1I4DA

Crystal structure analysis of rac1-gdp complexed with arfaptin (p21)
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
200
structure length
188
Chain Sequence
SRTVDLELELQIELLRETKRKYESVLQLGRALTAHLYSLLQTQHALGDAFADLSQKSPELQEEFGYNAETQKLLCKNGETLLGAVNFFVSSINTLVTKTMEDTLMTVKQYEAARLEYDAYRTDLEELSESAQATFQAHRDKYEKLRGDVAIKLKFLEENKIKVMHKQLLLFHNAVSAYFAGNQKQLEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARFAPTIN 2
publication title The structural basis of Arfaptin-mediated cross-talk between Rac and Arf signalling pathways.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 88
structure length 188
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-02-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 1i4dA00
2Z0OA 4FZSA 1I49A 5C5BB 3Q84A 3QWEA 2RAIA 3HAJA 4H8SA 4DCNC 2YKTA 4DYLA 1I4LA 3G9GA 1Y2OA 3ABHA 3CAZA 2Q12A 3QNIA 4WPCA 2Z0VA 3DYTA 2EFKA 3Q0KA 4BNEA 1ZWWA 3HAHA 3OK8A 1URUA 4NSWA 2EFLA 2Z0NA 2D4CA 4I1QA 2RAJA 2X3WA 3SYVA 4AKVA 4ATMA 1I4TA 2C08A 2V0OA 4NQIA 2Q13A 1I4DA 2X3VA 3M3WA 5C5BA 1X03A 3ACOA 2FICA 3HAIA 3LLLA 4AVMA 4WPEA 3PLTA 3SOGA 1WDZA 2RAKA 1X04A 3QE6A 2ELBA 2D1LA 3I2WA 2X3XA
chains in the Genus database with same CATH superfamily
2NCZA 4EZPA 3HAJA 4AZIA 2KHOA 1HWWA 2Q12A 2F1BA 1ZYLA 4AZCB 2JNSA 4G6QA 2OW6A 2YL5A 3I2WA 4IWOA 3QWEA 1YWMA 3KAVA 2YIBA 2YLLA 3BLBA 4JN4A 4WPCA 3EJUA 2O0I1 4IW0A 5E84A 4AZHA 4R5KA 3D2FA 3HAIA 4FZSA 3DX3A 4JNEA 1SU8A 1GNLA 1Y2OA 3I01A 2EFKA 3F7WA 4NSWA 3DPQA 1SU7A 2F1AA 3VEBA 2X5CA 3BUPA 2EWFA 4H8SA 3I39X 3CAZA 3BVXA 3CZNA 4HYBA 3T46A 4AZCA 2RAJA 2ZXQA 4IM2A 2MI7A 2Z8YA 2YL9A 3D52A 3BUBA 4IM0A 4EZWA 1E2UA 3OHXM 1ZWWA 3CKDA 3CZSA 1GN9A 2Z0NA 3M3WA 4IM3A 3LLLA 4R5GA 2WYIA 3D51A 4JWCA 1DKYA 4NPHA 1O7DC 4EZYA 2F7RA 2D4CA 2YIVX 3BVUA 4HR1A 4ATMA 3FD9A 4JLCA 2WINM 4F00A 4EZZA 3DX4A 3L3PA 4F01A 3ZEDA 2RAIA 3O3MB 3VKHA 3RV1A 1TQTA 1TQUA 2GF4A 2OBMA 1R33A 3T47A 4EZNA 3C7NA 1SU6A 4FM3A 3B52X 3T4AG 2YIAA 3ERCC 2D1LA 4H6HA 1QWNA 4D8JA 2PY6A 4B9QA 1I4LA 1DKZA 3RPMA 1QWUA 4EZTA 4R5IA 1OA0A 2F7OA 3DDFA 3D4ZA 3DDGA 1DKXA 4HR1B 4WPEA 4M0MA 1WDZA 1E1DA 3PLTA 4EZXA 1X04A 2OZNB 2YI8A 3ER9B 3O3NB 3B53X 4DCNC 2ALWA 3ABHA 3L3OM 1MJGA 1R5EA 3DX2A 3HAHA 1JQKA 4AKVA 2F7PA 4JL9A 4UDXX 2N3KA 3QE6A 4PO2A 1I49A 3CV5A 2ND1A 1E9VA 3CVRA 3DYTA 4KIKA 3QA8A 2JNKA 2EFLA 3SYVA 1HTYA 5FIGA 1I4DA 2F18A 3EJTA 1R34A 1W9MA 3BVWA 3Q84A 2QXLA 3BUIA 2YKTA 2YLAA 1LQ7A 4DYLA 3A98A 3VEAA 2WYHA 4EZOA 3D50A 2YL8A 3ER8C 2QKWA 2EX3B 5KBPA 2GAFD 1GNTA 4R5JA 5TKYA 3DX0A 3BUDA 3EJRA 2X3XA 3O3OB 4H6IA 5FLEX 3OWGA 2YL6A 4JWDA 3I04A 4FZPA 4AZBA 3Q0KA 4E3CA 1TQWA 2GA9D 3D4YA 3BUQA 4KIKB 2OO2A 2V0OA 3BVTA 5C5BA 1X03A 1TQVA 3SOGA 2Z0OA 3T49A 1OA1A 3DX1A 3D2EA 3EJQA 3EJPA 4AZ6A 3OK8A 1URUA 4I1QA 3LMFA 2FYVA 4AZGA 4IWPA 4AVMA 3DPPA 1TQSA 3EJSA 4EZQA 2F7QA 1UPXA 3T48A 2LM0A 3QNIA 2Z0VA 4EZVA 3KDRA 3LVTA 4HY9A 2RT6A 1I4TA 1PS3A 4UDYX 2YI9A 3ACOA 3GI7A 4R5LA 4IWQA 4EZRA 1HXKA 2ELBA 5C5BB 3BVVA 2ND0A 4AZ7A 3G9GA 4AZ5A 3RV0A 4EZUA 4BNEA 1OAOA 2OBLA 3UITA 2C08A 2Q13A 1U00A 2X3VA 2OW7A 4FZOA 4EZSA 2RAKA 3DPOA 4E81A 1O7DB 1QX1A 4JNFA 2LXYA 4JWEA 3QNJA 3B51X 3KAWA 4JWIA 2PMRA 2X3WA 4NQIA 1SUFA 2FICA 2QFFA
chains in the Genus database with same CATH topology
2Z0OA 4FZSA 1I49A 5C5BB 3Q84A 3QWEA 2RAIA 3HAJA 4H8SA 4DCNC 2YKTA 4DYLA 1I4LA 3G9GA 1Y2OA 3ABHA 3CAZA 2Q12A 3QNIA 4WPCA 2Z0VA 3DYTA 2EFKA 3Q0KA 4BNEA 1ZWWA 3HAHA 3OK8A 1URUA 4NSWA 2EFLA 2Z0NA 2D4CA 4I1QA 2RAJA 2X3WA 3SYVA 4AKVA 4ATMA 1I4TA 2C08A 2V0OA 4NQIA 2Q13A 1I4DA 2X3VA 3M3WA 5C5BA 1X03A 3ACOA 2FICA 3HAIA 3LLLA 4AVMA 4WPEA 3PLTA 3SOGA 1WDZA 2RAKA 1X04A 3QE6A 2ELBA 2D1LA 3I2WA 2X3XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z0O A;  4FZS A;  1I49 A;  5C5B B;  3Q84 A;  3QWE A;  2RAI A;  3HAJ A;  4H8S A;  4DCN C;  2YKT A;  4DYL A;  1I4L A;  3G9G A;  1Y2O A;  3ABH A;  3CAZ A;  2Q12 A;  3QNI A;  4WPC A;  2Z0V A;  3DYT A;  2EFK A;  3Q0K A;  4BNE A;  1ZWW A;  3HAH A;  3OK8 A;  1URU A;  4NSW A;  2EFL A;  2Z0N A;  2D4C A;  4I1Q A;  2RAJ A;  2X3W A;  3SYV A;  4AKV A;  4ATM A;  1I4T A;  2C08 A;  2V0O A;  4NQI A;  2Q13 A;  1I4D A;  2X3V A;  3M3W A;  5C5B A;  1X03 A;  3ACO A;  2FIC A;  3HAI A;  3LLL A;  4AVM A;  4WPE A;  3PLT A;  3SOG A;  1WDZ A;  2RAK A;  1X04 A;  3QE6 A;  2ELB A;  2D1L A;  3I2W A;  2X3X A; 
#chains in the Genus database with same CATH topology
 2NCZ A;  4EZP A;  3HAJ A;  4AZI A;  2KHO A;  1HWW A;  2Q12 A;  2F1B A;  1ZYL A;  4AZC B;  2JNS A;  4G6Q A;  2OW6 A;  2YL5 A;  3I2W A;  4IWO A;  3QWE A;  1YWM A;  3KAV A;  2YIB A;  2YLL A;  3BLB A;  4JN4 A;  4WPC A;  3EJU A;  2O0I 1;  4IW0 A;  5E84 A;  4AZH A;  4R5K A;  3D2F A;  3HAI A;  4FZS A;  3DX3 A;  4JNE A;  1SU8 A;  1GNL A;  1Y2O A;  3I01 A;  2EFK A;  3F7W A;  4NSW A;  3DPQ A;  1SU7 A;  2F1A A;  3VEB A;  2X5C A;  3BUP A;  2EWF A;  4H8S A;  3I39 X;  3CAZ A;  3BVX A;  3CZN A;  4HYB A;  3T46 A;  4AZC A;  2RAJ A;  2ZXQ A;  4IM2 A;  2MI7 A;  2Z8Y A;  2YL9 A;  3D52 A;  3BUB A;  4IM0 A;  4EZW A;  1E2U A;  3OHX M;  1ZWW A;  3CKD A;  3CZS A;  1GN9 A;  2Z0N A;  3M3W A;  4IM3 A;  3LLL A;  4R5G A;  2WYI A;  3D51 A;  4JWC A;  1DKY A;  4NPH A;  1O7D C;  4EZY A;  2F7R A;  2D4C A;  2YIV X;  3BVU A;  4HR1 A;  4ATM A;  3FD9 A;  4JLC A;  2WIN M;  4F00 A;  4EZZ A;  3DX4 A;  3L3P A;  4F01 A;  3ZED A;  2RAI A;  3O3M B;  3VKH A;  3RV1 A;  1TQT A;  1TQU A;  2GF4 A;  2OBM A;  1R33 A;  3T47 A;  4EZN A;  3C7N A;  1SU6 A;  4FM3 A;  3B52 X;  3T4A G;  2YIA A;  3ERC C;  2D1L A;  4H6H A;  1QWN A;  4D8J A;  2PY6 A;  4B9Q A;  1I4L A;  1DKZ A;  3RPM A;  1QWU A;  4EZT A;  4R5I A;  1OA0 A;  2F7O A;  3DDF A;  3D4Z A;  3DDG A;  1DKX A;  4HR1 B;  4WPE A;  4M0M A;  1WDZ A;  1E1D A;  3PLT A;  4EZX A;  1X04 A;  2OZN B;  2YI8 A;  3ER9 B;  3O3N B;  3B53 X;  4DCN C;  2ALW A;  3ABH A;  3L3O M;  1MJG A;  1R5E A;  3DX2 A;  3HAH A;  1JQK A;  4AKV A;  2F7P A;  4JL9 A;  4UDX X;  2N3K A;  3QE6 A;  4PO2 A;  1I49 A;  3CV5 A;  2ND1 A;  1E9V A;  3CVR A;  3DYT A;  4KIK A;  3QA8 A;  2JNK A;  2EFL A;  3SYV A;  1HTY A;  5FIG A;  1I4D A;  2F18 A;  3EJT A;  1R34 A;  1W9M A;  3BVW A;  3Q84 A;  2QXL A;  3BUI A;  2YKT A;  2YLA A;  1LQ7 A;  4DYL A;  3A98 A;  3VEA A;  2WYH A;  4EZO A;  3D50 A;  2YL8 A;  3ER8 C;  2QKW A;  2EX3 B;  5KBP A;  2GAF D;  1GNT A;  4R5J A;  5TKY A;  3DX0 A;  3BUD A;  3EJR A;  2X3X A;  3O3O B;  4H6I A;  5FLE X;  3OWG A;  2YL6 A;  4JWD A;  3I04 A;  4FZP A;  4AZB A;  3Q0K A;  4E3C A;  1TQW A;  2GA9 D;  3D4Y A;  3BUQ A;  4KIK B;  2OO2 A;  2V0O A;  3BVT A;  5C5B A;  1X03 A;  1TQV A;  3SOG A;  2Z0O A;  3T49 A;  1OA1 A;  3DX1 A;  3D2E A;  3EJQ A;  3EJP A;  4AZ6 A;  3OK8 A;  1URU A;  4I1Q A;  3LMF A;  2FYV A;  4AZG A;  4IWP A;  4AVM A;  3DPP A;  1TQS A;  3EJS A;  4EZQ A;  2F7Q A;  1UPX A;  3T48 A;  2LM0 A;  3QNI A;  2Z0V A;  4EZV A;  3KDR A;  3LVT A;  4HY9 A;  2RT6 A;  1I4T A;  1PS3 A;  4UDY X;  2YI9 A;  3ACO A;  3GI7 A;  4R5L A;  4IWQ A;  4EZR A;  1HXK A;  2ELB A;  5C5B B;  3BVV A;  2ND0 A;  4AZ7 A;  3G9G A;  4AZ5 A;  3RV0 A;  4EZU A;  4BNE A;  1OAO A;  2OBL A;  3UIT A;  2C08 A;  2Q13 A;  1U00 A;  2X3V A;  2OW7 A;  4FZO A;  4EZS A;  2RAK A;  3DPO A;  4E81 A;  1O7D B;  1QX1 A;  4JNF A;  2LXY A;  4JWE A;  3QNJ A;  3B51 X;  3KAW A;  4JWI A;  2PMR A;  2X3W A;  4NQI A;  1SUF A;  2FIC A;  2QFF A; 
#chains in the Genus database with same CATH homology
 2Z0O A;  4FZS A;  1I49 A;  5C5B B;  3Q84 A;  3QWE A;  2RAI A;  3HAJ A;  4H8S A;  4DCN C;  2YKT A;  4DYL A;  1I4L A;  3G9G A;  1Y2O A;  3ABH A;  3CAZ A;  2Q12 A;  3QNI A;  4WPC A;  2Z0V A;  3DYT A;  2EFK A;  3Q0K A;  4BNE A;  1ZWW A;  3HAH A;  3OK8 A;  1URU A;  4NSW A;  2EFL A;  2Z0N A;  2D4C A;  4I1Q A;  2RAJ A;  2X3W A;  3SYV A;  4AKV A;  4ATM A;  1I4T A;  2C08 A;  2V0O A;  4NQI A;  2Q13 A;  1I4D A;  2X3V A;  3M3W A;  5C5B A;  1X03 A;  3ACO A;  2FIC A;  3HAI A;  3LLL A;  4AVM A;  4WPE A;  3PLT A;  3SOG A;  1WDZ A;  2RAK A;  1X04 A;  3QE6 A;  2ELB A;  2D1L A;  3I2W A;  2X3X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...