3HAHA

Crystal structure of human pacsin1 f-bar domain (c2 lattice)
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
289
structure length
269
Chain Sequence
TDSFWEVGNYKRTVKRIDDGHRLCNDLMNCVQERAKIEKAYGQQLTDWAKRWRQLIEKGPQYGSLERAWGAIMTEADKVSELHQEVKNNLLNEDLEKVKNWQKDAYHKQIMGGFKETKEAEDGFRKAQKPWAKKMKELEAAKKAYHLACKEEKLAMQDKVDKCKQDVQKTQEKYEKVLEDVGKTTPQYMENMEQVFEQCQQFEEKRLVFLKEVLLDIKRHLNLAENSSYIHVYRELEQAIRGADAQEDLRWFRSTSGPGMPMNWPQFEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords human PACSIN1 F-BAR
publication title Molecular mechanism of membrane constriction and tubulation mediated by the F-BAR protein Pacsin/Syndapin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Endocytosis
total genus 113
structure length 269
sequence length 289
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00611 FCH Fes/CIP4, and EFC/F-BAR homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 3hahA01
3ACOA 2Z0OA 2Z0VA 3G9GA 3OK8A 4FZSA 3LLLA 2EFKA 2FICA 3DYTA 3QE6A 3QWEA 3CAZA 4NQIA 5C5BA 4DCNC 3Q0KA 5C5BB 3HAHA 4DYLA 4WPEA 1X03A 1X04A 4AVMA 1ZWWA 3ABHA 2X3WA 3HAIA 2Q12A 4NSWA 2Z0NA 1I4LA 2EFLA 4H8SA 1I4TA 2C08A 2X3VA 2ELBA 3M3WA 2D4CA 4BNEA 2V0OA 2Q13A 2X3XA 2YKTA 1WDZA 3SOGA 2RAIA 4ATMA 3SYVA 1URUA 3I2WA 2RAJA 4AKVA 3PLTA 1I49A 4I1QA 2RAKA 1I4DA 3HAJA 3QNIA 3Q84A 2D1LA 4WPCA 1Y2OA
chains in the Genus database with same CATH superfamily
4IWOA 3DYTA 4UDXX 4EZRA 5E84A 4EZQA 1YWMA 3CVRA 4EZNA 2YKTA 3BUQA 1SU7A 4HR1B 1I49A 4R5KA 3C7NA 2LM0A 2YI9A 2O0I1 3LLLA 5C5BA 3BUIA 2YL8A 2F1AA 4IW0A 4EZZA 2PMRA 2Z0NA 1I4LA 4H8SA 5FIGA 3KAWA 4JLCA 4FM3A 4EZXA 3ER9B 2QKWA 4HR1A 2GAFD 1Y2OA 3Q0KA 4DYLA 2WINM 2WYHA 3A98A 1TQTA 3D50A 2C08A 4E3CA 4KIKA 4AZ7A 3SYVA 4AZCB 3CZSA 3HAJA 3ABHA 3D4ZA 3ZEDA 3D4YA 2F7RA 1TQSA 3CZNA 3DX1A 3I39X 3UITA 3OHXM 4FZPA 3RV1A 4R5LA 4AZGA 2Z0VA 3G9GA 2ZXQA 2FYVA 3O3NB 4JNEA 4EZSA 2EWFA 1GN9A 3LMFA 1GNLA 4E81A 4EZPA 4HY9A 4NSWA 3QE6A 3QWEA 4B9QA 5C5BB 3L3OM 3BVUA 1PS3A 3BUBA 2OZNB 1TQVA 2YLAA 3BVTA 4PO2A 2KHOA 2EX3B 2NCZA 1HXKA 2YIVX 1LQ7A 4HYBA 4IM3A 4AZIA 2GA9D 2MI7A 2X5CA 3EJRA 3HAHA 4IWPA 3DX3A 4R5IA 1X04A 4IWQA 4AZ5A 3KDRA 2PY6A 4IM2A 4G6QA 1R33A 1I4TA 3B52X 3T4AG 2X3XA 4KIKB 1HTYA 1JQKA 3BVXA 2JNSA 1DKYA 2D1LA 2OBMA 2OBLA 2FICA 3RV0A 1O7DC 3DX4A 4WPEA 1SU6A 2Q12A 4JWIA 2OO2A 2YL5A 3LVTA 3EJSA 5TKYA 1MJGA 3Q84A 2ALWA 3T46A 4BNEA 3B53X 4EZUA 4JWEA 3D2FA 1E9VA 2YLLA 3GI7A 2QFFA 3OWGA 2YL9A 2F18A 4R5JA 2LXYA 3EJPA 3EJTA 2ND0A 3F7WA 2YIAA 4H6HA 1O7DB 1QX1A 4D8JA 4WPCA 4UDYX 4FZSA 3DPQA 1OA0A 2JNKA 2YIBA 4AVMA 4EZOA 3T49A 3KAVA 3DDFA 4JWCA 2OW7A 3FD9A 3ERCC 3QNIA 3D51A 3VEAA 5KBPA 4NQIA 4AZ6A 3T47A 3CKDA 4AZBA 1X03A 4EZYA 3B51X 3I01A 2X3WA 2YL6A 3BVWA 4JNFA 2X3VA 2D4CA 3DPPA 1URUA 1W9MA 4I1QA 1I4DA 1QWNA 3EJQA 2EFKA 1OAOA 1U00A 4JN4A 2EFLA 4JL9A 2RT6A 4EZWA 3M3WA 3CV5A 3I2WA 4AKVA 4AZHA 3PLTA 3L3PA 3OK8A 1GNTA 1QWUA 3CAZA 2YI8A 3T48A 3VEBA 2WYIA 4R5GA 4EZVA 3QNJA 3VKHA 2V0OA 2Q13A 3DPOA 1WDZA 4ATMA 1OA1A 1R34A 3ER8C 2F1BA 3DX2A 3DDGA 1E2UA 2GF4A 1ZWWA 2F7PA 3RPMA 1UPXA 1DKXA 3D2EA 3BLBA 1HWWA 2F7QA 3O3MB 3BUDA 2RAKA 2N3KA 2Z0OA 1SU8A 3QA8A 4EZTA 4NPHA 4H6IA 2QXLA 4FZOA 2ND1A 3BVVA 5FLEX 1TQUA 3SOGA 1TQWA 4AZCA 3O3OB 2RAIA 4M0MA 3I04A 3ACOA 2Z8YA 3DX0A 3EJUA 4DCNC 4F01A 1SUFA 3HAIA 1DKZA 1R5EA 1ZYLA 2OW6A 2ELBA 1E1DA 4IM0A 2F7OA 4F00A 2RAJA 3BUPA 3D52A 4JWDA
chains in the Genus database with same CATH topology
3ACOA 2Z0OA 2Z0VA 3G9GA 3OK8A 4FZSA 3LLLA 2EFKA 2FICA 3DYTA 3QE6A 3QWEA 3CAZA 4NQIA 5C5BA 4DCNC 3Q0KA 5C5BB 3HAHA 4DYLA 4WPEA 1X03A 1X04A 4AVMA 1ZWWA 3ABHA 2X3WA 3HAIA 2Q12A 4NSWA 2Z0NA 1I4LA 2EFLA 4H8SA 1I4TA 2C08A 2X3VA 2ELBA 3M3WA 2D4CA 4BNEA 2V0OA 2Q13A 2X3XA 2YKTA 1WDZA 3SOGA 2RAIA 4ATMA 3SYVA 1URUA 3I2WA 2RAJA 4AKVA 3PLTA 1I49A 4I1QA 2RAKA 1I4DA 3HAJA 3QNIA 3Q84A 2D1LA 4WPCA 1Y2OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ACO A;  2Z0O A;  2Z0V A;  3G9G A;  3OK8 A;  4FZS A;  3LLL A;  2EFK A;  2FIC A;  3DYT A;  3QE6 A;  3QWE A;  3CAZ A;  4NQI A;  5C5B A;  4DCN C;  3Q0K A;  5C5B B;  3HAH A;  4DYL A;  4WPE A;  1X03 A;  1X04 A;  4AVM A;  1ZWW A;  3ABH A;  2X3W A;  3HAI A;  2Q12 A;  4NSW A;  2Z0N A;  1I4L A;  2EFL A;  4H8S A;  1I4T A;  2C08 A;  2X3V A;  2ELB A;  3M3W A;  2D4C A;  4BNE A;  2V0O A;  2Q13 A;  2X3X A;  2YKT A;  1WDZ A;  3SOG A;  2RAI A;  4ATM A;  3SYV A;  1URU A;  3I2W A;  2RAJ A;  4AKV A;  3PLT A;  1I49 A;  4I1Q A;  2RAK A;  1I4D A;  3HAJ A;  3QNI A;  3Q84 A;  2D1L A;  4WPC A;  1Y2O A; 
#chains in the Genus database with same CATH topology
 4IWO A;  3DYT A;  4UDX X;  4EZR A;  5E84 A;  4EZQ A;  1YWM A;  3CVR A;  4EZN A;  2YKT A;  3BUQ A;  1SU7 A;  4HR1 B;  1I49 A;  4R5K A;  3C7N A;  2LM0 A;  2YI9 A;  2O0I 1;  3LLL A;  5C5B A;  3BUI A;  2YL8 A;  2F1A A;  4IW0 A;  4EZZ A;  2PMR A;  2Z0N A;  1I4L A;  4H8S A;  5FIG A;  3KAW A;  4JLC A;  4FM3 A;  4EZX A;  3ER9 B;  2QKW A;  4HR1 A;  2GAF D;  1Y2O A;  3Q0K A;  4DYL A;  2WIN M;  2WYH A;  3A98 A;  1TQT A;  3D50 A;  2C08 A;  4E3C A;  4KIK A;  4AZ7 A;  3SYV A;  4AZC B;  3CZS A;  3HAJ A;  3ABH A;  3D4Z A;  3ZED A;  3D4Y A;  2F7R A;  1TQS A;  3CZN A;  3DX1 A;  3I39 X;  3UIT A;  3OHX M;  4FZP A;  3RV1 A;  4R5L A;  4AZG A;  2Z0V A;  3G9G A;  2ZXQ A;  2FYV A;  3O3N B;  4JNE A;  4EZS A;  2EWF A;  1GN9 A;  3LMF A;  1GNL A;  4E81 A;  4EZP A;  4HY9 A;  4NSW A;  3QE6 A;  3QWE A;  4B9Q A;  5C5B B;  3L3O M;  3BVU A;  1PS3 A;  3BUB A;  2OZN B;  1TQV A;  2YLA A;  3BVT A;  4PO2 A;  2KHO A;  2EX3 B;  2NCZ A;  1HXK A;  2YIV X;  1LQ7 A;  4HYB A;  4IM3 A;  4AZI A;  2GA9 D;  2MI7 A;  2X5C A;  3EJR A;  3HAH A;  4IWP A;  3DX3 A;  4R5I A;  1X04 A;  4IWQ A;  4AZ5 A;  3KDR A;  2PY6 A;  4IM2 A;  4G6Q A;  1R33 A;  1I4T A;  3B52 X;  3T4A G;  2X3X A;  4KIK B;  1HTY A;  1JQK A;  3BVX A;  2JNS A;  1DKY A;  2D1L A;  2OBM A;  2OBL A;  2FIC A;  3RV0 A;  1O7D C;  3DX4 A;  4WPE A;  1SU6 A;  2Q12 A;  4JWI A;  2OO2 A;  2YL5 A;  3LVT A;  3EJS A;  5TKY A;  1MJG A;  3Q84 A;  2ALW A;  3T46 A;  4BNE A;  3B53 X;  4EZU A;  4JWE A;  3D2F A;  1E9V A;  2YLL A;  3GI7 A;  2QFF A;  3OWG A;  2YL9 A;  2F18 A;  4R5J A;  2LXY A;  3EJP A;  3EJT A;  2ND0 A;  3F7W A;  2YIA A;  4H6H A;  1O7D B;  1QX1 A;  4D8J A;  4WPC A;  4UDY X;  4FZS A;  3DPQ A;  1OA0 A;  2JNK A;  2YIB A;  4AVM A;  4EZO A;  3T49 A;  3KAV A;  3DDF A;  4JWC A;  2OW7 A;  3FD9 A;  3ERC C;  3QNI A;  3D51 A;  3VEA A;  5KBP A;  4NQI A;  4AZ6 A;  3T47 A;  3CKD A;  4AZB A;  1X03 A;  4EZY A;  3B51 X;  3I01 A;  2X3W A;  2YL6 A;  3BVW A;  4JNF A;  2X3V A;  2D4C A;  3DPP A;  1URU A;  1W9M A;  4I1Q A;  1I4D A;  1QWN A;  3EJQ A;  2EFK A;  1OAO A;  1U00 A;  4JN4 A;  2EFL A;  4JL9 A;  2RT6 A;  4EZW A;  3M3W A;  3CV5 A;  3I2W A;  4AKV A;  4AZH A;  3PLT A;  3L3P A;  3OK8 A;  1GNT A;  1QWU A;  3CAZ A;  2YI8 A;  3T48 A;  3VEB A;  2WYI A;  4R5G A;  4EZV A;  3QNJ A;  3VKH A;  2V0O A;  2Q13 A;  3DPO A;  1WDZ A;  4ATM A;  1OA1 A;  1R34 A;  3ER8 C;  2F1B A;  3DX2 A;  3DDG A;  1E2U A;  2GF4 A;  1ZWW A;  2F7P A;  3RPM A;  1UPX A;  1DKX A;  3D2E A;  3BLB A;  1HWW A;  2F7Q A;  3O3M B;  3BUD A;  2RAK A;  2N3K A;  2Z0O A;  1SU8 A;  3QA8 A;  4EZT A;  4NPH A;  4H6I A;  2QXL A;  4FZO A;  2ND1 A;  3BVV A;  5FLE X;  1TQU A;  3SOG A;  1TQW A;  4AZC A;  3O3O B;  2RAI A;  4M0M A;  3I04 A;  3ACO A;  2Z8Y A;  3DX0 A;  3EJU A;  4DCN C;  4F01 A;  1SUF A;  3HAI A;  1DKZ A;  1R5E A;  1ZYL A;  2OW6 A;  2ELB A;  1E1D A;  4IM0 A;  2F7O A;  4F00 A;  2RAJ A;  3BUP A;  3D52 A;  4JWD A; 
#chains in the Genus database with same CATH homology
 3ACO A;  2Z0O A;  2Z0V A;  3G9G A;  3OK8 A;  4FZS A;  3LLL A;  2EFK A;  2FIC A;  3DYT A;  3QE6 A;  3QWE A;  3CAZ A;  4NQI A;  5C5B A;  4DCN C;  3Q0K A;  5C5B B;  3HAH A;  4DYL A;  4WPE A;  1X03 A;  1X04 A;  4AVM A;  1ZWW A;  3ABH A;  2X3W A;  3HAI A;  2Q12 A;  4NSW A;  2Z0N A;  1I4L A;  2EFL A;  4H8S A;  1I4T A;  2C08 A;  2X3V A;  2ELB A;  3M3W A;  2D4C A;  4BNE A;  2V0O A;  2Q13 A;  2X3X A;  2YKT A;  1WDZ A;  3SOG A;  2RAI A;  4ATM A;  3SYV A;  1URU A;  3I2W A;  2RAJ A;  4AKV A;  3PLT A;  1I49 A;  4I1Q A;  2RAK A;  1I4D A;  3HAJ A;  3QNI A;  3Q84 A;  2D1L A;  4WPC A;  1Y2O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...