1I4DA

Crystal structure analysis of rac1-gdp complexed with arfaptin (p21)
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
200
structure length
188
Chain Sequence
SRTVDLELELQIELLRETKRKYESVLQLGRALTAHLYSLLQTQHALGDAFADLSQKSPELQEEFGYNAETQKLLCKNGETLLGAVNFFVSSINTLVTKTMEDTLMTVKQYEAARLEYDAYRTDLEELSESAQATFQAHRDKYEKLRGDVAIKLKFLEENKIKVMHKQLLLFHNAVSAYFAGNQKQLEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARFAPTIN 2
publication title The structural basis of Arfaptin-mediated cross-talk between Rac and Arf signalling pathways.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 88
structure length 188
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-02-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 1i4dA00
1ZWWA 1X04A 2X3VA 3LLLA 3OK8A 2ELBA 4H8SA 2Z0OA 2C08A 1WDZA 2RAIA 3QWEA 4AKVA 1I49A 2EFLA 3HAJA 4NQIA 1Y2OA 2Z0NA 3DYTA 4NSWA 4DCNC 3SOGA 3QE6A 2X3XA 2RAKA 3Q0KA 4ATMA 5C5BA 2YKTA 3SYVA 1URUA 1I4DA 2RAJA 2FICA 4WPCA 3ACOA 1I4TA 4WPEA 4FZSA 2Z0VA 3Q84A 3M3WA 4DYLA 3I2WA 3CAZA 2V0OA 2X3WA 3ABHA 3HAHA 4AVMA 1I4LA 2Q12A 2Q13A 3QNIA 5C5BB 4BNEA 2EFKA 3PLTA 1X03A 4I1QA 3G9GA 2D4CA 3HAIA 2D1LA
chains in the Genus database with same CATH superfamily
3EJTA 4AKVA 1QX1A 3HAJA 3OWGA 4R5KA 4ATMA 2F7PA 4AZCB 1TQWA 3CV5A 1HTYA 4AVMA 2Q12A 2Q13A 2F7QA 3G9GA 1OAOA 4IWOA 3DX2A 1QWUA 2X3VA 3D2EA 3I04A 2F1AA 4JWEA 3ERCC 3T49A 4F00A 4IWPA 5E84A 3B52X 2WYHA 3SOGA 3EJSA 3I01A 5C5BA 3GI7A 2WYIA 4JL9A 4EZOA 3VEAA 1U00A 3I2WA 2X3WA 3D52A 1SU8A 3QNIA 1E9VA 2PY6A 3T4AG 2OO2A 4UDXX 3BLBA 3KAVA 3DX4A 2RT6A 1YWMA 1E1DA 4AZ7A 1E2UA 2EFKA 2EX3B 3DDFA 3O3OB 3BUQA 4JLCA 2D4CA 4EZPA 4B9QA 2C08A 1WDZA 2OW7A 4NQIA 5FIGA 1DKXA 3SYVA 1O7DB 2OZNB 4KIKA 1R33A 3DPQA 3ER8C 2OBLA 4FM3A 1GN9A 3RPMA 4IWQA 3OHXM 4BNEA 3O3NB 1SU7A 4EZQA 4IW0A 1X04A 2ELBA 1I49A 2RAKA 1URUA 4E3CA 4M0MA 3QNJA 3D4ZA 4EZYA 3A98A 4EZWA 2Z8YA 3PLTA 2FYVA 3DPOA 2X5CA 3UITA 3EJPA 3KDRA 4PO2A 2YLAA 1QWNA 2YL9A 4IM3A 2N3KA 4EZRA 3D51A 3QE6A 2X3XA 2QFFA 3B53X 4R5JA 3Q84A 4EZXA 3BVVA 3D2FA 3HAHA 3DX1A 1R5EA 4IM2A 2OW6A 4F01A 3BVTA 4H6HA 4AZBA 1R34A 2PMRA 4AZHA 3O3MB 3B51X 1W9MA 4FZOA 1X03A 4EZUA 5C5BB 4R5LA 1UPXA 4AZGA 2RAIA 5KBPA 1Y2OA 5TKYA 3T46A 3RV1A 3BUIA 4UDYX 2FICA 4AZIA 2YL5A 3ER9B 3ZEDA 4G6QA 3BVXA 3RV0A 2QKWA 1I4LA 3D50A 2ZXQA 2Z0OA 2ND1A 3DYTA 2QXLA 4HYBA 3ACOA 2GAFD 4EZVA 4JNEA 4E81A 3LVTA 4DYLA 2F1BA 3ABHA 3KAWA 3BUPA 4EZTA 2YLLA 4I1QA 2NCZA 3HAIA 2D1LA 4KIKB 2YL6A 3CVRA 1HXKA 2KHOA 4EZNA 3EJUA 3DDGA 1JQKA 1TQSA 4HY9A 4HR1A 1ZWWA 2LXYA 3LLLA 3EJRA 3L3OM 1TQTA 1GNTA 4NSWA 1O7DC 2YI9A 2GF4A 3VKHA 2Z0VA 3M3WA 4EZZA 2V0OA 4AZCA 3EJQA 4H8SA 4WPCA 3OK8A 3QWEA 2YKTA 3LMFA 3T48A 3DPPA 2ND0A 1SUFA 4JN4A 3BVWA 3CAZA 1GNLA 1TQVA 3BVUA 2EFLA 4DCNC 4JWIA 1HWWA 2OBMA 1I4TA 1PS3A 4JNFA 3BUDA 3T47A 4AZ5A 1OA0A 5FLEX 4R5GA 4JWCA 2Z0NA 3Q0KA 2ALWA 2F18A 4AZ6A 1I4DA 2YL8A 3CZSA 3CKDA 3I39X 2JNKA 3D4YA 3FD9A 3BUBA 3F7WA 4D8JA 2YIAA 1DKZA 4FZPA 2O0I1 2GA9D 1SU6A 2LM0A 1LQ7A 2YIVX 4IM0A 1OA1A 1ZYLA 4WPEA 4FZSA 1TQUA 2MI7A 3VEBA 2F7RA 3DX0A 4R5IA 3L3PA 2EWFA 1DKYA 2WINM 2YIBA 3CZNA 3DX3A 4NPHA 3C7NA 2RAJA 2YI8A 4EZSA 4H6IA 2JNSA 4HR1B 3QA8A 2F7OA 1MJGA 4JWDA
chains in the Genus database with same CATH topology
1ZWWA 1X04A 2X3VA 3LLLA 3OK8A 2ELBA 4H8SA 2Z0OA 2C08A 1WDZA 2RAIA 3QWEA 4AKVA 1I49A 2EFLA 3HAJA 4NQIA 1Y2OA 2Z0NA 3DYTA 4NSWA 4DCNC 3SOGA 3QE6A 2X3XA 2RAKA 3Q0KA 4ATMA 5C5BA 2YKTA 3SYVA 1URUA 1I4DA 2RAJA 2FICA 4WPCA 3ACOA 1I4TA 4WPEA 4FZSA 2Z0VA 3Q84A 3M3WA 4DYLA 3I2WA 3CAZA 2V0OA 2X3WA 3ABHA 3HAHA 4AVMA 1I4LA 2Q12A 2Q13A 3QNIA 5C5BB 4BNEA 2EFKA 3PLTA 1X03A 4I1QA 3G9GA 2D4CA 3HAIA 2D1LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZWW A;  1X04 A;  2X3V A;  3LLL A;  3OK8 A;  2ELB A;  4H8S A;  2Z0O A;  2C08 A;  1WDZ A;  2RAI A;  3QWE A;  4AKV A;  1I49 A;  2EFL A;  3HAJ A;  4NQI A;  1Y2O A;  2Z0N A;  3DYT A;  4NSW A;  4DCN C;  3SOG A;  3QE6 A;  2X3X A;  2RAK A;  3Q0K A;  4ATM A;  5C5B A;  2YKT A;  3SYV A;  1URU A;  1I4D A;  2RAJ A;  2FIC A;  4WPC A;  3ACO A;  1I4T A;  4WPE A;  4FZS A;  2Z0V A;  3Q84 A;  3M3W A;  4DYL A;  3I2W A;  3CAZ A;  2V0O A;  2X3W A;  3ABH A;  3HAH A;  4AVM A;  1I4L A;  2Q12 A;  2Q13 A;  3QNI A;  5C5B B;  4BNE A;  2EFK A;  3PLT A;  1X03 A;  4I1Q A;  3G9G A;  2D4C A;  3HAI A;  2D1L A; 
#chains in the Genus database with same CATH topology
 3EJT A;  4AKV A;  1QX1 A;  3HAJ A;  3OWG A;  4R5K A;  4ATM A;  2F7P A;  4AZC B;  1TQW A;  3CV5 A;  1HTY A;  4AVM A;  2Q12 A;  2Q13 A;  2F7Q A;  3G9G A;  1OAO A;  4IWO A;  3DX2 A;  1QWU A;  2X3V A;  3D2E A;  3I04 A;  2F1A A;  4JWE A;  3ERC C;  3T49 A;  4F00 A;  4IWP A;  5E84 A;  3B52 X;  2WYH A;  3SOG A;  3EJS A;  3I01 A;  5C5B A;  3GI7 A;  2WYI A;  4JL9 A;  4EZO A;  3VEA A;  1U00 A;  3I2W A;  2X3W A;  3D52 A;  1SU8 A;  3QNI A;  1E9V A;  2PY6 A;  3T4A G;  2OO2 A;  4UDX X;  3BLB A;  3KAV A;  3DX4 A;  2RT6 A;  1YWM A;  1E1D A;  4AZ7 A;  1E2U A;  2EFK A;  2EX3 B;  3DDF A;  3O3O B;  3BUQ A;  4JLC A;  2D4C A;  4EZP A;  4B9Q A;  2C08 A;  1WDZ A;  2OW7 A;  4NQI A;  5FIG A;  1DKX A;  3SYV A;  1O7D B;  2OZN B;  4KIK A;  1R33 A;  3DPQ A;  3ER8 C;  2OBL A;  4FM3 A;  1GN9 A;  3RPM A;  4IWQ A;  3OHX M;  4BNE A;  3O3N B;  1SU7 A;  4EZQ A;  4IW0 A;  1X04 A;  2ELB A;  1I49 A;  2RAK A;  1URU A;  4E3C A;  4M0M A;  3QNJ A;  3D4Z A;  4EZY A;  3A98 A;  4EZW A;  2Z8Y A;  3PLT A;  2FYV A;  3DPO A;  2X5C A;  3UIT A;  3EJP A;  3KDR A;  4PO2 A;  2YLA A;  1QWN A;  2YL9 A;  4IM3 A;  2N3K A;  4EZR A;  3D51 A;  3QE6 A;  2X3X A;  2QFF A;  3B53 X;  4R5J A;  3Q84 A;  4EZX A;  3BVV A;  3D2F A;  3HAH A;  3DX1 A;  1R5E A;  4IM2 A;  2OW6 A;  4F01 A;  3BVT A;  4H6H A;  4AZB A;  1R34 A;  2PMR A;  4AZH A;  3O3M B;  3B51 X;  1W9M A;  4FZO A;  1X03 A;  4EZU A;  5C5B B;  4R5L A;  1UPX A;  4AZG A;  2RAI A;  5KBP A;  1Y2O A;  5TKY A;  3T46 A;  3RV1 A;  3BUI A;  4UDY X;  2FIC A;  4AZI A;  2YL5 A;  3ER9 B;  3ZED A;  4G6Q A;  3BVX A;  3RV0 A;  2QKW A;  1I4L A;  3D50 A;  2ZXQ A;  2Z0O A;  2ND1 A;  3DYT A;  2QXL A;  4HYB A;  3ACO A;  2GAF D;  4EZV A;  4JNE A;  4E81 A;  3LVT A;  4DYL A;  2F1B A;  3ABH A;  3KAW A;  3BUP A;  4EZT A;  2YLL A;  4I1Q A;  2NCZ A;  3HAI A;  2D1L A;  4KIK B;  2YL6 A;  3CVR A;  1HXK A;  2KHO A;  4EZN A;  3EJU A;  3DDG A;  1JQK A;  1TQS A;  4HY9 A;  4HR1 A;  1ZWW A;  2LXY A;  3LLL A;  3EJR A;  3L3O M;  1TQT A;  1GNT A;  4NSW A;  1O7D C;  2YI9 A;  2GF4 A;  3VKH A;  2Z0V A;  3M3W A;  4EZZ A;  2V0O A;  4AZC A;  3EJQ A;  4H8S A;  4WPC A;  3OK8 A;  3QWE A;  2YKT A;  3LMF A;  3T48 A;  3DPP A;  2ND0 A;  1SUF A;  4JN4 A;  3BVW A;  3CAZ A;  1GNL A;  1TQV A;  3BVU A;  2EFL A;  4DCN C;  4JWI A;  1HWW A;  2OBM A;  1I4T A;  1PS3 A;  4JNF A;  3BUD A;  3T47 A;  4AZ5 A;  1OA0 A;  5FLE X;  4R5G A;  4JWC A;  2Z0N A;  3Q0K A;  2ALW A;  2F18 A;  4AZ6 A;  1I4D A;  2YL8 A;  3CZS A;  3CKD A;  3I39 X;  2JNK A;  3D4Y A;  3FD9 A;  3BUB A;  3F7W A;  4D8J A;  2YIA A;  1DKZ A;  4FZP A;  2O0I 1;  2GA9 D;  1SU6 A;  2LM0 A;  1LQ7 A;  2YIV X;  4IM0 A;  1OA1 A;  1ZYL A;  4WPE A;  4FZS A;  1TQU A;  2MI7 A;  3VEB A;  2F7R A;  3DX0 A;  4R5I A;  3L3P A;  2EWF A;  1DKY A;  2WIN M;  2YIB A;  3CZN A;  3DX3 A;  4NPH A;  3C7N A;  2RAJ A;  2YI8 A;  4EZS A;  4H6I A;  2JNS A;  4HR1 B;  3QA8 A;  2F7O A;  1MJG A;  4JWD A; 
#chains in the Genus database with same CATH homology
 1ZWW A;  1X04 A;  2X3V A;  3LLL A;  3OK8 A;  2ELB A;  4H8S A;  2Z0O A;  2C08 A;  1WDZ A;  2RAI A;  3QWE A;  4AKV A;  1I49 A;  2EFL A;  3HAJ A;  4NQI A;  1Y2O A;  2Z0N A;  3DYT A;  4NSW A;  4DCN C;  3SOG A;  3QE6 A;  2X3X A;  2RAK A;  3Q0K A;  4ATM A;  5C5B A;  2YKT A;  3SYV A;  1URU A;  1I4D A;  2RAJ A;  2FIC A;  4WPC A;  3ACO A;  1I4T A;  4WPE A;  4FZS A;  2Z0V A;  3Q84 A;  3M3W A;  4DYL A;  3I2W A;  3CAZ A;  2V0O A;  2X3W A;  3ABH A;  3HAH A;  4AVM A;  1I4L A;  2Q12 A;  2Q13 A;  3QNI A;  5C5B B;  4BNE A;  2EFK A;  3PLT A;  1X03 A;  4I1Q A;  3G9G A;  2D4C A;  3HAI A;  2D1L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...