2YKTA

Crystal structure of the i-bar domain of irsp53 (baiap2) in complex with an ehec derived tir peptide
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
231
structure length
225
Chain Sequence
SRSEEMHRLTENVYKTIMEQFNPSLRNFIAMGKNYEKALAGVTYAAKGYFDALVKMGELASESQGSKELGDVLFQMAEVHRQIQNQLEEMLKSFHNELLTQLEQKVELDSRYLSAALKKYQTEQRSKGDALDKCQAELKKLRKKPQKYSDKELQYIDAISNKQGELENYVSDGYKTALTEERRRFCFLVEKQCAVAKNSAAYHSKGKELLAQKLPLWQQACADPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BRAIN-SPECIFIC ANGIOGENESIS INHIBITOR 1-ASSOCIATED PROTEIN 2
publication title Structural Basis for Complex Formation between Human Irsp53 and the Translocated Intimin Receptor Tir of Enterohemorrhagic E. Coli.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 107
structure length 225
sequence length 231
ec nomenclature
pdb deposition date 2011-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08397 IMD IRSp53/MIM homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 2yktA00
2RAKA 4FZSA 3ACOA 1X04A 4AVMA 3M3WA 2YKTA 2X3VA 1URUA 1I4TA 1X03A 1ZWWA 3PLTA 2Z0NA 4H8SA 2X3WA 3LLLA 4BNEA 2EFLA 3HAJA 2C08A 5C5BB 2EFKA 4WPEA 2RAIA 3SOGA 2FICA 2Z0VA 3SYVA 5C5BA 2V0OA 3HAIA 3OK8A 3CAZA 1I4DA 1Y2OA 2Q12A 4DCNC 2D4CA 2ELBA 4WPCA 4I1QA 4ATMA 3Q84A 1WDZA 2D1LA 3ABHA 1I49A 4NSWA 4DYLA 2RAJA 2X3XA 3I2WA 3G9GA 3HAHA 3QNIA 2Z0OA 3QE6A 1I4LA 4NQIA 3QWEA 3Q0KA 4AKVA 3DYTA 2Q13A
chains in the Genus database with same CATH superfamily
1MJGA 2YKTA 4H6IA 2C08A 4EZPA 2LXYA 1R34A 2WYIA 4IWQA 3I39X 1TQVA 2QKWA 4DYLA 3QNIA 4AZ6A 3QA8A 4H8SA 3B51X 4JL9A 3EJUA 4PO2A 3DX1A 4AZBA 2ND0A 2QXLA 4R5GA 4WPCA 3F7WA 2RAJA 4E81A 1TQSA 3EJTA 3BVXA 1OA1A 1R5EA 3PLTA 3RPMA 3BUPA 1HWWA 4HR1B 1ZYLA 4IM2A 4JWDA 4HR1A 3B53X 2D4CA 3DX2A 1PS3A 2WINM 1GN9A 1OA0A 2OBLA 4JWCA 3D4YA 4EZOA 4AZGA 5FIGA 3VEAA 3DX0A 2YL6A 4AZCB 3HAJA 3DX3A 4WPEA 3B52X 2F7OA 4G6QA 5KBPA 2X5CA 4DCNC 4ATMA 3EJRA 4EZQA 1DKZA 2N3KA 2YIAA 4AZHA 3QWEA 4JNFA 3BVTA 4AKVA 3DYTA 1X04A 2F7QA 2EFKA 1QWNA 3BLBA 2F7RA 2YI9A 3HAIA 2KHOA 3CAZA 1I4DA 3CZNA 2D1LA 5TKYA 1HTYA 3D50A 2JNKA 1I4LA 1E2UA 3DDFA 3KAVA 4HY9A 3OWGA 3D4ZA 1JQKA 4BNEA 4FM3A 4UDXX 2NCZA 2YI8A 4FZPA 1WDZA 1E1DA 1LQ7A 1SUFA 3ABHA 4E3CA 3G9GA 3ZEDA 3Q0KA 2OZNB 1HXKA 3ACOA 3A98A 3BUQA 2X3WA 3LLLA 2YL8A 2OW7A 2FICA 2Z0VA 3BUBA 3BVVA 1R33A 3CV5A 2F18A 4R5LA 1GNLA 3BUDA 3D2EA 2RAKA 4AVMA 1ZWWA 3EJSA 2RAIA 2GAFD 3UITA 3CVRA 4UDYX 2F1BA 3KAWA 4AZ5A 3O3MB 3VKHA 3I01A 3LVTA 3FD9A 2ALWA 3RV0A 3DPOA 3OHXM 3L3OM 3SYVA 4EZXA 4M0MA 4AZCA 1Y2OA 1QX1A 1OAOA 2WYHA 3I2WA 4D8JA 4IWPA 2PY6A 3O3OB 2EWFA 3D2FA 1U00A 3M3WA 3EJQA 3C7NA 4JNEA 4EZUA 4EZTA 2Q12A 4IM0A 4NQIA 3O3NB 3QNJA 2ZXQA 4EZSA 4FZSA 3D52A 1X03A 3T49A 1O7DB 4F01A 2QFFA 2PMRA 3ER9B 4F00A 3HAHA 3ERCC 2GF4A 2O0I1 2GA9D 2LM0A 2EX3B 3I04A 5E84A 1SU7A 1W9MA 2ND1A 2YL5A 4EZVA 2V0OA 1TQWA 4R5JA 4I1QA 3BVUA 1I49A 4EZRA 3KDRA 2X3XA 4B9QA 1QWUA 3CZSA 3QE6A 2F7PA 4JWIA 2JNSA 4JWEA 3DPQA 2OBMA 2X3VA 3GI7A 2YL9A 5C5BB 2F1AA 3SOGA 1UPXA 5C5BA 4EZNA 4H6HA 2YLLA 3L3PA 3LMFA 4IW0A 2FYVA 4EZZA 3D51A 3T48A 1O7DC 2OO2A 4NPHA 3CKDA 4KIKB 1URUA 4KIKA 1SU6A 1DKYA 3DDGA 4HYBA 3BVWA 3DX4A 3OK8A 2RT6A 2ELBA 3T47A 4R5IA 2YIVX 3T46A 5FLEX 2MI7A 2Q13A 2YIBA 3BUIA 4EZYA 3DPPA 2EFLA 3EJPA 4AZIA 1YWMA 1E9VA 1SU8A 2OW6A 1TQTA 1DKXA 4EZWA 3RV1A 4FZOA 2Z0OA 1TQUA 4JN4A 4R5KA 4AZ7A 1I4TA 1GNTA 2Z0NA 2YLAA 3VEBA 4IWOA 3ER8C 3T4AG 3Q84A 4NSWA 4IM3A 4JLCA 2Z8YA
chains in the Genus database with same CATH topology
2RAKA 4FZSA 3ACOA 1X04A 4AVMA 3M3WA 2YKTA 2X3VA 1URUA 1I4TA 1X03A 1ZWWA 3PLTA 2Z0NA 4H8SA 2X3WA 3LLLA 4BNEA 2EFLA 3HAJA 2C08A 5C5BB 2EFKA 4WPEA 2RAIA 3SOGA 2FICA 2Z0VA 3SYVA 5C5BA 2V0OA 3HAIA 3OK8A 3CAZA 1I4DA 1Y2OA 2Q12A 4DCNC 2D4CA 2ELBA 4WPCA 4I1QA 4ATMA 3Q84A 1WDZA 2D1LA 3ABHA 1I49A 4NSWA 4DYLA 2RAJA 2X3XA 3I2WA 3G9GA 3HAHA 3QNIA 2Z0OA 3QE6A 1I4LA 4NQIA 3QWEA 3Q0KA 4AKVA 3DYTA 2Q13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RAK A;  4FZS A;  3ACO A;  1X04 A;  4AVM A;  3M3W A;  2YKT A;  2X3V A;  1URU A;  1I4T A;  1X03 A;  1ZWW A;  3PLT A;  2Z0N A;  4H8S A;  2X3W A;  3LLL A;  4BNE A;  2EFL A;  3HAJ A;  2C08 A;  5C5B B;  2EFK A;  4WPE A;  2RAI A;  3SOG A;  2FIC A;  2Z0V A;  3SYV A;  5C5B A;  2V0O A;  3HAI A;  3OK8 A;  3CAZ A;  1I4D A;  1Y2O A;  2Q12 A;  4DCN C;  2D4C A;  2ELB A;  4WPC A;  4I1Q A;  4ATM A;  3Q84 A;  1WDZ A;  2D1L A;  3ABH A;  1I49 A;  4NSW A;  4DYL A;  2RAJ A;  2X3X A;  3I2W A;  3G9G A;  3HAH A;  3QNI A;  2Z0O A;  3QE6 A;  1I4L A;  4NQI A;  3QWE A;  3Q0K A;  4AKV A;  3DYT A;  2Q13 A; 
#chains in the Genus database with same CATH topology
 1MJG A;  2YKT A;  4H6I A;  2C08 A;  4EZP A;  2LXY A;  1R34 A;  2WYI A;  4IWQ A;  3I39 X;  1TQV A;  2QKW A;  4DYL A;  3QNI A;  4AZ6 A;  3QA8 A;  4H8S A;  3B51 X;  4JL9 A;  3EJU A;  4PO2 A;  3DX1 A;  4AZB A;  2ND0 A;  2QXL A;  4R5G A;  4WPC A;  3F7W A;  2RAJ A;  4E81 A;  1TQS A;  3EJT A;  3BVX A;  1OA1 A;  1R5E A;  3PLT A;  3RPM A;  3BUP A;  1HWW A;  4HR1 B;  1ZYL A;  4IM2 A;  4JWD A;  4HR1 A;  3B53 X;  2D4C A;  3DX2 A;  1PS3 A;  2WIN M;  1GN9 A;  1OA0 A;  2OBL A;  4JWC A;  3D4Y A;  4EZO A;  4AZG A;  5FIG A;  3VEA A;  3DX0 A;  2YL6 A;  4AZC B;  3HAJ A;  3DX3 A;  4WPE A;  3B52 X;  2F7O A;  4G6Q A;  5KBP A;  2X5C A;  4DCN C;  4ATM A;  3EJR A;  4EZQ A;  1DKZ A;  2N3K A;  2YIA A;  4AZH A;  3QWE A;  4JNF A;  3BVT A;  4AKV A;  3DYT A;  1X04 A;  2F7Q A;  2EFK A;  1QWN A;  3BLB A;  2F7R A;  2YI9 A;  3HAI A;  2KHO A;  3CAZ A;  1I4D A;  3CZN A;  2D1L A;  5TKY A;  1HTY A;  3D50 A;  2JNK A;  1I4L A;  1E2U A;  3DDF A;  3KAV A;  4HY9 A;  3OWG A;  3D4Z A;  1JQK A;  4BNE A;  4FM3 A;  4UDX X;  2NCZ A;  2YI8 A;  4FZP A;  1WDZ A;  1E1D A;  1LQ7 A;  1SUF A;  3ABH A;  4E3C A;  3G9G A;  3ZED A;  3Q0K A;  2OZN B;  1HXK A;  3ACO A;  3A98 A;  3BUQ A;  2X3W A;  3LLL A;  2YL8 A;  2OW7 A;  2FIC A;  2Z0V A;  3BUB A;  3BVV A;  1R33 A;  3CV5 A;  2F18 A;  4R5L A;  1GNL A;  3BUD A;  3D2E A;  2RAK A;  4AVM A;  1ZWW A;  3EJS A;  2RAI A;  2GAF D;  3UIT A;  3CVR A;  4UDY X;  2F1B A;  3KAW A;  4AZ5 A;  3O3M B;  3VKH A;  3I01 A;  3LVT A;  3FD9 A;  2ALW A;  3RV0 A;  3DPO A;  3OHX M;  3L3O M;  3SYV A;  4EZX A;  4M0M A;  4AZC A;  1Y2O A;  1QX1 A;  1OAO A;  2WYH A;  3I2W A;  4D8J A;  4IWP A;  2PY6 A;  3O3O B;  2EWF A;  3D2F A;  1U00 A;  3M3W A;  3EJQ A;  3C7N A;  4JNE A;  4EZU A;  4EZT A;  2Q12 A;  4IM0 A;  4NQI A;  3O3N B;  3QNJ A;  2ZXQ A;  4EZS A;  4FZS A;  3D52 A;  1X03 A;  3T49 A;  1O7D B;  4F01 A;  2QFF A;  2PMR A;  3ER9 B;  4F00 A;  3HAH A;  3ERC C;  2GF4 A;  2O0I 1;  2GA9 D;  2LM0 A;  2EX3 B;  3I04 A;  5E84 A;  1SU7 A;  1W9M A;  2ND1 A;  2YL5 A;  4EZV A;  2V0O A;  1TQW A;  4R5J A;  4I1Q A;  3BVU A;  1I49 A;  4EZR A;  3KDR A;  2X3X A;  4B9Q A;  1QWU A;  3CZS A;  3QE6 A;  2F7P A;  4JWI A;  2JNS A;  4JWE A;  3DPQ A;  2OBM A;  2X3V A;  3GI7 A;  2YL9 A;  5C5B B;  2F1A A;  3SOG A;  1UPX A;  5C5B A;  4EZN A;  4H6H A;  2YLL A;  3L3P A;  3LMF A;  4IW0 A;  2FYV A;  4EZZ A;  3D51 A;  3T48 A;  1O7D C;  2OO2 A;  4NPH A;  3CKD A;  4KIK B;  1URU A;  4KIK A;  1SU6 A;  1DKY A;  3DDG A;  4HYB A;  3BVW A;  3DX4 A;  3OK8 A;  2RT6 A;  2ELB A;  3T47 A;  4R5I A;  2YIV X;  3T46 A;  5FLE X;  2MI7 A;  2Q13 A;  2YIB A;  3BUI A;  4EZY A;  3DPP A;  2EFL A;  3EJP A;  4AZI A;  1YWM A;  1E9V A;  1SU8 A;  2OW6 A;  1TQT A;  1DKX A;  4EZW A;  3RV1 A;  4FZO A;  2Z0O A;  1TQU A;  4JN4 A;  4R5K A;  4AZ7 A;  1I4T A;  1GNT A;  2Z0N A;  2YLA A;  3VEB A;  4IWO A;  3ER8 C;  3T4A G;  3Q84 A;  4NSW A;  4IM3 A;  4JLC A;  2Z8Y A; 
#chains in the Genus database with same CATH homology
 2RAK A;  4FZS A;  3ACO A;  1X04 A;  4AVM A;  3M3W A;  2YKT A;  2X3V A;  1URU A;  1I4T A;  1X03 A;  1ZWW A;  3PLT A;  2Z0N A;  4H8S A;  2X3W A;  3LLL A;  4BNE A;  2EFL A;  3HAJ A;  2C08 A;  5C5B B;  2EFK A;  4WPE A;  2RAI A;  3SOG A;  2FIC A;  2Z0V A;  3SYV A;  5C5B A;  2V0O A;  3HAI A;  3OK8 A;  3CAZ A;  1I4D A;  1Y2O A;  2Q12 A;  4DCN C;  2D4C A;  2ELB A;  4WPC A;  4I1Q A;  4ATM A;  3Q84 A;  1WDZ A;  2D1L A;  3ABH A;  1I49 A;  4NSW A;  4DYL A;  2RAJ A;  2X3X A;  3I2W A;  3G9G A;  3HAH A;  3QNI A;  2Z0O A;  3QE6 A;  1I4L A;  4NQI A;  3QWE A;  3Q0K A;  4AKV A;  3DYT A;  2Q13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...