5FIGA

Apo-csp3 (copper storage protein 3) from bacillus subtilis
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
105
structure length
100
Chain Sequence
YSEACIEACIDCMKACNHCFTKCLEHLSGCIRLDRECADICALAVKAMQTDSPFMKEICALCADICEACGTECGKHDHDHCQACAKACFTCAEQCRSMAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CSP3
publication title Bacterial cytosolic proteins with a high capacity for Cu(I) that protect against copper toxicity.
pubmed doi rcsb
molecule tags Copper-binding protein
total genus 46
structure length 100
sequence length 105
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03860 DUF326 Domain of Unknown Function (DUF326)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.360 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 5figA00
3LMFA 3KAVA 5FIGA 3KAWA
chains in the Genus database with same CATH superfamily
4F00A 4H6IA 2X3VA 3EJSA 4F01A 3BUQA 3B53X 2JNSA 4JNFA 4IM3A 3ABHA 1DKZA 3EJTA 2YIVX 4AVMA 3BVXA 2D1LA 4KIKB 3C7NA 1OA0A 1R34A 4R5LA 2RAIA 2F7PA 1DKYA 3ACOA 4JN4A 4AZBA 1SU8A 1MJGA 1U00A 4AZCA 3CAZA 4EZVA 3DX0A 2EFKA 3DX4A 1HXKA 4D8JA 3EJUA 4JWEA 1O7DC 2X5CA 4UDYX 4EZNA 3QNJA 3EJQA 3EJPA 2RT6A 3D52A 4IM2A 1E2UA 2F1BA 2ZXQA 3T48A 1SUFA 2Z0VA 3DX1A 2YLAA 1TQSA 3BVVA 4EZWA 2F1AA 3DDFA 3RPMA 1QWUA 5C5BA 4R5IA 3B52X 2ELBA 3Q84A 4FZOA 4UDXX 3HAJA 4AZIA 1R33A 2Z0OA 4M0MA 3GI7A 3ERCC 4E81A 2OO2A 2QFFA 1HTYA 3RV0A 3T47A 4EZYA 3O3NB 5FLEX 1SU6A 3D4ZA 4R5JA 2V0OA 4HR1B 5TKYA 4AKVA 3I39X 4AZ5A 1E9VA 4NSWA 1GNTA 1I49A 3A98A 3QE6A 1I4LA 2YL6A 3I01A 4WPCA 4E3CA 2JNKA 5KBPA 3BLBA 4DYLA 3ZEDA 2F7OA 3KDRA 2EFLA 3Q0KA 2YI9A 2PMRA 3HAHA 2F7RA 2MI7A 2Z0NA 3D51A 2FICA 1SU7A 1ZWWA 2O0I1 2WINM 4H8SA 1GN9A 1DKXA 4AZ7A 3CZSA 3KAWA 3G9GA 4EZPA 2X3XA 3QA8A 2F18A 3T46A 4IW0A 3VEAA 4HY9A 3DPOA 2OW7A 2D4CA 3DDGA 1O7DB 1X04A 2ALWA 3FD9A 2WYIA 4JWDA 1X03A 3HAIA 4DCNC 4EZOA 4FM3A 1JQKA 4H6HA 4G6QA 1OAOA 2Q13A 4NQIA 3LVTA 2OZNB 4AZCB 2EWFA 4JWCA 1TQWA 3O3OB 4EZQA 3ER9B 2KHOA 3DX3A 2YIBA 1URUA 1UPXA 3O3MB 3UITA 4EZSA 3LMFA 2YI8A 3B51X 3ER8C 2GF4A 1R5EA 2YL9A 3BUPA 4I1QA 2EX3B 3D2FA 2YL5A 4IWQA 2X3WA 3QNIA 2Q12A 2YKTA 2ND0A 1WDZA 1W9MA 4AZ6A 3BUDA 3SOGA 2C08A 3T4AG 4JLCA 3BUIA 1QX1A 4EZRA 2N3KA 2ND1A 1YWMA 2Z8YA 3VEBA 3RV1A 2YL8A 3VKHA 4KIKA 3M3WA 4WPEA 3CKDA 5FIGA 4ATMA 4HYBA 1ZYLA 3I2WA 1HWWA 3QWEA 3BVWA 4IWOA 3T49A 3F7WA 2F7QA 4JWIA 3D50A 3D4YA 2GA9D 2RAKA 3KAVA 3OHXM 1PS3A 1LQ7A 1QWNA 2RAJA 3BVUA 4R5KA 3DPPA 4FZPA 1TQVA 1OA1A 4EZXA 3OWGA 5E84A 3CZNA 1TQTA 4IM0A 3DX2A 2OBMA 4EZZA 3CVRA 3LLLA 1I4TA 1I4DA 2YLLA 3BUBA 2QXLA 2OW6A 2OBLA 4B9QA 2YIAA 3DYTA 1Y2OA 3I04A 3BVTA 4BNEA 2GAFD 1TQUA 3D2EA 4R5GA 4JNEA 4NPHA 4EZUA 2NCZA 4PO2A 3L3PA 2LXYA 4IWPA 3L3OM 4HR1A 4EZTA 4AZGA 3PLTA 4FZSA 4JL9A 3EJRA 5C5BB 3OK8A 4AZHA 2FYVA 2LM0A 3CV5A 3SYVA 2PY6A 2QKWA 3DPQA 1E1DA 2WYHA 1GNLA
chains in the Genus database with same CATH topology
4F00A 4H6IA 4R5KA 2EWFA 4JWCA 3DPPA 4M0MA 3GI7A 3ERCC 3O3OB 4E81A 4EZQA 4F01A 3ER9B 2QFFA 1OA1A 3RV0A 3T47A 2KHOA 4EZYA 4EZXA 3O3NB 3OWGA 3B53X 5E84A 2JNSA 4JNFA 4IM3A 5FLEX 2YIBA 1DKZA 1UPXA 4IM0A 1SU6A 3O3MB 3UITA 2OBMA 4EZZA 4EZSA 2YIVX 3LMFA 2YI8A 4R5JA 3B51X 2QXLA 3ER8C 4KIKB 4HR1B 5TKYA 2EX3B 3D2FA 3C7NA 3I39X 2OBLA 1E9VA 1OA0A 1GNTA 4IWQA 4R5LA 3A98A 4B9QA 2YIAA 2ND0A 1DKYA 3I01A 4JN4A 4E3CA 3I04A 1SU8A 1MJGA 1U00A 1W9MA 3ZEDA 3KDRA 2GAFD 3D2EA 4EZVA 4R5GA 4JNEA 2YI9A 3T4AG 4JLCA 4NPHA 4EZRA 2N3KA 4EZUA 4D8JA 2ND1A 2NCZA 4PO2A 1SU7A 4JWEA 2WINM 1GN9A 2Z8YA 1DKXA 2X5CA 3VEBA 3KAWA 4IWPA 3RV1A 4UDYX 3VKHA 4KIKA 3L3OM 4EZNA 3QNJA 4EZPA 4HR1A 4EZTA 3QA8A 3T46A 4IW0A 3VEAA 2RT6A 4JL9A 5FIGA 4HY9A 4HYBA 4IM2A 3DPOA 1ZYLA 1E2UA 3T48A 1SUFA 4IWOA 2LM0A 3T49A 3F7WA 4EZWA 3FD9A 2PY6A 3DPQA 4JWIA 4JWDA 2GA9D 1E1DA 3KAVA 4R5IA 3OHXM 3B52X 4FM3A 4EZOA 1JQKA 4H6HA 4G6QA 1OAOA 1GNLA 4UDXX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LMF A;  3KAV A;  5FIG A;  3KAW A; 
#chains in the Genus database with same CATH topology
 4F00 A;  4H6I A;  2X3V A;  3EJS A;  4F01 A;  3BUQ A;  3B53 X;  2JNS A;  4JNF A;  4IM3 A;  3ABH A;  1DKZ A;  3EJT A;  2YIV X;  4AVM A;  3BVX A;  2D1L A;  4KIK B;  3C7N A;  1OA0 A;  1R34 A;  4R5L A;  2RAI A;  2F7P A;  1DKY A;  3ACO A;  4JN4 A;  4AZB A;  1SU8 A;  1MJG A;  1U00 A;  4AZC A;  3CAZ A;  4EZV A;  3DX0 A;  2EFK A;  3DX4 A;  1HXK A;  4D8J A;  3EJU A;  4JWE A;  1O7D C;  2X5C A;  4UDY X;  4EZN A;  3QNJ A;  3EJQ A;  3EJP A;  2RT6 A;  3D52 A;  4IM2 A;  1E2U A;  2F1B A;  2ZXQ A;  3T48 A;  1SUF A;  2Z0V A;  3DX1 A;  2YLA A;  1TQS A;  3BVV A;  4EZW A;  2F1A A;  3DDF A;  3RPM A;  1QWU A;  5C5B A;  4R5I A;  3B52 X;  2ELB A;  3Q84 A;  4FZO A;  4UDX X;  3HAJ A;  4AZI A;  1R33 A;  2Z0O A;  4M0M A;  3GI7 A;  3ERC C;  4E81 A;  2OO2 A;  2QFF A;  1HTY A;  3RV0 A;  3T47 A;  4EZY A;  3O3N B;  5FLE X;  1SU6 A;  3D4Z A;  4R5J A;  2V0O A;  4HR1 B;  5TKY A;  4AKV A;  3I39 X;  4AZ5 A;  1E9V A;  4NSW A;  1GNT A;  1I49 A;  3A98 A;  3QE6 A;  1I4L A;  2YL6 A;  3I01 A;  4WPC A;  4E3C A;  2JNK A;  5KBP A;  3BLB A;  4DYL A;  3ZED A;  2F7O A;  3KDR A;  2EFL A;  3Q0K A;  2YI9 A;  2PMR A;  3HAH A;  2F7R A;  2MI7 A;  2Z0N A;  3D51 A;  2FIC A;  1SU7 A;  1ZWW A;  2O0I 1;  2WIN M;  4H8S A;  1GN9 A;  1DKX A;  4AZ7 A;  3CZS A;  3KAW A;  3G9G A;  4EZP A;  2X3X A;  3QA8 A;  2F18 A;  3T46 A;  4IW0 A;  3VEA A;  4HY9 A;  3DPO A;  2OW7 A;  2D4C A;  3DDG A;  1O7D B;  1X04 A;  2ALW A;  3FD9 A;  2WYI A;  4JWD A;  1X03 A;  3HAI A;  4DCN C;  4EZO A;  4FM3 A;  1JQK A;  4H6H A;  4G6Q A;  1OAO A;  2Q13 A;  4NQI A;  3LVT A;  2OZN B;  4AZC B;  2EWF A;  4JWC A;  1TQW A;  3O3O B;  4EZQ A;  3ER9 B;  2KHO A;  3DX3 A;  2YIB A;  1URU A;  1UPX A;  3O3M B;  3UIT A;  4EZS A;  3LMF A;  2YI8 A;  3B51 X;  3ER8 C;  2GF4 A;  1R5E A;  2YL9 A;  3BUP A;  4I1Q A;  2EX3 B;  3D2F A;  2YL5 A;  4IWQ A;  2X3W A;  3QNI A;  2Q12 A;  2YKT A;  2ND0 A;  1WDZ A;  1W9M A;  4AZ6 A;  3BUD A;  3SOG A;  2C08 A;  3T4A G;  4JLC A;  3BUI A;  1QX1 A;  4EZR A;  2N3K A;  2ND1 A;  1YWM A;  2Z8Y A;  3VEB A;  3RV1 A;  2YL8 A;  3VKH A;  4KIK A;  3M3W A;  4WPE A;  3CKD A;  5FIG A;  4ATM A;  4HYB A;  1ZYL A;  3I2W A;  1HWW A;  3QWE A;  3BVW A;  4IWO A;  3T49 A;  3F7W A;  2F7Q A;  4JWI A;  3D50 A;  3D4Y A;  2GA9 D;  2RAK A;  3KAV A;  3OHX M;  1PS3 A;  1LQ7 A;  1QWN A;  2RAJ A;  3BVU A;  4R5K A;  3DPP A;  4FZP A;  1TQV A;  1OA1 A;  4EZX A;  3OWG A;  5E84 A;  3CZN A;  1TQT A;  4IM0 A;  3DX2 A;  2OBM A;  4EZZ A;  3CVR A;  3LLL A;  1I4T A;  1I4D A;  2YLL A;  3BUB A;  2QXL A;  2OW6 A;  2OBL A;  4B9Q A;  2YIA A;  3DYT A;  1Y2O A;  3I04 A;  3BVT A;  4BNE A;  2GAF D;  1TQU A;  3D2E A;  4R5G A;  4JNE A;  4NPH A;  4EZU A;  2NCZ A;  4PO2 A;  3L3P A;  2LXY A;  4IWP A;  3L3O M;  4HR1 A;  4EZT A;  4AZG A;  3PLT A;  4FZS A;  4JL9 A;  3EJR A;  5C5B B;  3OK8 A;  4AZH A;  2FYV A;  2LM0 A;  3CV5 A;  3SYV A;  2PY6 A;  2QKW A;  3DPQ A;  1E1D A;  2WYH A;  1GNL A; 
#chains in the Genus database with same CATH homology
 4F00 A;  4H6I A;  4R5K A;  2EWF A;  4JWC A;  3DPP A;  4M0M A;  3GI7 A;  3ERC C;  3O3O B;  4E81 A;  4EZQ A;  4F01 A;  3ER9 B;  2QFF A;  1OA1 A;  3RV0 A;  3T47 A;  2KHO A;  4EZY A;  4EZX A;  3O3N B;  3OWG A;  3B53 X;  5E84 A;  2JNS A;  4JNF A;  4IM3 A;  5FLE X;  2YIB A;  1DKZ A;  1UPX A;  4IM0 A;  1SU6 A;  3O3M B;  3UIT A;  2OBM A;  4EZZ A;  4EZS A;  2YIV X;  3LMF A;  2YI8 A;  4R5J A;  3B51 X;  2QXL A;  3ER8 C;  4KIK B;  4HR1 B;  5TKY A;  2EX3 B;  3D2F A;  3C7N A;  3I39 X;  2OBL A;  1E9V A;  1OA0 A;  1GNT A;  4IWQ A;  4R5L A;  3A98 A;  4B9Q A;  2YIA A;  2ND0 A;  1DKY A;  3I01 A;  4JN4 A;  4E3C A;  3I04 A;  1SU8 A;  1MJG A;  1U00 A;  1W9M A;  3ZED A;  3KDR A;  2GAF D;  3D2E A;  4EZV A;  4R5G A;  4JNE A;  2YI9 A;  3T4A G;  4JLC A;  4NPH A;  4EZR A;  2N3K A;  4EZU A;  4D8J A;  2ND1 A;  2NCZ A;  4PO2 A;  1SU7 A;  4JWE A;  2WIN M;  1GN9 A;  2Z8Y A;  1DKX A;  2X5C A;  3VEB A;  3KAW A;  4IWP A;  3RV1 A;  4UDY X;  3VKH A;  4KIK A;  3L3O M;  4EZN A;  3QNJ A;  4EZP A;  4HR1 A;  4EZT A;  3QA8 A;  3T46 A;  4IW0 A;  3VEA A;  2RT6 A;  4JL9 A;  5FIG A;  4HY9 A;  4HYB A;  4IM2 A;  3DPO A;  1ZYL A;  1E2U A;  3T48 A;  1SUF A;  4IWO A;  2LM0 A;  3T49 A;  3F7W A;  4EZW A;  3FD9 A;  2PY6 A;  3DPQ A;  4JWI A;  4JWD A;  2GA9 D;  1E1D A;  3KAV A;  4R5I A;  3OHX M;  3B52 X;  4FM3 A;  4EZO A;  1JQK A;  4H6H A;  4G6Q A;  1OAO A;  1GNL A;  4UDX X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...