5FIGA

Apo-csp3 (copper storage protein 3) from bacillus subtilis
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
105
structure length
100
Chain Sequence
b'YSEACIEACIDCMKACNHCFTKCLEHLSGCIRLDRECADICALAVKAMQTDSPFMKEICALCADICEACGTECGKHDHDHCQACAKACFTCAEQCRSMAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CSP3
publication title Bacterial cytosolic proteins with a high capacity for Cu(I) that protect against copper toxicity.
pubmed doi rcsb
molecule tags Copper-binding protein
total genus 46
structure length 100
sequence length 105
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03860 DUF326 Domain of Unknown Function (DUF326)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.360 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 5figA00
3LMFA 5FIGA 3KAWA 3KAVA
chains in the Genus database with same CATH superfamily
3HAIA 2QFFA 3KAWA 3SOGA 3EJTA 4AZ7A 5C5BB 4JLCA 3RV0A 4HR1B 3DDFA 4EZSA 1ZYLA 3BVUA 1SU6A 4R5KA 3L3OM 3DPPA 4UDXX 3KAVA 3EJSA 2N3KA 2YL9A 4R5GA 2X3WA 3OK8A 4KIKB 3M3WA 3RPMA 3O3NB 1SU7A 2Z0NA 5FIGA 4F01A 4EZPA 1X03A 1DKYA 1O7DC 5C5BA 2NCZA 2PY6A 4JWEA 4IWQA 2EFKA 4AVMA 1R5EA 3DPQA 2EX3B 3T48A 2GF4A 2X5CA 4IM2A 3ER8C 2GA9D 1SUFA 4IM3A 3BLBA 3VEAA 3CZSA 1TQTA 4JWIA 3OHXM 4JWCA 2OO2A 2ZXQA 3Q84A 2Q12A 2EWFA 3T46A 1UPXA 3OWGA 4KIKA 4F00A 4FZPA 3HAHA 5FLEX 2F7RA 1ZWWA 4EZWA 2Z8YA 3DX0A 3B53X 2FYVA 3UITA 2YI9A 3BUBA 3VKHA 2LXYA 4R5JA 3EJQA 3DX3A 2OZNB 3ERCC 1QWUA 2Z0OA 4UDYX 3T49A 2O0I1 4EZXA 3EJUA 2ALWA 3C7NA 2KHOA 4EZZA 2JNSA 3A98A 2LM0A 3I2WA 4I1QA 2Q13A 3KDRA 4EZTA 3QNIA 4AZ5A 1R34A 4IWOA 3I04A 4EZVA 4IM0A 3BVVA 4M0MA 3I01A 1MJGA 4DCNC 4AZCB 3O3OB 4JWDA 2OW7A 3EJPA 4JNEA 2GAFD 2F7QA 2PMRA 2YIVX 5TKYA 2YL8A 1E2UA 4HR1A 4JNFA 4AZHA 2YLAA 3QNJA 4AZ6A 2ELBA 1TQWA 1I4TA 2C08A 1GN9A 3QWEA 3EJRA 4JN4A 2Z0VA 1GNTA 2WYIA 1HTYA 4NQIA 4EZYA 1DKXA 3CKDA 3DPOA 3T47A 3DDGA 3DX4A 2X3XA 3CAZA 3F7WA 2ND1A 3CZNA 3DX1A 3HAJA 4JL9A 4PO2A 3D2EA 3BVTA 4AKVA 1DKZA 4AZBA 2YIBA 4WPCA 3RV1A 4EZNA 2V0OA 3BVXA 3B51X 3D50A 3LLLA 1E9VA 2EFLA 1WDZA 3BUIA 1O7DB 1TQUA 4EZOA 1JQKA 2RAJA 2OBMA 1TQVA 2RAIA 4AZGA 3D4YA 3Q0KA 2F1BA 1GNLA 2YL5A 4HYBA 2ND0A 3ABHA 2MI7A 3PLTA 4AZIA 2YIAA 3CV5A 2RT6A 2FICA 4FZSA 2YL6A 4E3CA 4EZQA 4E81A 1TQSA 1QX1A 3VEBA 2JNKA 2QKWA 1R33A 1I49A 4WPEA 4EZRA 4EZUA 1URUA 2QXLA 1I4LA 4NSWA 5E84A 3O3MB 4D8JA 1YWMA 2YLLA 3BUQA 4NPHA 2D1LA 2WINM 2F1AA 4H8SA 3G9GA 4FM3A 4DYLA 2YKTA 1Y2OA 1X04A 3T4AG 3B52X 4IWPA 4G6QA 1I4DA 3DYTA 3DX2A 3LVTA 3D4ZA 3BUDA 4AZCA 2F7PA 3ACOA 1SU8A 1OA0A 1U00A 2RAKA 2D4CA 4H6HA 3ZEDA 5KBPA 1LQ7A 1HXKA 4R5LA 3BUPA 2X3VA 3D51A 4R5IA 4B9QA 3D52A 1E1DA 1OA1A 1QWNA 3BVWA 1OAOA 2OBLA 1HWWA 3QA8A 4FZOA 2F7OA 1W9MA 2F18A 3LMFA 3ER9B 3GI7A 3QE6A 4BNEA 3I39X 3CVRA 2OW6A 1PS3A 4H6IA 3L3PA 2WYHA 4HY9A 4ATMA 3FD9A 3D2FA 2YI8A 4IW0A 3SYVA
chains in the Genus database with same CATH topology
4EZUA 2QXLA 2QFFA 4JN4A 3UITA 3KAWA 2YI9A 1GNTA 5E84A 3O3MB 3VKHA 4D8JA 4NPHA 4R5JA 2WINM 4JLCA 4EZYA 1DKXA 3DPOA 3T47A 3ERCC 3F7WA 4FM3A 4HR1B 3RV0A 4EZSA 4UDYX 2ND1A 1ZYLA 1SU6A 4JL9A 4R5KA 4PO2A 3T4AG 3T49A 3B52X 4EZXA 3D2EA 3L3OM 4IWPA 1DKZA 3DPPA 3C7NA 4G6QA 2KHOA 2YIBA 4UDXX 3KAVA 2JNSA 4EZZA 2N3KA 3A98A 3RV1A 2LM0A 4EZNA 4R5GA 4KIKB 3B51X 3KDRA 4EZTA 1E9VA 3O3NB 1SU7A 1SU8A 5FIGA 4IWOA 1OA0A 4F01A 4EZPA 1U00A 3I04A 1DKYA 4H6HA 3ZEDA 4EZOA 1JQKA 2NCZA 2OBMA 2PY6A 4R5LA 4JWEA 4EZVA 4IM0A 4IWQA 4R5IA 4B9QA 3DPQA 4M0MA 1E1DA 1GNLA 3I01A 1OA1A 2EX3B 1MJGA 4HYBA 1OAOA 2ND0A 3T48A 2OBLA 2X5CA 3O3OB 4IM2A 3QA8A 2YIAA 2RT6A 2GA9D 3LMFA 1SUFA 1W9MA 4IM3A 3ER8C 3ER9B 3GI7A 3VEAA 4JWDA 4JNEA 3I39X 2GAFD 4E3CA 4JWIA 4E81A 4EZQA 3OHXM 4JWCA 2YIVX 2EWFA 3T46A 3VEBA 5TKYA 1UPXA 1E2UA 3OWGA 4KIKA 4F00A 4HR1A 4H6IA 4JNFA 5FLEX 3QNJA 4HY9A 4EZWA 2Z8YA 3FD9A 3D2FA 2YI8A 1GN9A 4IW0A 3B53X 4EZRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LMF A;  5FIG A;  3KAW A;  3KAV A; 
#chains in the Genus database with same CATH topology
 3HAI A;  2QFF A;  3KAW A;  3SOG A;  3EJT A;  4AZ7 A;  5C5B B;  4JLC A;  3RV0 A;  4HR1 B;  3DDF A;  4EZS A;  1ZYL A;  3BVU A;  1SU6 A;  4R5K A;  3L3O M;  3DPP A;  4UDX X;  3KAV A;  3EJS A;  2N3K A;  2YL9 A;  4R5G A;  2X3W A;  3OK8 A;  4KIK B;  3M3W A;  3RPM A;  3O3N B;  1SU7 A;  2Z0N A;  5FIG A;  4F01 A;  4EZP A;  1X03 A;  1DKY A;  1O7D C;  5C5B A;  2NCZ A;  2PY6 A;  4JWE A;  4IWQ A;  2EFK A;  4AVM A;  1R5E A;  3DPQ A;  2EX3 B;  3T48 A;  2GF4 A;  2X5C A;  4IM2 A;  3ER8 C;  2GA9 D;  1SUF A;  4IM3 A;  3BLB A;  3VEA A;  3CZS A;  1TQT A;  4JWI A;  3OHX M;  4JWC A;  2OO2 A;  2ZXQ A;  3Q84 A;  2Q12 A;  2EWF A;  3T46 A;  1UPX A;  3OWG A;  4KIK A;  4F00 A;  4FZP A;  3HAH A;  5FLE X;  2F7R A;  1ZWW A;  4EZW A;  2Z8Y A;  3DX0 A;  3B53 X;  2FYV A;  3UIT A;  2YI9 A;  3BUB A;  3VKH A;  2LXY A;  4R5J A;  3EJQ A;  3DX3 A;  2OZN B;  3ERC C;  1QWU A;  2Z0O A;  4UDY X;  3T49 A;  2O0I 1;  4EZX A;  3EJU A;  2ALW A;  3C7N A;  2KHO A;  4EZZ A;  2JNS A;  3A98 A;  2LM0 A;  3I2W A;  4I1Q A;  2Q13 A;  3KDR A;  4EZT A;  3QNI A;  4AZ5 A;  1R34 A;  4IWO A;  3I04 A;  4EZV A;  4IM0 A;  3BVV A;  4M0M A;  3I01 A;  1MJG A;  4DCN C;  4AZC B;  3O3O B;  4JWD A;  2OW7 A;  3EJP A;  4JNE A;  2GAF D;  2F7Q A;  2PMR A;  2YIV X;  5TKY A;  2YL8 A;  1E2U A;  4HR1 A;  4JNF A;  4AZH A;  2YLA A;  3QNJ A;  4AZ6 A;  2ELB A;  1TQW A;  1I4T A;  2C08 A;  1GN9 A;  3QWE A;  3EJR A;  4JN4 A;  2Z0V A;  1GNT A;  2WYI A;  1HTY A;  4NQI A;  4EZY A;  1DKX A;  3CKD A;  3DPO A;  3T47 A;  3DDG A;  3DX4 A;  2X3X A;  3CAZ A;  3F7W A;  2ND1 A;  3CZN A;  3DX1 A;  3HAJ A;  4JL9 A;  4PO2 A;  3D2E A;  3BVT A;  4AKV A;  1DKZ A;  4AZB A;  2YIB A;  4WPC A;  3RV1 A;  4EZN A;  2V0O A;  3BVX A;  3B51 X;  3D50 A;  3LLL A;  1E9V A;  2EFL A;  1WDZ A;  3BUI A;  1O7D B;  1TQU A;  4EZO A;  1JQK A;  2RAJ A;  2OBM A;  1TQV A;  2RAI A;  4AZG A;  3D4Y A;  3Q0K A;  2F1B A;  1GNL A;  2YL5 A;  4HYB A;  2ND0 A;  3ABH A;  2MI7 A;  3PLT A;  4AZI A;  2YIA A;  3CV5 A;  2RT6 A;  2FIC A;  4FZS A;  2YL6 A;  4E3C A;  4EZQ A;  4E81 A;  1TQS A;  1QX1 A;  3VEB A;  2JNK A;  2QKW A;  1R33 A;  1I49 A;  4WPE A;  4EZR A;  4EZU A;  1URU A;  2QXL A;  1I4L A;  4NSW A;  5E84 A;  3O3M B;  4D8J A;  1YWM A;  2YLL A;  3BUQ A;  4NPH A;  2D1L A;  2WIN M;  2F1A A;  4H8S A;  3G9G A;  4FM3 A;  4DYL A;  2YKT A;  1Y2O A;  1X04 A;  3T4A G;  3B52 X;  4IWP A;  4G6Q A;  1I4D A;  3DYT A;  3DX2 A;  3LVT A;  3D4Z A;  3BUD A;  4AZC A;  2F7P A;  3ACO A;  1SU8 A;  1OA0 A;  1U00 A;  2RAK A;  2D4C A;  4H6H A;  3ZED A;  5KBP A;  1LQ7 A;  1HXK A;  4R5L A;  3BUP A;  2X3V A;  3D51 A;  4R5I A;  4B9Q A;  3D52 A;  1E1D A;  1OA1 A;  1QWN A;  3BVW A;  1OAO A;  2OBL A;  1HWW A;  3QA8 A;  4FZO A;  2F7O A;  1W9M A;  2F18 A;  3LMF A;  3ER9 B;  3GI7 A;  3QE6 A;  4BNE A;  3I39 X;  3CVR A;  2OW6 A;  1PS3 A;  4H6I A;  3L3P A;  2WYH A;  4HY9 A;  4ATM A;  3FD9 A;  3D2F A;  2YI8 A;  4IW0 A;  3SYV A; 
#chains in the Genus database with same CATH homology
 4EZU A;  2QXL A;  2QFF A;  4JN4 A;  3UIT A;  3KAW A;  2YI9 A;  1GNT A;  5E84 A;  3O3M B;  3VKH A;  4D8J A;  4NPH A;  4R5J A;  2WIN M;  4JLC A;  4EZY A;  1DKX A;  3DPO A;  3T47 A;  3ERC C;  3F7W A;  4FM3 A;  4HR1 B;  3RV0 A;  4EZS A;  4UDY X;  2ND1 A;  1ZYL A;  1SU6 A;  4JL9 A;  4R5K A;  4PO2 A;  3T4A G;  3T49 A;  3B52 X;  4EZX A;  3D2E A;  3L3O M;  4IWP A;  1DKZ A;  3DPP A;  3C7N A;  4G6Q A;  2KHO A;  2YIB A;  4UDX X;  3KAV A;  2JNS A;  4EZZ A;  2N3K A;  3A98 A;  3RV1 A;  2LM0 A;  4EZN A;  4R5G A;  4KIK B;  3B51 X;  3KDR A;  4EZT A;  1E9V A;  3O3N B;  1SU7 A;  1SU8 A;  5FIG A;  4IWO A;  1OA0 A;  4F01 A;  4EZP A;  1U00 A;  3I04 A;  1DKY A;  4H6H A;  3ZED A;  4EZO A;  1JQK A;  2NCZ A;  2OBM A;  2PY6 A;  4R5L A;  4JWE A;  4EZV A;  4IM0 A;  4IWQ A;  4R5I A;  4B9Q A;  3DPQ A;  4M0M A;  1E1D A;  1GNL A;  3I01 A;  1OA1 A;  2EX3 B;  1MJG A;  4HYB A;  1OAO A;  2ND0 A;  3T48 A;  2OBL A;  2X5C A;  3O3O B;  4IM2 A;  3QA8 A;  2YIA A;  2RT6 A;  2GA9 D;  3LMF A;  1SUF A;  1W9M A;  4IM3 A;  3ER8 C;  3ER9 B;  3GI7 A;  3VEA A;  4JWD A;  4JNE A;  3I39 X;  2GAF D;  4E3C A;  4JWI A;  4E81 A;  4EZQ A;  3OHX M;  4JWC A;  2YIV X;  2EWF A;  3T46 A;  3VEB A;  5TKY A;  1UPX A;  1E2U A;  3OWG A;  4KIK A;  4F00 A;  4HR1 A;  4H6I A;  4JNF A;  5FLE X;  3QNJ A;  4HY9 A;  4EZW A;  2Z8Y A;  3FD9 A;  3D2F A;  2YI8 A;  1GN9 A;  4IW0 A;  3B53 X;  4EZR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...