2D4CA

Crystal structure of the endophilin bar domain mutant
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
241
structure length
224
Chain Sequence
b'HKATQKVSEKVGGAEGTKLDDDFKEMERKVDVTSRAVMEIMTKTIEYLQPNPASRAKLYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMRELSEVKDSLDIEVKQNFIDPLQNLHDKDLREIQSALQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFDESKEIAESSMFNLLEMDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRLEERIRQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SH3-containing GRB2-like protein 2
publication title Endophilin BAR domain drives membrane curvature by two newly identified structure-based mechanisms
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 99
structure length 224
sequence length 241
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.-:
pdb deposition date 2005-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03114 BAR BAR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 2d4cA00
3HAHA 1I4TA 2D4CA 4AVMA 2X3XA 2Q12A 3QWEA 4WPEA 3DYTA 3SOGA 4FZSA 3QNIA 3SYVA 3ACOA 1I4LA 3HAIA 3I2WA 4NQIA 1I4DA 2RAJA 2ELBA 3HAJA 2Z0OA 2D1LA 4WPCA 2Z0NA 3Q84A 2X3VA 3LLLA 3PLTA 4I1QA 5C5BB 1I49A 2FICA 1ZWWA 3G9GA 4DCNC 2RAKA 3M3WA 2V0OA 4NSWA 4H8SA 2C08A 1Y2OA 3CAZA 2YKTA 3Q0KA 4AKVA 2EFKA 2EFLA 1URUA 3ABHA 3OK8A 2Q13A 5C5BA 1X04A 3QE6A 4DYLA 1WDZA 4ATMA 2RAIA 2X3WA 2Z0VA 4BNEA 1X03A
chains in the Genus database with same CATH superfamily
1R33A 1UPXA 3BVXA 1SUFA 3EJPA 3LVTA 1O7DB 4EZZA 2QKWA 2WINM 1R34A 3CVRA 3CZNA 3G9GA 1TQUA 4IWPA 3D52A 3DX2A 4AZ6A 2X3XA 4AZ7A 2GAFD 2OO2A 3BVUA 3ACOA 3F7WA 2EWFA 1SU7A 2D1LA 2Z0OA 3D50A 3PLTA 4E3CA 3D4YA 4EZXA 3EJTA 4G6QA 3CAZA 4HY9A 2YL9A 3I04A 3LMFA 4E81A 2ND1A 2Z0VA 1I4TA 2YL8A 4R5JA 3BVVA 2WYHA 4JWIA 1I4DA 3BUDA 3Q84A 3EJSA 1O7DC 4EZQA 3CZSA 3DPQA 3Q0KA 1URUA 1E9VA 4JN4A 3SOGA 1GNTA 4HR1A 3HAIA 1GNLA 3O3OB 3T46A 4AZHA 1ZWWA 3UITA 3DX0A 1X03A 3QWEA 3OHXM 4H6HA 3QA8A 4UDYX 2X5CA 1TQTA 2RAJA 1OA0A 1R5EA 4JNFA 5TKYA 3OK8A 1WDZA 4ATMA 3O3NB 4PO2A 3BUQA 4EZWA 3CV5A 2PMRA 2OBMA 3M3WA 4IW0A 4JWDA 3C7NA 2Q13A 3QE6A 1DKYA 1E1DA 1SU8A 3DYTA 4FZSA 4EZYA 3BUPA 3OWGA 3RV1A 2YL5A 4NQIA 3DPPA 2ALWA 3ER8C 5E84A 1LQ7A 3A98A 2ND0A 3DX4A 3L3OM 4EZVA 4AKVA 1HWWA 4BNEA 1DKXA 2RT6A 3ZEDA 2D4CA 4IM2A 1MJGA 2QXLA 3QNJA 4AZCB 1I4LA 3DX3A 2OW6A 3KAWA 4I1QA 3BUBA 3L3PA 3GI7A 3EJUA 4FZPA 4IM0A 3D2EA 1Y2OA 4B9QA 2EFLA 5C5BA 3CKDA 2YIVX 3BLBA 3EJRA 3DX1A 2OW7A 3I01A 4EZSA 3I2WA 4R5KA 3VEAA 4AZIA 4EZRA 2RAKA 2V0OA 1TQWA 4NSWA 4IWOA 3RV0A 4AZ5A 2Z8YA 3B53X 2GA9D 3D2FA 2Q12A 2YI8A 2F1BA 1QWNA 1PS3A 4F00A 4KIKB 1HTYA 2C08A 1HXKA 2MI7A 1U00A 4R5IA 1W9MA 4IM3A 3I39X 3T47A 5FLEX 1QX1A 3QNIA 4JWCA 3D51A 2JNSA 2YI9A 1YWMA 4IWQA 3FD9A 2JNKA 4EZOA 4DCNC 3RPMA 4EZNA 4JL9A 3DPOA 4JWEA 1OAOA 1SU6A 4FZOA 4AZGA 1JQKA 2FICA 4JLCA 4NPHA 4R5GA 4UDXX 2EFKA 3BVWA 2F7PA 4AVMA 3B52X 4F01A 3SYVA 2F18A 3T48A 3HAJA 2Z0NA 1TQSA 3DDFA 3BUIA 1E2UA 3ER9B 5C5BB 2O0I1 1TQVA 2FYVA 3ABHA 4EZUA 3VEBA 4HR1B 4H6IA 2F7RA 4EZPA 2ZXQA 3HAHA 2QFFA 4D8JA 4WPEA 3ERCC 2LM0A 3BVTA 2PY6A 3T49A 4AZCA 3D4ZA 2YL6A 3VKHA 2EX3B 4AZBA 1X04A 4DYLA 2YLAA 2RAIA 2YIBA 2OZNB 3O3MB 3KDRA 3EJQA 2NCZA 2YLLA 4HYBA 2KHOA 4WPCA 3LLLA 1DKZA 2F7QA 1GN9A 2OBLA 1OA1A 1QWUA 4JNEA 4H8SA 2F1AA 4M0MA 5KBPA 2N3KA 1ZYLA 2X3WA 2YIAA 4EZTA 2ELBA 2X3VA 3DDGA 2F7OA 1I49A 3T4AG 4FM3A 3KAVA 3B51X 4KIKA 2YKTA 2LXYA 4R5LA 2WYIA 2GF4A 5FIGA
chains in the Genus database with same CATH topology
3HAHA 1I4TA 2D4CA 4AVMA 2X3XA 2Q12A 3QWEA 4WPEA 3DYTA 3SOGA 4FZSA 3QNIA 3SYVA 3ACOA 1I4LA 3HAIA 3I2WA 4NQIA 1I4DA 2RAJA 2ELBA 3HAJA 2Z0OA 2D1LA 4WPCA 2Z0NA 3Q84A 2X3VA 3LLLA 3PLTA 4I1QA 5C5BB 1I49A 2FICA 1ZWWA 3G9GA 4DCNC 2RAKA 3M3WA 2V0OA 4NSWA 4H8SA 2C08A 1Y2OA 3CAZA 2YKTA 3Q0KA 4AKVA 2EFKA 2EFLA 1URUA 3ABHA 3OK8A 2Q13A 5C5BA 1X04A 3QE6A 4DYLA 1WDZA 4ATMA 2RAIA 2X3WA 2Z0VA 4BNEA 1X03A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HAH A;  1I4T A;  2D4C A;  4AVM A;  2X3X A;  2Q12 A;  3QWE A;  4WPE A;  3DYT A;  3SOG A;  4FZS A;  3QNI A;  3SYV A;  3ACO A;  1I4L A;  3HAI A;  3I2W A;  4NQI A;  1I4D A;  2RAJ A;  2ELB A;  3HAJ A;  2Z0O A;  2D1L A;  4WPC A;  2Z0N A;  3Q84 A;  2X3V A;  3LLL A;  3PLT A;  4I1Q A;  5C5B B;  1I49 A;  2FIC A;  1ZWW A;  3G9G A;  4DCN C;  2RAK A;  3M3W A;  2V0O A;  4NSW A;  4H8S A;  2C08 A;  1Y2O A;  3CAZ A;  2YKT A;  3Q0K A;  4AKV A;  2EFK A;  2EFL A;  1URU A;  3ABH A;  3OK8 A;  2Q13 A;  5C5B A;  1X04 A;  3QE6 A;  4DYL A;  1WDZ A;  4ATM A;  2RAI A;  2X3W A;  2Z0V A;  4BNE A;  1X03 A; 
#chains in the Genus database with same CATH topology
 1R33 A;  1UPX A;  3BVX A;  1SUF A;  3EJP A;  3LVT A;  1O7D B;  4EZZ A;  2QKW A;  2WIN M;  1R34 A;  3CVR A;  3CZN A;  3G9G A;  1TQU A;  4IWP A;  3D52 A;  3DX2 A;  4AZ6 A;  2X3X A;  4AZ7 A;  2GAF D;  2OO2 A;  3BVU A;  3ACO A;  3F7W A;  2EWF A;  1SU7 A;  2D1L A;  2Z0O A;  3D50 A;  3PLT A;  4E3C A;  3D4Y A;  4EZX A;  3EJT A;  4G6Q A;  3CAZ A;  4HY9 A;  2YL9 A;  3I04 A;  3LMF A;  4E81 A;  2ND1 A;  2Z0V A;  1I4T A;  2YL8 A;  4R5J A;  3BVV A;  2WYH A;  4JWI A;  1I4D A;  3BUD A;  3Q84 A;  3EJS A;  1O7D C;  4EZQ A;  3CZS A;  3DPQ A;  3Q0K A;  1URU A;  1E9V A;  4JN4 A;  3SOG A;  1GNT A;  4HR1 A;  3HAI A;  1GNL A;  3O3O B;  3T46 A;  4AZH A;  1ZWW A;  3UIT A;  3DX0 A;  1X03 A;  3QWE A;  3OHX M;  4H6H A;  3QA8 A;  4UDY X;  2X5C A;  1TQT A;  2RAJ A;  1OA0 A;  1R5E A;  4JNF A;  5TKY A;  3OK8 A;  1WDZ A;  4ATM A;  3O3N B;  4PO2 A;  3BUQ A;  4EZW A;  3CV5 A;  2PMR A;  2OBM A;  3M3W A;  4IW0 A;  4JWD A;  3C7N A;  2Q13 A;  3QE6 A;  1DKY A;  1E1D A;  1SU8 A;  3DYT A;  4FZS A;  4EZY A;  3BUP A;  3OWG A;  3RV1 A;  2YL5 A;  4NQI A;  3DPP A;  2ALW A;  3ER8 C;  5E84 A;  1LQ7 A;  3A98 A;  2ND0 A;  3DX4 A;  3L3O M;  4EZV A;  4AKV A;  1HWW A;  4BNE A;  1DKX A;  2RT6 A;  3ZED A;  2D4C A;  4IM2 A;  1MJG A;  2QXL A;  3QNJ A;  4AZC B;  1I4L A;  3DX3 A;  2OW6 A;  3KAW A;  4I1Q A;  3BUB A;  3L3P A;  3GI7 A;  3EJU A;  4FZP A;  4IM0 A;  3D2E A;  1Y2O A;  4B9Q A;  2EFL A;  5C5B A;  3CKD A;  2YIV X;  3BLB A;  3EJR A;  3DX1 A;  2OW7 A;  3I01 A;  4EZS A;  3I2W A;  4R5K A;  3VEA A;  4AZI A;  4EZR A;  2RAK A;  2V0O A;  1TQW A;  4NSW A;  4IWO A;  3RV0 A;  4AZ5 A;  2Z8Y A;  3B53 X;  2GA9 D;  3D2F A;  2Q12 A;  2YI8 A;  2F1B A;  1QWN A;  1PS3 A;  4F00 A;  4KIK B;  1HTY A;  2C08 A;  1HXK A;  2MI7 A;  1U00 A;  4R5I A;  1W9M A;  4IM3 A;  3I39 X;  3T47 A;  5FLE X;  1QX1 A;  3QNI A;  4JWC A;  3D51 A;  2JNS A;  2YI9 A;  1YWM A;  4IWQ A;  3FD9 A;  2JNK A;  4EZO A;  4DCN C;  3RPM A;  4EZN A;  4JL9 A;  3DPO A;  4JWE A;  1OAO A;  1SU6 A;  4FZO A;  4AZG A;  1JQK A;  2FIC A;  4JLC A;  4NPH A;  4R5G A;  4UDX X;  2EFK A;  3BVW A;  2F7P A;  4AVM A;  3B52 X;  4F01 A;  3SYV A;  2F18 A;  3T48 A;  3HAJ A;  2Z0N A;  1TQS A;  3DDF A;  3BUI A;  1E2U A;  3ER9 B;  5C5B B;  2O0I 1;  1TQV A;  2FYV A;  3ABH A;  4EZU A;  3VEB A;  4HR1 B;  4H6I A;  2F7R A;  4EZP A;  2ZXQ A;  3HAH A;  2QFF A;  4D8J A;  4WPE A;  3ERC C;  2LM0 A;  3BVT A;  2PY6 A;  3T49 A;  4AZC A;  3D4Z A;  2YL6 A;  3VKH A;  2EX3 B;  4AZB A;  1X04 A;  4DYL A;  2YLA A;  2RAI A;  2YIB A;  2OZN B;  3O3M B;  3KDR A;  3EJQ A;  2NCZ A;  2YLL A;  4HYB A;  2KHO A;  4WPC A;  3LLL A;  1DKZ A;  2F7Q A;  1GN9 A;  2OBL A;  1OA1 A;  1QWU A;  4JNE A;  4H8S A;  2F1A A;  4M0M A;  5KBP A;  2N3K A;  1ZYL A;  2X3W A;  2YIA A;  4EZT A;  2ELB A;  2X3V A;  3DDG A;  2F7O A;  1I49 A;  3T4A G;  4FM3 A;  3KAV A;  3B51 X;  4KIK A;  2YKT A;  2LXY A;  4R5L A;  2WYI A;  2GF4 A;  5FIG A; 
#chains in the Genus database with same CATH homology
 3HAH A;  1I4T A;  2D4C A;  4AVM A;  2X3X A;  2Q12 A;  3QWE A;  4WPE A;  3DYT A;  3SOG A;  4FZS A;  3QNI A;  3SYV A;  3ACO A;  1I4L A;  3HAI A;  3I2W A;  4NQI A;  1I4D A;  2RAJ A;  2ELB A;  3HAJ A;  2Z0O A;  2D1L A;  4WPC A;  2Z0N A;  3Q84 A;  2X3V A;  3LLL A;  3PLT A;  4I1Q A;  5C5B B;  1I49 A;  2FIC A;  1ZWW A;  3G9G A;  4DCN C;  2RAK A;  3M3W A;  2V0O A;  4NSW A;  4H8S A;  2C08 A;  1Y2O A;  3CAZ A;  2YKT A;  3Q0K A;  4AKV A;  2EFK A;  2EFL A;  1URU A;  3ABH A;  3OK8 A;  2Q13 A;  5C5B A;  1X04 A;  3QE6 A;  4DYL A;  1WDZ A;  4ATM A;  2RAI A;  2X3W A;  2Z0V A;  4BNE A;  1X03 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...