1I4DA

Crystal structure analysis of rac1-gdp complexed with arfaptin (p21)
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
200
structure length
188
Chain Sequence
SRTVDLELELQIELLRETKRKYESVLQLGRALTAHLYSLLQTQHALGDAFADLSQKSPELQEEFGYNAETQKLLCKNGETLLGAVNFFVSSINTLVTKTMEDTLMTVKQYEAARLEYDAYRTDLEELSESAQATFQAHRDKYEKLRGDVAIKLKFLEENKIKVMHKQLLLFHNAVSAYFAGNQKQLEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords ARFAPTIN 2
publication title The structural basis of Arfaptin-mediated cross-talk between Rac and Arf signalling pathways.
pubmed doi rcsb
source organism Homo sapiens
total genus 88
structure length 188
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-02-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 1i4dA00
3PLTA 2Q13A 2RAJA 3HAIA 2D1LA 1X03A 4WPCA 2RAIA 2YKTA 1I4TA 3ACOA 2X3WA 4FZSA 2ELBA 3QNIA 5C5BA 4H8SA 2C08A 2X3XA 4BNEA 1I4LA 3DYTA 3I2WA 4NSWA 3SOGA 2EFLA 3G9GA 1URUA 2Z0NA 3QWEA 2RAKA 3Q84A 4WPEA 1Y2OA 1I4DA 2X3VA 3M3WA 1ZWWA 3CAZA 3HAHA 3Q0KA 4DYLA 1X04A 2D4CA 2Z0OA 3OK8A 4DCNC 2EFKA 2Q12A 4NQIA 2Z0VA 2FICA 1I49A 4AVMA 4I1QA 4AKVA 3QE6A 5C5BB 3LLLA 3ABHA 3HAJA 3SYVA 1WDZA 2V0OA 4ATMA
chains in the Genus database with same CATH superfamily
3PLTA 3ERCC 3T4AG 2C08A 3BVTA 3QA8A 4JNEA 4AZ5A 2YL8A 1ZWWA 1TQUA 4UDYX 3OWGA 3OK8A 4NQIA 1O7DB 2OZNB 2YL6A 4ATMA 2KHOA 3RV0A 2F1AA 3VEAA 3A98A 4JN4A 4FZOA 3Q84A 1MJGA 3BUBA 2YL9A 3DPPA 5C5BB 1DKXA 1R34A 2YIAA 1TQWA 3HAIA 2O0I1 4E3CA 3F7WA 3T46A 2EFLA 3OHXM 2F7RA 4AZIA 3D50A 3HAHA 4KIKA 4AZ7A 1E1DA 1R5EA 3B52X 1SUFA 3T47A 1I49A 4IWOA 4F01A 3EJUA 2V0OA 1JQKA 3VKHA 3DX4A 2MI7A 5FLEX 4EZRA 4H8SA 3BLBA 2GA9D 3M3WA 1U00A 3CZNA 2F7QA 4FZPA 5E84A 4NPHA 3EJPA 1HXKA 5TKYA 1QWUA 2N3KA 1E2UA 3T49A 3DDFA 2X3VA 4R5GA 2WYHA 4EZUA 3EJTA 3KAVA 4HR1A 3ZEDA 4UDXX 1TQSA 2OBLA 2F7PA 1TQTA 3O3NB 3QE6A 4EZXA 1OAOA 3CVRA 2PMRA 2Z8YA 4R5KA 2X3WA 2X3XA 4NSWA 2WINM 2F1BA 3CAZA 3DPOA 4EZYA 4M0MA 3B53X 3QNJA 4EZWA 4PO2A 2YI8A 2QFFA 3ACOA 4FZSA 4KIKB 3KDRA 1I4LA 1DKYA 4JLCA 3L3PA 4D8JA 2JNKA 3UITA 2Z0OA 3BVXA 4JNFA 2EFKA 2Q12A 4FM3A 4IM2A 3DDGA 4B9QA 1TQVA 2GF4A 2WYIA 4JWEA 3LVTA 2YIVX 2RT6A 3DPQA 1GNLA 2RAKA 4JWDA 3B51X 2Z0VA 4HYBA 4IM0A 4AZCA 2LM0A 3HAJA 2JNSA 2OO2A 2ALWA 4AZGA 2D1LA 1X03A 1OA1A 1I4TA 2OBMA 2X5CA 3VEBA 4AZ6A 4EZNA 3FD9A 1SU6A 4IWQA 4AZHA 4R5JA 2FICA 2F18A 3LLLA 3EJRA 3GI7A 2Q13A 3CKDA 4H6IA 2OW7A 3QNIA 3BUQA 4AZBA 1URUA 2Z0NA 2NCZA 2EX3B 3DX3A 4EZSA 1I4DA 4EZZA 2D4CA 3EJSA 1OA0A 3C7NA 4AKVA 3D2EA 3D4YA 3D51A 2QXLA 2YL5A 1YWMA 4WPCA 1QX1A 2ZXQA 4R5LA 4IM3A 3I04A 3DX1A 2YI9A 1X04A 2QKWA 5FIGA 3D2FA 5KBPA 2PY6A 1HTYA 3ER8C 3BUPA 3SYVA 2OW6A 3BVUA 3D52A 3O3MB 3BVWA 4AZCB 2ND1A 1Y2OA 4E81A 3CV5A 2FYVA 4F00A 4IWPA 1W9MA 4EZVA 2ELBA 3I2WA 4EZPA 1GNTA 2F7OA 4G6QA 1HWWA 4H6HA 4DYLA 1E9VA 3BUDA 1SU8A 3BVVA 4JL9A 1GN9A 1WDZA 3EJQA 4EZTA 3T48A 1UPXA 2RAIA 2YKTA 2YIBA 3SOGA 4HR1B 3I01A 3BUIA 4WPEA 2GAFD 4IW0A 4JWIA 4HY9A 4EZOA 3I39X 1SU7A 3LMFA 1PS3A 1DKZA 1R33A 5C5BA 4BNEA 3DYTA 1LQ7A 3RPMA 1QWNA 3ER9B 4R5IA 2EWFA 3KAWA 2YLLA 2ND0A 3L3OM 4AVMA 1O7DC 2RAJA 2YLAA 4EZQA 3G9GA 3QWEA 3O3OB 3Q0KA 3CZSA 1ZYLA 3DX2A 4DCNC 3D4ZA 4JWCA 4I1QA 3RV1A 3ABHA 2LXYA 3DX0A
chains in the Genus database with same CATH topology
3PLTA 2Q13A 2RAJA 3HAIA 2D1LA 1X03A 4WPCA 2RAIA 2YKTA 1I4TA 3ACOA 2X3WA 4FZSA 2ELBA 3QNIA 5C5BA 4H8SA 2C08A 2X3XA 4BNEA 1I4LA 3DYTA 3I2WA 4NSWA 3SOGA 2EFLA 3G9GA 1URUA 2Z0NA 3QWEA 2RAKA 3Q84A 4WPEA 1Y2OA 1I4DA 2X3VA 3M3WA 1ZWWA 3CAZA 3HAHA 3Q0KA 4DYLA 1X04A 2D4CA 2Z0OA 3OK8A 4DCNC 2EFKA 2Q12A 4NQIA 2Z0VA 2FICA 1I49A 4AVMA 4I1QA 4AKVA 3QE6A 5C5BB 3LLLA 3ABHA 3HAJA 3SYVA 1WDZA 2V0OA 4ATMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PLT A;  2Q13 A;  2RAJ A;  3HAI A;  2D1L A;  1X03 A;  4WPC A;  2RAI A;  2YKT A;  1I4T A;  3ACO A;  2X3W A;  4FZS A;  2ELB A;  3QNI A;  5C5B A;  4H8S A;  2C08 A;  2X3X A;  4BNE A;  1I4L A;  3DYT A;  3I2W A;  4NSW A;  3SOG A;  2EFL A;  3G9G A;  1URU A;  2Z0N A;  3QWE A;  2RAK A;  3Q84 A;  4WPE A;  1Y2O A;  1I4D A;  2X3V A;  3M3W A;  1ZWW A;  3CAZ A;  3HAH A;  3Q0K A;  4DYL A;  1X04 A;  2D4C A;  2Z0O A;  3OK8 A;  4DCN C;  2EFK A;  2Q12 A;  4NQI A;  2Z0V A;  2FIC A;  1I49 A;  4AVM A;  4I1Q A;  4AKV A;  3QE6 A;  5C5B B;  3LLL A;  3ABH A;  3HAJ A;  3SYV A;  1WDZ A;  2V0O A;  4ATM A; 
#chains in the Genus database with same CATH topology
 3PLT A;  3ERC C;  3T4A G;  2C08 A;  3BVT A;  3QA8 A;  4JNE A;  4AZ5 A;  2YL8 A;  1ZWW A;  1TQU A;  4UDY X;  3OWG A;  3OK8 A;  4NQI A;  1O7D B;  2OZN B;  2YL6 A;  4ATM A;  2KHO A;  3RV0 A;  2F1A A;  3VEA A;  3A98 A;  4JN4 A;  4FZO A;  3Q84 A;  1MJG A;  3BUB A;  2YL9 A;  3DPP A;  5C5B B;  1DKX A;  1R34 A;  2YIA A;  1TQW A;  3HAI A;  2O0I 1;  4E3C A;  3F7W A;  3T46 A;  2EFL A;  3OHX M;  2F7R A;  4AZI A;  3D50 A;  3HAH A;  4KIK A;  4AZ7 A;  1E1D A;  1R5E A;  3B52 X;  1SUF A;  3T47 A;  1I49 A;  4IWO A;  4F01 A;  3EJU A;  2V0O A;  1JQK A;  3VKH A;  3DX4 A;  2MI7 A;  5FLE X;  4EZR A;  4H8S A;  3BLB A;  2GA9 D;  3M3W A;  1U00 A;  3CZN A;  2F7Q A;  4FZP A;  5E84 A;  4NPH A;  3EJP A;  1HXK A;  5TKY A;  1QWU A;  2N3K A;  1E2U A;  3T49 A;  3DDF A;  2X3V A;  4R5G A;  2WYH A;  4EZU A;  3EJT A;  3KAV A;  4HR1 A;  3ZED A;  4UDX X;  1TQS A;  2OBL A;  2F7P A;  1TQT A;  3O3N B;  3QE6 A;  4EZX A;  1OAO A;  3CVR A;  2PMR A;  2Z8Y A;  4R5K A;  2X3W A;  2X3X A;  4NSW A;  2WIN M;  2F1B A;  3CAZ A;  3DPO A;  4EZY A;  4M0M A;  3B53 X;  3QNJ A;  4EZW A;  4PO2 A;  2YI8 A;  2QFF A;  3ACO A;  4FZS A;  4KIK B;  3KDR A;  1I4L A;  1DKY A;  4JLC A;  3L3P A;  4D8J A;  2JNK A;  3UIT A;  2Z0O A;  3BVX A;  4JNF A;  2EFK A;  2Q12 A;  4FM3 A;  4IM2 A;  3DDG A;  4B9Q A;  1TQV A;  2GF4 A;  2WYI A;  4JWE A;  3LVT A;  2YIV X;  2RT6 A;  3DPQ A;  1GNL A;  2RAK A;  4JWD A;  3B51 X;  2Z0V A;  4HYB A;  4IM0 A;  4AZC A;  2LM0 A;  3HAJ A;  2JNS A;  2OO2 A;  2ALW A;  4AZG A;  2D1L A;  1X03 A;  1OA1 A;  1I4T A;  2OBM A;  2X5C A;  3VEB A;  4AZ6 A;  4EZN A;  3FD9 A;  1SU6 A;  4IWQ A;  4AZH A;  4R5J A;  2FIC A;  2F18 A;  3LLL A;  3EJR A;  3GI7 A;  2Q13 A;  3CKD A;  4H6I A;  2OW7 A;  3QNI A;  3BUQ A;  4AZB A;  1URU A;  2Z0N A;  2NCZ A;  2EX3 B;  3DX3 A;  4EZS A;  1I4D A;  4EZZ A;  2D4C A;  3EJS A;  1OA0 A;  3C7N A;  4AKV A;  3D2E A;  3D4Y A;  3D51 A;  2QXL A;  2YL5 A;  1YWM A;  4WPC A;  1QX1 A;  2ZXQ A;  4R5L A;  4IM3 A;  3I04 A;  3DX1 A;  2YI9 A;  1X04 A;  2QKW A;  5FIG A;  3D2F A;  5KBP A;  2PY6 A;  1HTY A;  3ER8 C;  3BUP A;  3SYV A;  2OW6 A;  3BVU A;  3D52 A;  3O3M B;  3BVW A;  4AZC B;  2ND1 A;  1Y2O A;  4E81 A;  3CV5 A;  2FYV A;  4F00 A;  4IWP A;  1W9M A;  4EZV A;  2ELB A;  3I2W A;  4EZP A;  1GNT A;  2F7O A;  4G6Q A;  1HWW A;  4H6H A;  4DYL A;  1E9V A;  3BUD A;  1SU8 A;  3BVV A;  4JL9 A;  1GN9 A;  1WDZ A;  3EJQ A;  4EZT A;  3T48 A;  1UPX A;  2RAI A;  2YKT A;  2YIB A;  3SOG A;  4HR1 B;  3I01 A;  3BUI A;  4WPE A;  2GAF D;  4IW0 A;  4JWI A;  4HY9 A;  4EZO A;  3I39 X;  1SU7 A;  3LMF A;  1PS3 A;  1DKZ A;  1R33 A;  5C5B A;  4BNE A;  3DYT A;  1LQ7 A;  3RPM A;  1QWN A;  3ER9 B;  4R5I A;  2EWF A;  3KAW A;  2YLL A;  2ND0 A;  3L3O M;  4AVM A;  1O7D C;  2RAJ A;  2YLA A;  4EZQ A;  3G9G A;  3QWE A;  3O3O B;  3Q0K A;  3CZS A;  1ZYL A;  3DX2 A;  4DCN C;  3D4Z A;  4JWC A;  4I1Q A;  3RV1 A;  3ABH A;  2LXY A;  3DX0 A; 
#chains in the Genus database with same CATH homology
 3PLT A;  2Q13 A;  2RAJ A;  3HAI A;  2D1L A;  1X03 A;  4WPC A;  2RAI A;  2YKT A;  1I4T A;  3ACO A;  2X3W A;  4FZS A;  2ELB A;  3QNI A;  5C5B A;  4H8S A;  2C08 A;  2X3X A;  4BNE A;  1I4L A;  3DYT A;  3I2W A;  4NSW A;  3SOG A;  2EFL A;  3G9G A;  1URU A;  2Z0N A;  3QWE A;  2RAK A;  3Q84 A;  4WPE A;  1Y2O A;  1I4D A;  2X3V A;  3M3W A;  1ZWW A;  3CAZ A;  3HAH A;  3Q0K A;  4DYL A;  1X04 A;  2D4C A;  2Z0O A;  3OK8 A;  4DCN C;  2EFK A;  2Q12 A;  4NQI A;  2Z0V A;  2FIC A;  1I49 A;  4AVM A;  4I1Q A;  4AKV A;  3QE6 A;  5C5B B;  3LLL A;  3ABH A;  3HAJ A;  3SYV A;  1WDZ A;  2V0O A;  4ATM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...