZH A;  3RPM A;  2RAK A;  3B51 X;  3L3O M;  2YIA A;  2ELB A;  2YKT A;  3CZN A;  4BNE A;  2EWF A;  4IWO A;  5FIG A;  3DX3 A;  3D50 A;  4F00 A;  3EJT A;  1URU A;  3QA8 A;  4G6Q A;  2YL6 A;  2YL8 A;  3ABH A;  3QWE A;  5KBP A;  1ZWW A;  5TKY A;  1TQV A;  2Z0V A;  2F18 A;  4JWI A;  1TQS A;  4AVM A;  3DX4 A;  2WIN M;  2RAJ A;  2YL9 A;  1GN9 A;  1WDZ A;  1QX1 A;  3D2E A;  3DDG A;  3RV1 A;  3Q0K A;  4AZ5 A;  3BVX A;  3F7W A;  2YL5 A;  4EZW A;  1I4L A;  1JQK A;  2RT6 A;  4EZR A;  4EZX A;  1ZYL A;  3DX1 A;  3BVT A;  4AZ6 A;  2X3X A;  3CZS A;  2GF4 A;  4AZB A;  2OW6 A;  3DDF A;  3ERC C;  2LXY A;  4JNF A;  1UPX A;  2X3V A;  2KHO A;  4NPH A;  1QWN A;  1U00 A;  4H8S A;  4E81 A;  4DCN C;  3O3N B;  3T48 A;  2Z0O A;  3D4Y A;  1YWM A;  1LQ7 A;  2ZXQ A;  4E3C A;  4NSW A;  2FIC A;  3ER8 C;  3SYV A;  2YLA A;  2X3W A;  4IM0 A;  4AZC A;  4JWE A;  4EZZ A;  2F1A A;  2WYH A;  2GA9 D;  1I49 A;  3BVW A;  2QFF A;  4WPC A;  2N3K A;  2ALW A;  4IM3 A;  4HY9 A;  2YIB A;  3G9G A;  3BUI A;  5C5B A;  3EJQ A;  3KAV A;  3CAZ A;  3D52 A;  3T49 A;  2Q12 A;  1DKX A;  4WPE A;  3KAW A;  3HAI A;  3I2W A;  1QWU A;  3OK8 A;  4EZP A;  4AZG A;  4IWQ A;  4JN4 A;  1OAO A;  4R5L A;  3KDR A;  4AZC B;  3BLB A;  1TQT A;  4AZI A;  4AKV A;  2WYI A;  2YI9 A;  4DYL A; 
#chains in the Genus database with same CATH homology
 3M3W A;  2RAK A;  1X03 A;  2V0O A;  4FZS A;  2EFK A;  4AVM A;  4WPC A;  2ELB A;  4NSW A;  3HAH A;  2FIC A;  3PLT A;  2X3V A;  3SOG A;  1I4L A;  3HAJ A;  2RAJ A;  2YKT A;  3LLL A;  4NQI A;  3SYV A;  5C5B B;  3Q84 A;  1WDZ A;  2D1L A;  4ATM A;  4H8S A;  3QE6 A;  4BNE A;  3G9G A;  2X3W A;  5C5B A;  2RAI A;  1URU A;  3ACO A;  3CAZ A;  3QWE A;  1Y2O A;  3ABH A;  4DCN C;  2Q12 A;  1I4D A;  1ZWW A;  3Q0K A;  2D4C A;  2Q13 A;  2Z0O A;  3DYT A;  2EFL A;  3QNI A;  1I4T A;  4AKV A;  1X04 A;  4WPE A;  2X3X A;  3HAI A;  3I2W A;  2C08 A;  4DYL A;  2Z0V A;  2Z0N A;  3OK8 A;  4I1Q A;  1I49 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...