2D4CA

Crystal structure of the endophilin bar domain mutant
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
241
structure length
224
Chain Sequence
HKATQKVSEKVGGAEGTKLDDDFKEMERKVDVTSRAVMEIMTKTIEYLQPNPASRAKLYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMRELSEVKDSLDIEVKQNFIDPLQNLHDKDLREIQSALQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFDESKEIAESSMFNLLEMDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRLEERIRQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SH3-containing GRB2-like protein 2
publication title Endophilin BAR domain drives membrane curvature by two newly identified structure-based mechanisms
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 99
structure length 224
sequence length 241
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.-:
pdb deposition date 2005-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03114 BAR BAR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 2d4cA00
3I2WA 1I4TA 2EFLA 2X3WA 2Z0OA 1I4LA 3PLTA 1I49A 4AVMA 4WPEA 2D1LA 2Q13A 4I1QA 1X04A 3QWEA 1WDZA 4FZSA 3DYTA 2C08A 4BNEA 2RAIA 3HAIA 3CAZA 3SOGA 3Q84A 3HAHA 3QE6A 4AKVA 4ATMA 2RAJA 4NSWA 2Q12A 4DCNC 3G9GA 3HAJA 4NQIA 5C5BB 4H8SA 4DYLA 3Q0KA 2V0OA 3ABHA 5C5BA 2FICA 2RAKA 2Z0VA 2ELBA 1X03A 3QNIA 3SYVA 2EFKA 2Z0NA 3M3WA 1URUA 2X3XA 2D4CA 3OK8A 4WPCA 1I4DA 1ZWWA 2X3VA 2YKTA 1Y2OA 3ACOA 3LLLA
chains in the Genus database with same CATH superfamily
4AZIA 1W9MA 4JL9A 2F7RA 2RT6A 1WDZA 2YL6A 4NPHA 2OZNB 3CAZA 4AZBA 3FD9A 3RV1A 3BLBA 3M3WA 4JWCA 3KDRA 2X3VA 2OO2A 2WYHA 4IM2A 1E1DA 3DYTA 2EWFA 1LQ7A 3BUQA 4NSWA 1OA1A 1R5EA 4NQIA 5C5BB 1TQTA 4IWQA 3ER8C 2EFKA 5FLEX 4F01A 2OBMA 4HYBA 1QWNA 3ZEDA 1SU8A 2Q12A 4E81A 4DYLA 3D50A 2PY6A 3DX1A 3D4YA 2LM0A 4AZGA 4AZ7A 1OAOA 5TKYA 3DDFA 2JNSA 2Q13A 3DPOA 4PO2A 4IM3A 2FYVA 3CVRA 1ZYLA 4EZOA 3ABHA 5C5BA 1E2UA 3GI7A 4AZCB 4IW0A 3T49A 1GNTA 3BUDA 2JNKA 4EZNA 4B9QA 2YIAA 3O3NB 4IM0A 2RAIA 4IWPA 2YI8A 2YIBA 2F7PA 3EJSA 3G9GA 2QXLA 2FICA 3D51A 1PS3A 3DX4A 4EZXA 4FZSA 4BNEA 3EJPA 4H6IA 2MI7A 4EZQA 2F7QA 3DDGA 4JNFA 3DX2A 1TQSA 4F00A 3D4ZA 4AZCA 2EFLA 3QNJA 4AVMA 2D1LA 1SU7A 4EZZA 4I1QA 4JWDA 2KHOA 2C08A 3CV5A 3I01A 2YL8A 3I39X 3HAJA 2V0OA 3L3OM 4AZHA 4R5JA 3EJUA 3BUBA 4EZVA 4EZPA 1GNLA 3F7WA 3UITA 2X5CA 2PMRA 4DCNC 2NCZA 4H8SA 3DPPA 4EZTA 1DKZA 3I04A 3ERCC 4EZSA 3QA8A 1R34A 3ACOA 2LXYA 1OA0A 1QX1A 3HAIA 3DX3A 4EZUA 4JLCA 3ER9B 2OW7A 3BUPA 3LVTA 1X03A 3EJQA 2F7OA 4EZYA 4H6HA 5FIGA 2YKTA 1I49A 4KIKB 3BUIA 3RV0A 2QKWA 3SOGA 4UDYX 4ATMA 3KAWA 5KBPA 4AZ5A 3CZNA 3SYVA 3T48A 2ND0A 2D4CA 2X3XA 3T47A 3I2WA 1JQKA 2EX3B 3A98A 2GF4A 4EZRA 4WPEA 1SU6A 2YLAA 3EJTA 2GAFD 4FM3A 2OBLA 3DX0A 1GN9A 3T4AG 2F1BA 4JWEA 1URUA 4JNEA 3B51X 1HXKA 1O7DB 1Y2OA 3BVUA 1TQUA 1HWWA 1YWMA 2YL9A 1X04A 4KIKA 1TQVA 4FZOA 4R5KA 3BVVA 2WYIA 4AKVA 2RAJA 4HY9A 1MJGA 2YL5A 3O3OB 1I4DA 2YIVX 3D2EA 2Z0OA 3PLTA 4R5GA 2F18A 2O0I1 2N3KA 3OWGA 3Q84A 3QE6A 1R33A 3RPMA 2QFFA 3BVXA 1U00A 3C7NA 4D8JA 1TQWA 3VEBA 2YLLA 3LLLA 2X3WA 2Z8YA 4R5IA 4HR1B 3BVWA 3QWEA 3KAVA 3VEAA 4G6QA 4JN4A 3VKHA 3DPQA 3LMFA 3O3MB 3Q0KA 2F1AA 5E84A 1DKXA 1SUFA 3BVTA 3T46A 2Z0VA 1I4LA 2GA9D 1HTYA 3D52A 1QWUA 3HAHA 4AZ6A 4M0MA 2YI9A 3EJRA 1DKYA 2ND1A 3B53X 4E3CA 2ELBA 2Z0NA 3OK8A 2ALWA 4WPCA 4IWOA 1I4TA 3CKDA 2ZXQA 4JWIA 4HR1A 3B52X 3OHXM 3L3PA 3D2FA 1E9VA 2OW6A 2WINM 4EZWA 1O7DC 1UPXA 4UDXX 2RAKA 3QNIA 4FZPA 1ZWWA 4R5LA 3CZSA
chains in the Genus database with same CATH topology
3I2WA 1I4TA 2EFLA 2X3WA 2Z0OA 1I4LA 3PLTA 1I49A 4AVMA 4WPEA 2D1LA 2Q13A 4I1QA 1X04A 3QWEA 1WDZA 4FZSA 3DYTA 2C08A 4BNEA 2RAIA 3HAIA 3CAZA 3SOGA 3Q84A 3HAHA 3QE6A 4AKVA 4ATMA 2RAJA 4NSWA 2Q12A 4DCNC 3G9GA 3HAJA 4NQIA 5C5BB 4H8SA 4DYLA 3Q0KA 2V0OA 3ABHA 5C5BA 2FICA 2RAKA 2Z0VA 2ELBA 1X03A 3QNIA 3SYVA 2EFKA 2Z0NA 3M3WA 1URUA 2X3XA 2D4CA 3OK8A 4WPCA 1I4DA 1ZWWA 2X3VA 2YKTA 1Y2OA 3ACOA 3LLLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I2W A;  1I4T A;  2EFL A;  2X3W A;  2Z0O A;  1I4L A;  3PLT A;  1I49 A;  4AVM A;  4WPE A;  2D1L A;  2Q13 A;  4I1Q A;  1X04 A;  3QWE A;  1WDZ A;  4FZS A;  3DYT A;  2C08 A;  4BNE A;  2RAI A;  3HAI A;  3CAZ A;  3SOG A;  3Q84 A;  3HAH A;  3QE6 A;  4AKV A;  4ATM A;  2RAJ A;  4NSW A;  2Q12 A;  4DCN C;  3G9G A;  3HAJ A;  4NQI A;  5C5B B;  4H8S A;  4DYL A;  3Q0K A;  2V0O A;  3ABH A;  5C5B A;  2FIC A;  2RAK A;  2Z0V A;  2ELB A;  1X03 A;  3QNI A;  3SYV A;  2EFK A;  2Z0N A;  3M3W A;  1URU A;  2X3X A;  2D4C A;  3OK8 A;  4WPC A;  1I4D A;  1ZWW A;  2X3V A;  2YKT A;  1Y2O A;  3ACO A;  3LLL A; 
#chains in the Genus database with same CATH topology
 4AZI A;  1W9M A;  4JL9 A;  2F7R A;  2RT6 A;  1WDZ A;  2YL6 A;  4NPH A;  2OZN B;  3CAZ A;  4AZB A;  3FD9 A;  3RV1 A;  3BLB A;  3M3W A;  4JWC A;  3KDR A;  2X3V A;  2OO2 A;  2WYH A;  4IM2 A;  1E1D A;  3DYT A;  2EWF A;  1LQ7 A;  3BUQ A;  4NSW A;  1OA1 A;  1R5E A;  4NQI A;  5C5B B;  1TQT A;  4IWQ A;  3ER8 C;  2EFK A;  5FLE X;  4F01 A;  2OBM A;  4HYB A;  1QWN A;  3ZED A;  1SU8 A;  2Q12 A;  4E81 A;  4DYL A;  3D50 A;  2PY6 A;  3DX1 A;  3D4Y A;  2LM0 A;  4AZG A;  4AZ7 A;  1OAO A;  5TKY A;  3DDF A;  2JNS A;  2Q13 A;  3DPO A;  4PO2 A;  4IM3 A;  2FYV A;  3CVR A;  1ZYL A;  4EZO A;  3ABH A;  5C5B A;  1E2U A;  3GI7 A;  4AZC B;  4IW0 A;  3T49 A;  1GNT A;  3BUD A;  2JNK A;  4EZN A;  4B9Q A;  2YIA A;  3O3N B;  4IM0 A;  2RAI A;  4IWP A;  2YI8 A;  2YIB A;  2F7P A;  3EJS A;  3G9G A;  2QXL A;  2FIC A;  3D51 A;  1PS3 A;  3DX4 A;  4EZX A;  4FZS A;  4BNE A;  3EJP A;  4H6I A;  2MI7 A;  4EZQ A;  2F7Q A;  3DDG A;  4JNF A;  3DX2 A;  1TQS A;  4F00 A;  3D4Z A;  4AZC A;  2EFL A;  3QNJ A;  4AVM A;  2D1L A;  1SU7 A;  4EZZ A;  4I1Q A;  4JWD A;  2KHO A;  2C08 A;  3CV5 A;  3I01 A;  2YL8 A;  3I39 X;  3HAJ A;  2V0O A;  3L3O M;  4AZH A;  4R5J A;  3EJU A;  3BUB A;  4EZV A;  4EZP A;  1GNL A;  3F7W A;  3UIT A;  2X5C A;  2PMR A;  4DCN C;  2NCZ A;  4H8S A;  3DPP A;  4EZT A;  1DKZ A;  3I04 A;  3ERC C;  4EZS A;  3QA8 A;  1R34 A;  3ACO A;  2LXY A;  1OA0 A;  1QX1 A;  3HAI A;  3DX3 A;  4EZU A;  4JLC A;  3ER9 B;  2OW7 A;  3BUP A;  3LVT A;  1X03 A;  3EJQ A;  2F7O A;  4EZY A;  4H6H A;  5FIG A;  2YKT A;  1I49 A;  4KIK B;  3BUI A;  3RV0 A;  2QKW A;  3SOG A;  4UDY X;  4ATM A;  3KAW A;  5KBP A;  4AZ5 A;  3CZN A;  3SYV A;  3T48 A;  2ND0 A;  2D4C A;  2X3X A;  3T47 A;  3I2W A;  1JQK A;  2EX3 B;  3A98 A;  2GF4 A;  4EZR A;  4WPE A;  1SU6 A;  2YLA A;  3EJT A;  2GAF D;  4FM3 A;  2OBL A;  3DX0 A;  1GN9 A;  3T4A G;  2F1B A;  4JWE A;  1URU A;  4JNE A;  3B51 X;  1HXK A;  1O7D B;  1Y2O A;  3BVU A;  1TQU A;  1HWW A;  1YWM A;  2YL9 A;  1X04 A;  4KIK A;  1TQV A;  4FZO A;  4R5K A;  3BVV A;  2WYI A;  4AKV A;  2RAJ A;  4HY9 A;  1MJG A;  2YL5 A;  3O3O B;  1I4D A;  2YIV X;  3D2E A;  2Z0O A;  3PLT A;  4R5G A;  2F18 A;  2O0I 1;  2N3K A;  3OWG A;  3Q84 A;  3QE6 A;  1R33 A;  3RPM A;  2QFF A;  3BVX A;  1U00 A;  3C7N A;  4D8J A;  1TQW A;  3VEB A;  2YLL A;  3LLL A;  2X3W A;  2Z8Y A;  4R5I A;  4HR1 B;  3BVW A;  3QWE A;  3KAV A;  3VEA A;  4G6Q A;  4JN4 A;  3VKH A;  3DPQ A;  3LMF A;  3O3M B;  3Q0K A;  2F1A A;  5E84 A;  1DKX A;  1SUF A;  3BVT A;  3T46 A;  2Z0V A;  1I4L A;  2GA9 D;  1HTY A;  3D52 A;  1QWU A;  3HAH A;  4AZ6 A;  4M0M A;  2YI9 A;  3EJR A;  1DKY A;  2ND1 A;  3B53 X;  4E3C A;  2ELB A;  2Z0N A;  3OK8 A;  2ALW A;  4WPC A;  4IWO A;  1I4T A;  3CKD A;  2ZXQ A;  4JWI A;  4HR1 A;  3B52 X;  3OHX M;  3L3P A;  3D2F A;  1E9V A;  2OW6 A;  2WIN M;  4EZW A;  1O7D C;  1UPX A;  4UDX X;  2RAK A;  3QNI A;  4FZP A;  1ZWW A;  4R5L A;  3CZS A; 
#chains in the Genus database with same CATH homology
 3I2W A;  1I4T A;  2EFL A;  2X3W A;  2Z0O A;  1I4L A;  3PLT A;  1I49 A;  4AVM A;  4WPE A;  2D1L A;  2Q13 A;  4I1Q A;  1X04 A;  3QWE A;  1WDZ A;  4FZS A;  3DYT A;  2C08 A;  4BNE A;  2RAI A;  3HAI A;  3CAZ A;  3SOG A;  3Q84 A;  3HAH A;  3QE6 A;  4AKV A;  4ATM A;  2RAJ A;  4NSW A;  2Q12 A;  4DCN C;  3G9G A;  3HAJ A;  4NQI A;  5C5B B;  4H8S A;  4DYL A;  3Q0K A;  2V0O A;  3ABH A;  5C5B A;  2FIC A;  2RAK A;  2Z0V A;  2ELB A;  1X03 A;  3QNI A;  3SYV A;  2EFK A;  2Z0N A;  3M3W A;  1URU A;  2X3X A;  2D4C A;  3OK8 A;  4WPC A;  1I4D A;  1ZWW A;  2X3V A;  2YKT A;  1Y2O A;  3ACO A;  3LLL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...