5FIGA

Apo-csp3 (copper storage protein 3) from bacillus subtilis
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
105
structure length
100
Chain Sequence
YSEACIEACIDCMKACNHCFTKCLEHLSGCIRLDRECADICALAVKAMQTDSPFMKEICALCADICEACGTECGKHDHDHCQACAKACFTCAEQCRSMAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Copper-binding protein
molecule keywords CSP3
publication title Bacterial cytosolic proteins with a high capacity for Cu(I) that protect against copper toxicity.
pubmed doi rcsb
total genus 46
structure length 100
sequence length 105
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03860 DUF326 Domain of Unknown Function (DUF326)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.360 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 5figA00
3KAVA 5FIGA 3KAWA 3LMFA
chains in the Genus database with same CATH superfamily
3SYVA 2EFLA 2QXLA 2C08A 2F7RA 3O3NB 2KHOA 4R5IA 1X03A 2F1BA 4NSWA 3DDGA 4JNEA 3BVVA 1HWWA 4KIKB 4EZWA 3B52X 3ER8C 2PMRA 2NCZA 2X3WA 3DX4A 3DPPA 4R5JA 3BVXA 1OA1A 3BUIA 3T47A 4JWIA 4F01A 4G6QA 3QE6A 4AZGA 1QWUA 4WPCA 1HTYA 4I1QA 2F7OA 1QWNA 3EJUA 4EZSA 3LMFA 2F7PA 3F7WA 4IM0A 2YLAA 4UDXX 1TQVA 3BVUA 4JWDA 1I4TA 4EZXA 4R5LA 3LVTA 2OBMA 2YIAA 2YKTA 3DPQA 2RAIA 4EZQA 2O0I1 1R34A 1U00A 3QWEA 3BVTA 3KAVA 3L3PA 1OAOA 2YI8A 2RAKA 1ZYLA 1GN9A 2GAFD 4EZRA 4EZOA 2ELBA 2YL6A 4AZIA 4AZCB 4EZPA 3DDFA 1LQ7A 2EWFA 3RPMA 4JL9A 4AZ7A 2OBLA 4AZHA 1I4LA 3ABHA 2OO2A 3CZNA 3EJQA 1QX1A 4FZOA 3CKDA 2YL5A 1O7DB 4JN4A 4HR1A 2RT6A 4ATMA 3EJSA 3DX3A 4HY9A 4AKVA 5KBPA 3DX0A 2YIBA 4M0MA 1TQUA 1SU6A 2JNSA 2D1LA 3OWGA 4H6IA 1DKXA 3FD9A 3HAJA 3EJPA 1E9VA 2YL8A 4EZZA 3VEBA 2Z8YA 2WINM 3BVWA 3D2FA 4IW0A 3CZSA 1SU7A 1GNTA 4AZ6A 3OK8A 5E84A 3HAIA 1W9MA 1TQSA 4EZVA 2QFFA 1HXKA 3C7NA 3G9GA 4E81A 3D50A 2ND0A 3PLTA 4EZNA 3CVRA 3D2EA 3B51X 2ZXQA 1OA0A 2LXYA 3HAHA 2Q13A 3QNJA 3EJTA 4AVMA 4EZUA 1GNLA 4WPEA 3DX1A 4EZYA 3CAZA 3M3WA 3T49A 4IWQA 2YIVX 5FLEX 2JNKA 3L3OM 3Q84A 3O3OB 3BUPA 1MJGA 3A98A 2OW7A 3DX2A 2EFKA 2QKWA 4D8JA 2Q12A 3T4AG 1PS3A 3I39X 3QNIA 4AZBA 3Q0KA 1E1DA 2EX3B 3BUBA 1DKZA 4B9QA 4AZCA 3BUDA 5C5BA 2PY6A 1X04A 5TKYA 4R5GA 4UDYX 4FM3A 4F00A 3RV0A 1R5EA 4JWCA 2Z0OA 4IWPA 1TQWA 3OHXM 4NQIA 3B53X 4PO2A 2GA9D 3BLBA 4H8SA 2OW6A 2FICA 2ND1A 2X3VA 3ERCC 4KIKA 1DKYA 2ALWA 2RAJA 4HR1B 4DCNC 2Z0VA 3KAWA 1Y2OA 3DPOA 3SOGA 2OZNB 3VEAA 3I01A 2YLLA 3O3MB 4E3CA 1SUFA 3KDRA 2D4CA 3LLLA 1E2UA 4FZSA 1JQKA 1WDZA 2GF4A 4JNFA 3T48A 3D51A 4NPHA 3DYTA 3ZEDA 1TQTA 1I49A 1ZWWA 1R33A 2F1AA 4JLCA 4BNEA 4DYLA 2F7QA 3UITA 4R5KA 1URUA 5FIGA 2Z0NA 4AZ5A 4HYBA 2N3KA 3ACOA 3BUQA 3RV1A 3D4ZA 3I04A 3EJRA 4IM2A 4IWOA 1SU8A 4IM3A 2MI7A 4H6HA 3QA8A 2WYHA 1UPXA 1I4DA 2F18A 2X3XA 3ER9B 2YL9A 2X5CA 1O7DC 4JWEA 1YWMA 4FZPA 2YI9A 4EZTA 2WYIA 3D52A 2FYVA 3VKHA 2V0OA 3CV5A 2LM0A 5C5BB 3D4YA 3GI7A 3I2WA 3T46A
chains in the Genus database with same CATH topology
2YI8A 3QNJA 1ZYLA 4NPHA 4EZUA 1GNLA 2QXLA 1GN9A 3ZEDA 2GAFD 4EZRA 3O3NB 4EZOA 2KHOA 4EZYA 4JLCA 4R5IA 3T49A 4EZPA 4IWQA 2YIVX 5FLEX 4JNEA 3UITA 3L3OM 4KIKB 4EZWA 3B52X 4R5KA 3ER8C 5FIGA 3O3OB 2EWFA 2NCZA 1MJGA 2N3KA 4HYBA 3A98A 4JL9A 3DPPA 4R5JA 2OBLA 3RV1A 4D8JA 1OA1A 3T4AG 3I04A 3T47A 3I39X 4JN4A 4JWIA 4IM2A 4HR1A 4F01A 4IWOA 2RT6A 1SU8A 1E1DA 2EX3B 4IM3A 4H6HA 3QA8A 1DKZA 4G6QA 4HY9A 4B9QA 1UPXA 2PY6A 5TKYA 4R5GA 2YIBA 4UDYX 4M0MA 4FM3A 4F00A 3RV0A 3ER9B 4JWCA 4IWPA 2X5CA 4EZSA 3OHXM 1SU6A 2JNSA 3LMFA 3B53X 3F7WA 4PO2A 3OWGA 4H6IA 4IM0A 4UDXX 1DKXA 3FD9A 4JWEA 2GA9D 1E9VA 2YI9A 4EZZA 3VEBA 2Z8YA 4EZTA 2ND1A 3ERCC 2WINM 4JWDA 4KIKA 1DKYA 4EZXA 3D2FA 4IW0A 4R5LA 1SU7A 2OBMA 2YIAA 4HR1B 1GNTA 3KAWA 3DPOA 3DPQA 5E84A 3VKHA 1W9MA 4EZVA 3VEAA 2QFFA 3I01A 3O3MB 2LM0A 4E3CA 1SUFA 4EZQA 3C7NA 4E81A 2ND0A 3KDRA 4EZNA 1E2UA 1U00A 1JQKA 3D2EA 4JNFA 3B51X 1OA0A 3KAVA 1OAOA 3GI7A 3T48A 3T46A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KAV A;  5FIG A;  3KAW A;  3LMF A; 
#chains in the Genus database with same CATH topology
 3SYV A;  2EFL A;  2QXL A;  2C08 A;  2F7R A;  3O3N B;  2KHO A;  4R5I A;  1X03 A;  2F1B A;  4NSW A;  3DDG A;  4JNE A;  3BVV A;  1HWW A;  4KIK B;  4EZW A;  3B52 X;  3ER8 C;  2PMR A;  2NCZ A;  2X3W A;  3DX4 A;  3DPP A;  4R5J A;  3BVX A;  1OA1 A;  3BUI A;  3T47 A;  4JWI A;  4F01 A;  4G6Q A;  3QE6 A;  4AZG A;  1QWU A;  4WPC A;  1HTY A;  4I1Q A;  2F7O A;  1QWN A;  3EJU A;  4EZS A;  3LMF A;  2F7P A;  3F7W A;  4IM0 A;  2YLA A;  4UDX X;  1TQV A;  3BVU A;  4JWD A;  1I4T A;  4EZX A;  4R5L A;  3LVT A;  2OBM A;  2YIA A;  2YKT A;  3DPQ A;  2RAI A;  4EZQ A;  2O0I 1;  1R34 A;  1U00 A;  3QWE A;  3BVT A;  3KAV A;  3L3P A;  1OAO A;  2YI8 A;  2RAK A;  1ZYL A;  1GN9 A;  2GAF D;  4EZR A;  4EZO A;  2ELB A;  2YL6 A;  4AZI A;  4AZC B;  4EZP A;  3DDF A;  1LQ7 A;  2EWF A;  3RPM A;  4JL9 A;  4AZ7 A;  2OBL A;  4AZH A;  1I4L A;  3ABH A;  2OO2 A;  3CZN A;  3EJQ A;  1QX1 A;  4FZO A;  3CKD A;  2YL5 A;  1O7D B;  4JN4 A;  4HR1 A;  2RT6 A;  4ATM A;  3EJS A;  3DX3 A;  4HY9 A;  4AKV A;  5KBP A;  3DX0 A;  2YIB A;  4M0M A;  1TQU A;  1SU6 A;  2JNS A;  2D1L A;  3OWG A;  4H6I A;  1DKX A;  3FD9 A;  3HAJ A;  3EJP A;  1E9V A;  2YL8 A;  4EZZ A;  3VEB A;  2Z8Y A;  2WIN M;  3BVW A;  3D2F A;  4IW0 A;  3CZS A;  1SU7 A;  1GNT A;  4AZ6 A;  3OK8 A;  5E84 A;  3HAI A;  1W9M A;  1TQS A;  4EZV A;  2QFF A;  1HXK A;  3C7N A;  3G9G A;  4E81 A;  3D50 A;  2ND0 A;  3PLT A;  4EZN A;  3CVR A;  3D2E A;  3B51 X;  2ZXQ A;  1OA0 A;  2LXY A;  3HAH A;  2Q13 A;  3QNJ A;  3EJT A;  4AVM A;  4EZU A;  1GNL A;  4WPE A;  3DX1 A;  4EZY A;  3CAZ A;  3M3W A;  3T49 A;  4IWQ A;  2YIV X;  5FLE X;  2JNK A;  3L3O M;  3Q84 A;  3O3O B;  3BUP A;  1MJG A;  3A98 A;  2OW7 A;  3DX2 A;  2EFK A;  2QKW A;  4D8J A;  2Q12 A;  3T4A G;  1PS3 A;  3I39 X;  3QNI A;  4AZB A;  3Q0K A;  1E1D A;  2EX3 B;  3BUB A;  1DKZ A;  4B9Q A;  4AZC A;  3BUD A;  5C5B A;  2PY6 A;  1X04 A;  5TKY A;  4R5G A;  4UDY X;  4FM3 A;  4F00 A;  3RV0 A;  1R5E A;  4JWC A;  2Z0O A;  4IWP A;  1TQW A;  3OHX M;  4NQI A;  3B53 X;  4PO2 A;  2GA9 D;  3BLB A;  4H8S A;  2OW6 A;  2FIC A;  2ND1 A;  2X3V A;  3ERC C;  4KIK A;  1DKY A;  2ALW A;  2RAJ A;  4HR1 B;  4DCN C;  2Z0V A;  3KAW A;  1Y2O A;  3DPO A;  3SOG A;  2OZN B;  3VEA A;  3I01 A;  2YLL A;  3O3M B;  4E3C A;  1SUF A;  3KDR A;  2D4C A;  3LLL A;  1E2U A;  4FZS A;  1JQK A;  1WDZ A;  2GF4 A;  4JNF A;  3T48 A;  3D51 A;  4NPH A;  3DYT A;  3ZED A;  1TQT A;  1I49 A;  1ZWW A;  1R33 A;  2F1A A;  4JLC A;  4BNE A;  4DYL A;  2F7Q A;  3UIT A;  4R5K A;  1URU A;  5FIG A;  2Z0N A;  4AZ5 A;  4HYB A;  2N3K A;  3ACO A;  3BUQ A;  3RV1 A;  3D4Z A;  3I04 A;  3EJR A;  4IM2 A;  4IWO A;  1SU8 A;  4IM3 A;  2MI7 A;  4H6H A;  3QA8 A;  2WYH A;  1UPX A;  1I4D A;  2F18 A;  2X3X A;  3ER9 B;  2YL9 A;  2X5C A;  1O7D C;  4JWE A;  1YWM A;  4FZP A;  2YI9 A;  4EZT A;  2WYI A;  3D52 A;  2FYV A;  3VKH A;  2V0O A;  3CV5 A;  2LM0 A;  5C5B B;  3D4Y A;  3GI7 A;  3I2W A;  3T46 A; 
#chains in the Genus database with same CATH homology
 2YI8 A;  3QNJ A;  1ZYL A;  4NPH A;  4EZU A;  1GNL A;  2QXL A;  1GN9 A;  3ZED A;  2GAF D;  4EZR A;  3O3N B;  4EZO A;  2KHO A;  4EZY A;  4JLC A;  4R5I A;  3T49 A;  4EZP A;  4IWQ A;  2YIV X;  5FLE X;  4JNE A;  3UIT A;  3L3O M;  4KIK B;  4EZW A;  3B52 X;  4R5K A;  3ER8 C;  5FIG A;  3O3O B;  2EWF A;  2NCZ A;  1MJG A;  2N3K A;  4HYB A;  3A98 A;  4JL9 A;  3DPP A;  4R5J A;  2OBL A;  3RV1 A;  4D8J A;  1OA1 A;  3T4A G;  3I04 A;  3T47 A;  3I39 X;  4JN4 A;  4JWI A;  4IM2 A;  4HR1 A;  4F01 A;  4IWO A;  2RT6 A;  1SU8 A;  1E1D A;  2EX3 B;  4IM3 A;  4H6H A;  3QA8 A;  1DKZ A;  4G6Q A;  4HY9 A;  4B9Q A;  1UPX A;  2PY6 A;  5TKY A;  4R5G A;  2YIB A;  4UDY X;  4M0M A;  4FM3 A;  4F00 A;  3RV0 A;  3ER9 B;  4JWC A;  4IWP A;  2X5C A;  4EZS A;  3OHX M;  1SU6 A;  2JNS A;  3LMF A;  3B53 X;  3F7W A;  4PO2 A;  3OWG A;  4H6I A;  4IM0 A;  4UDX X;  1DKX A;  3FD9 A;  4JWE A;  2GA9 D;  1E9V A;  2YI9 A;  4EZZ A;  3VEB A;  2Z8Y A;  4EZT A;  2ND1 A;  3ERC C;  2WIN M;  4JWD A;  4KIK A;  1DKY A;  4EZX A;  3D2F A;  4IW0 A;  4R5L A;  1SU7 A;  2OBM A;  2YIA A;  4HR1 B;  1GNT A;  3KAW A;  3DPO A;  3DPQ A;  5E84 A;  3VKH A;  1W9M A;  4EZV A;  3VEA A;  2QFF A;  3I01 A;  3O3M B;  2LM0 A;  4E3C A;  1SUF A;  4EZQ A;  3C7N A;  4E81 A;  2ND0 A;  3KDR A;  4EZN A;  1E2U A;  1U00 A;  1JQK A;  3D2E A;  4JNF A;  3B51 X;  1OA0 A;  3KAV A;  1OAO A;  3GI7 A;  3T48 A;  3T46 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...