2D4CA

Crystal structure of the endophilin bar domain mutant
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
241
structure length
224
Chain Sequence
HKATQKVSEKVGGAEGTKLDDDFKEMERKVDVTSRAVMEIMTKTIEYLQPNPASRAKLYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMRELSEVKDSLDIEVKQNFIDPLQNLHDKDLREIQSALQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFDESKEIAESSMFNLLEMDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRLEERIRQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords SH3-containing GRB2-like protein 2
publication title Endophilin BAR domain drives membrane curvature by two newly identified structure-based mechanisms
pubmed doi rcsb
source organism Homo sapiens
total genus 99
structure length 224
sequence length 241
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.-:
pdb deposition date 2005-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03114 BAR BAR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 2d4cA00
2YKTA 3Q0KA 4AVMA 4BNEA 2ELBA 4WPCA 2RAIA 2X3VA 3M3WA 5C5BB 2Q12A 2RAKA 2Z0VA 3I2WA 3OK8A 3SYVA 4NSWA 2C08A 2X3WA 3HAJA 1WDZA 2Q13A 2EFKA 3HAHA 4DCNC 1Y2OA 3QE6A 1I49A 1I4DA 1X04A 4FZSA 3Q84A 4H8SA 4AKVA 3SOGA 2FICA 4NQIA 3ABHA 2RAJA 3G9GA 5C5BA 4WPEA 2Z0NA 2V0OA 1URUA 1ZWWA 3QNIA 2EFLA 2D4CA 2X3XA 2D1LA 3ACOA 3QWEA 4ATMA 3HAIA 3CAZA 1I4TA 3LLLA 2Z0OA 1I4LA 3PLTA 4DYLA 3DYTA 4I1QA 1X03A
chains in the Genus database with same CATH superfamily
4FM3A 3BLBA 5C5BB 1MJGA 3I2WA 3KAVA 2MI7A 4JWCA 4FZSA 4H8SA 3D2FA 4NQIA 2RAJA 5FLEX 4KIKB 5E84A 1R33A 4EZSA 2FYVA 2ND0A 4AZGA 3RV0A 2D4CA 3HAIA 3D4ZA 3BVXA 2LM0A 1E9VA 1I4TA 3PLTA 3ER8C 2YKTA 4BNEA 4WPCA 2F7PA 2QKWA 4EZOA 1HTYA 3A98A 2RAKA 3DX2A 3HAHA 2OBLA 2ND1A 3Q84A 4AZCB 1E2UA 2D1LA 2QXLA 3OHXM 3I01A 2PMRA 3BUBA 2OW7A 3DDGA 2YIVX 2GA9D 4AZ5A 4E81A 1O7DB 1O7DC 4R5LA 3DPOA 3VEAA 1ZWWA 1R34A 4IWPA 4IM3A 3LVTA 3EJQA 4AZ6A 1I4LA 1OA1A 3EJPA 1QWUA 2ELBA 3LMFA 2RAIA 2X3VA 4R5KA 2Q12A 1SU6A 3RPMA 4HR1A 1SU8A 4EZTA 3DPPA 1QWNA 2OW6A 1Y2OA 5C5BA 4IWOA 3DDFA 2RT6A 3BVVA 1GNLA 4JWEA 3OWGA 3Q0KA 3VKHA 4AZ7A 4KIKA 4NSWA 4EZWA 2O0I1 2QFFA 3T49A 4AKVA 2F1BA 4EZQA 3UITA 1QX1A 4JWIA 1UPXA 1TQUA 3ER9B 2Z0OA 2YI8A 1JQKA 4JL9A 3OK8A 2WYHA 3CZSA 2F18A 1URUA 1TQVA 4IM2A 2EFLA 3CV5A 4EZZA 1GN9A 3L3OM 4AZCA 3EJTA 3D4YA 4EZPA 2ZXQA 1SU7A 2OO2A 2JNKA 3QA8A 2C08A 3ZEDA 3HAJA 4M0MA 1WDZA 3GI7A 3BVWA 2OBMA 1TQSA 2Z0NA 2V0OA 3ERCC 4F01A 4ATMA 3L3PA 2EWFA 3C7NA 3QNJA 2PY6A 4B9QA 4UDYX 1I49A 4AVMA 3F7WA 4R5JA 2YL8A 2WINM 2LXYA 4IM0A 2YI9A 3D50A 4FZPA 4AZBA 3DPQA 4G6QA 3DX0A 2YLLA 4EZRA 4JWDA 2N3KA 2X3WA 4D8JA 5TKYA 1X04A 1W9MA 3T47A 4IW0A 4AZHA 2Z8YA 3DX4A 4H6HA 1E1DA 1GNTA 2F1AA 2YL6A 3D2EA 3O3MB 3KAWA 2YIBA 3I04A 2F7RA 4DCNC 2EFKA 1I4DA 2FICA 1TQWA 3QNIA 1LQ7A 3ACOA 3CAZA 3BUPA 4DYLA 3EJUA 4FZOA 3M3WA 1OAOA 3DX3A 1HXKA 1U00A 2GF4A 2YIAA 2JNSA 2X3XA 3BUQA 4EZVA 3QWEA 3T48A 3BVUA 3O3NB 3FD9A 4UDXX 2NCZA 4R5IA 4EZYA 2YLAA 2ALWA 1TQTA 3BUDA 4F00A 2F7OA 4H6IA 4EZNA 2YL9A 2GAFD 4HY9A 3ABHA 3CVRA 2X5CA 2KHOA 2EX3B 1PS3A 3O3OB 1YWMA 3EJSA 3D51A 1HWWA 3I39X 4I1QA 4JN4A 3BVTA 1OA0A 2Z0VA 3D52A 2Q13A 1DKXA 2YL5A 3QE6A 3T4AG 1DKYA 3SOGA 4EZUA 4R5GA 1ZYLA 2F7QA 3RV1A 3CKDA 3B53X 3B52X 1R5EA 1DKZA 4JLCA 5FIGA 3BUIA 3SYVA 4HYBA 3T46A 4JNFA 2OZNB 4IWQA 4E3CA 1X03A 4PO2A 4JNEA 3VEBA 3CZNA 5KBPA 1SUFA 4EZXA 3EJRA 3B51X 3DX1A 4NPHA 4AZIA 3G9GA 4WPEA 3KDRA 3LLLA 3DYTA 4HR1B 2WYIA
chains in the Genus database with same CATH topology
2YKTA 3Q0KA 4AVMA 4BNEA 2ELBA 4WPCA 2RAIA 2X3VA 3M3WA 5C5BB 2Q12A 2RAKA 2Z0VA 3I2WA 3OK8A 3SYVA 4NSWA 2C08A 2X3WA 3HAJA 1WDZA 2Q13A 2EFKA 3HAHA 4DCNC 1Y2OA 3QE6A 1I49A 1I4DA 1X04A 4FZSA 3Q84A 4H8SA 4AKVA 3SOGA 2FICA 4NQIA 3ABHA 2RAJA 3G9GA 5C5BA 4WPEA 2Z0NA 2V0OA 1URUA 1ZWWA 3QNIA 2EFLA 2D4CA 2X3XA 2D1LA 3ACOA 3QWEA 4ATMA 3HAIA 3CAZA 1I4TA 3LLLA 2Z0OA 1I4LA 3PLTA 4DYLA 3DYTA 4I1QA 1X03A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YKT A;  3Q0K A;  4AVM A;  4BNE A;  2ELB A;  4WPC A;  2RAI A;  2X3V A;  3M3W A;  5C5B B;  2Q12 A;  2RAK A;  2Z0V A;  3I2W A;  3OK8 A;  3SYV A;  4NSW A;  2C08 A;  2X3W A;  3HAJ A;  1WDZ A;  2Q13 A;  2EFK A;  3HAH A;  4DCN C;  1Y2O A;  3QE6 A;  1I49 A;  1I4D A;  1X04 A;  4FZS A;  3Q84 A;  4H8S A;  4AKV A;  3SOG A;  2FIC A;  4NQI A;  3ABH A;  2RAJ A;  3G9G A;  5C5B A;  4WPE A;  2Z0N A;  2V0O A;  1URU A;  1ZWW A;  3QNI A;  2EFL A;  2D4C A;  2X3X A;  2D1L A;  3ACO A;  3QWE A;  4ATM A;  3HAI A;  3CAZ A;  1I4T A;  3LLL A;  2Z0O A;  1I4L A;  3PLT A;  4DYL A;  3DYT A;  4I1Q A;  1X03 A; 
#chains in the Genus database with same CATH topology
 4FM3 A;  3BLB A;  5C5B B;  1MJG A;  3I2W A;  3KAV A;  2MI7 A;  4JWC A;  4FZS A;  4H8S A;  3D2F A;  4NQI A;  2RAJ A;  5FLE X;  4KIK B;  5E84 A;  1R33 A;  4EZS A;  2FYV A;  2ND0 A;  4AZG A;  3RV0 A;  2D4C A;  3HAI A;  3D4Z A;  3BVX A;  2LM0 A;  1E9V A;  1I4T A;  3PLT A;  3ER8 C;  2YKT A;  4BNE A;  4WPC A;  2F7P A;  2QKW A;  4EZO A;  1HTY A;  3A98 A;  2RAK A;  3DX2 A;  3HAH A;  2OBL A;  2ND1 A;  3Q84 A;  4AZC B;  1E2U A;  2D1L A;  2QXL A;  3OHX M;  3I01 A;  2PMR A;  3BUB A;  2OW7 A;  3DDG A;  2YIV X;  2GA9 D;  4AZ5 A;  4E81 A;  1O7D B;  1O7D C;  4R5L A;  3DPO A;  3VEA A;  1ZWW A;  1R34 A;  4IWP A;  4IM3 A;  3LVT A;  3EJQ A;  4AZ6 A;  1I4L A;  1OA1 A;  3EJP A;  1QWU A;  2ELB A;  3LMF A;  2RAI A;  2X3V A;  4R5K A;  2Q12 A;  1SU6 A;  3RPM A;  4HR1 A;  1SU8 A;  4EZT A;  3DPP A;  1QWN A;  2OW6 A;  1Y2O A;  5C5B A;  4IWO A;  3DDF A;  2RT6 A;  3BVV A;  1GNL A;  4JWE A;  3OWG A;  3Q0K A;  3VKH A;  4AZ7 A;  4KIK A;  4NSW A;  4EZW A;  2O0I 1;  2QFF A;  3T49 A;  4AKV A;  2F1B A;  4EZQ A;  3UIT A;  1QX1 A;  4JWI A;  1UPX A;  1TQU A;  3ER9 B;  2Z0O A;  2YI8 A;  1JQK A;  4JL9 A;  3OK8 A;  2WYH A;  3CZS A;  2F18 A;  1URU A;  1TQV A;  4IM2 A;  2EFL A;  3CV5 A;  4EZZ A;  1GN9 A;  3L3O M;  4AZC A;  3EJT A;  3D4Y A;  4EZP A;  2ZXQ A;  1SU7 A;  2OO2 A;  2JNK A;  3QA8 A;  2C08 A;  3ZED A;  3HAJ A;  4M0M A;  1WDZ A;  3GI7 A;  3BVW A;  2OBM A;  1TQS A;  2Z0N A;  2V0O A;  3ERC C;  4F01 A;  4ATM A;  3L3P A;  2EWF A;  3C7N A;  3QNJ A;  2PY6 A;  4B9Q A;  4UDY X;  1I49 A;  4AVM A;  3F7W A;  4R5J A;  2YL8 A;  2WIN M;  2LXY A;  4IM0 A;  2YI9 A;  3D50 A;  4FZP A;  4AZB A;  3DPQ A;  4G6Q A;  3DX0 A;  2YLL A;  4EZR A;  4JWD A;  2N3K A;  2X3W A;  4D8J A;  5TKY A;  1X04 A;  1W9M A;  3T47 A;  4IW0 A;  4AZH A;  2Z8Y A;  3DX4 A;  4H6H A;  1E1D A;  1GNT A;  2F1A A;  2YL6 A;  3D2E A;  3O3M B;  3KAW A;  2YIB A;  3I04 A;  2F7R A;  4DCN C;  2EFK A;  1I4D A;  2FIC A;  1TQW A;  3QNI A;  1LQ7 A;  3ACO A;  3CAZ A;  3BUP A;  4DYL A;  3EJU A;  4FZO A;  3M3W A;  1OAO A;  3DX3 A;  1HXK A;  1U00 A;  2GF4 A;  2YIA A;  2JNS A;  2X3X A;  3BUQ A;  4EZV A;  3QWE A;  3T48 A;  3BVU A;  3O3N B;  3FD9 A;  4UDX X;  2NCZ A;  4R5I A;  4EZY A;  2YLA A;  2ALW A;  1TQT A;  3BUD A;  4F00 A;  2F7O A;  4H6I A;  4EZN A;  2YL9 A;  2GAF D;  4HY9 A;  3ABH A;  3CVR A;  2X5C A;  2KHO A;  2EX3 B;  1PS3 A;  3O3O B;  1YWM A;  3EJS A;  3D51 A;  1HWW A;  3I39 X;  4I1Q A;  4JN4 A;  3BVT A;  1OA0 A;  2Z0V A;  3D52 A;  2Q13 A;  1DKX A;  2YL5 A;  3QE6 A;  3T4A G;  1DKY A;  3SOG A;  4EZU A;  4R5G A;  1ZYL A;  2F7Q A;  3RV1 A;  3CKD A;  3B53 X;  3B52 X;  1R5E A;  1DKZ A;  4JLC A;  5FIG A;  3BUI A;  3SYV A;  4HYB A;  3T46 A;  4JNF A;  2OZN B;  4IWQ A;  4E3C A;  1X03 A;  4PO2 A;  4JNE A;  3VEB A;  3CZN A;  5KBP A;  1SUF A;  4EZX A;  3EJR A;  3B51 X;  3DX1 A;  4NPH A;  4AZI A;  3G9G A;  4WPE A;  3KDR A;  3LLL A;  3DYT A;  4HR1 B;  2WYI A; 
#chains in the Genus database with same CATH homology
 2YKT A;  3Q0K A;  4AVM A;  4BNE A;  2ELB A;  4WPC A;  2RAI A;  2X3V A;  3M3W A;  5C5B B;  2Q12 A;  2RAK A;  2Z0V A;  3I2W A;  3OK8 A;  3SYV A;  4NSW A;  2C08 A;  2X3W A;  3HAJ A;  1WDZ A;  2Q13 A;  2EFK A;  3HAH A;  4DCN C;  1Y2O A;  3QE6 A;  1I49 A;  1I4D A;  1X04 A;  4FZS A;  3Q84 A;  4H8S A;  4AKV A;  3SOG A;  2FIC A;  4NQI A;  3ABH A;  2RAJ A;  3G9G A;  5C5B A;  4WPE A;  2Z0N A;  2V0O A;  1URU A;  1ZWW A;  3QNI A;  2EFL A;  2D4C A;  2X3X A;  2D1L A;  3ACO A;  3QWE A;  4ATM A;  3HAI A;  3CAZ A;  1I4T A;  3LLL A;  2Z0O A;  1I4L A;  3PLT A;  4DYL A;  3DYT A;  4I1Q A;  1X03 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...