3HAHA

Crystal structure of human pacsin1 f-bar domain (c2 lattice)
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
289
structure length
269
Chain Sequence
TDSFWEVGNYKRTVKRIDDGHRLCNDLMNCVQERAKIEKAYGQQLTDWAKRWRQLIEKGPQYGSLERAWGAIMTEADKVSELHQEVKNNLLNEDLEKVKNWQKDAYHKQIMGGFKETKEAEDGFRKAQKPWAKKMKELEAAKKAYHLACKEEKLAMQDKVDKCKQDVQKTQEKYEKVLEDVGKTTPQYMENMEQVFEQCQQFEEKRLVFLKEVLLDIKRHLNLAENSSYIHVYRELEQAIRGADAQEDLRWFRSTSGPGMPMNWPQFEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis
molecule keywords human PACSIN1 F-BAR
publication title Molecular mechanism of membrane constriction and tubulation mediated by the F-BAR protein Pacsin/Syndapin.
pubmed doi rcsb
source organism Homo sapiens
total genus 113
structure length 269
sequence length 289
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00611 FCH Fes/CIP4, and EFC/F-BAR homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 3hahA01
4BNEA 2RAJA 1X04A 3I2WA 2ELBA 4DCNC 4WPCA 4ATMA 1ZWWA 3DYTA 1X03A 4WPEA 3Q0KA 3OK8A 5C5BA 1URUA 3SOGA 3QE6A 4AKVA 2YKTA 2X3WA 1I4DA 1I4LA 2EFKA 2Q13A 3M3WA 3QWEA 2V0OA 3LLLA 2X3XA 3HAIA 2Z0NA 2X3VA 3ABHA 3PLTA 4H8SA 4FZSA 1I4TA 3SYVA 1Y2OA 3ACOA 3G9GA 1WDZA 4NSWA 2FICA 2C08A 3CAZA 4AVMA 4NQIA 3Q84A 3HAHA 1I49A 4I1QA 4DYLA 2RAIA 3QNIA 2Q12A 2EFLA 5C5BB 2Z0OA 2D1LA 2RAKA 3HAJA 2D4CA 2Z0VA
chains in the Genus database with same CATH superfamily
2YIVX 3A98A 3T47A 5E84A 3D52A 4WPEA 4JNFA 3BVXA 2OBLA 2F18A 4M0MA 2OZNB 2OW6A 4G6QA 2X3VA 1I4TA 5KBPA 3T48A 3DX2A 2JNSA 2YI9A 4AZCA 4JWEA 4H6IA 1X03A 4IM2A 3Q0KA 5C5BA 2F7PA 4KIKA 1SU8A 2EFKA 2WINM 3BUDA 3DX1A 3BVTA 3F7WA 2YLLA 4IWQA 4DYLA 3DPOA 1JQKA 3RV1A 2ND1A 4EZYA 3BLBA 4JNEA 3RV0A 4EZRA 3OK8A 4E81A 2OW7A 2MI7A 1PS3A 3BUIA 1SU7A 2ND0A 3HAIA 3VKHA 3GI7A 3LMFA 3KAWA 3DX0A 3ER8C 2D1LA 4EZSA 2RAJA 2ELBA 3D51A 1HXKA 2F1BA 4AKVA 3FD9A 4EZOA 1YWMA 4AZIA 2V0OA 1WDZA 3CAZA 2YL8A 4PO2A 2RAIA 3QNIA 2O0I1 2EFLA 3EJTA 1U00A 3L3OM 3EJRA 2Z0VA 1E9VA 3UITA 3I01A 1E2UA 4AZ7A 2YIBA 4AZBA 4HYBA 5FIGA 4JL9A 3O3NB 1W9MA 4F01A 4H8SA 4UDXX 3DX4A 3T4AG 3QA8A 2PY6A 5C5BB 3D4ZA 2D4CA 4KIKB 4NSWA 2F1AA 3DYTA 4H6HA 3D2FA 2NCZA 3QWEA 2X3XA 3CV5A 4EZZA 4HR1B 3C7NA 1O7DB 2OO2A 1GN9A 3I39X 4EZWA 1O7DC 4EZUA 2Q12A 3OWGA 4B9QA 2YL6A 1LQ7A 2ZXQA 3CVRA 4AZ5A 1TQVA 3CKDA 2QKWA 4IM3A 3I04A 3OHXM 4HR1A 4R5GA 3D4YA 4DCNC 4IM0A 4JLCA 1ZWWA 4EZQA 3BUBA 4JN4A 4D8JA 1I4LA 3M3WA 2YIAA 3EJPA 4AVMA 5TKYA 3QNJA 2Z8YA 2Z0OA 3BUPA 2GA9D 2EWFA 4ATMA 4EZVA 1SU6A 4AZ6A 1HTYA 2PMRA 1TQUA 4R5LA 2QXLA 3ACOA 4NQIA 4FM3A 3B53X 4AZGA 3DPQA 1R34A 3L3PA 1URUA 2F7QA 3VEBA 3ERCC 3O3OB 4IWPA 5FLEX 1I49A 1DKXA 3EJUA 4E3CA 4I1QA 1X04A 2OBMA 4FZPA 2FYVA 3BVWA 1UPXA 1I4DA 2F7OA 3LLLA 1ZYLA 1MJGA 2C08A 2LM0A 4R5JA 4EZXA 3KAVA 3D50A 3CZNA 2KHOA 1GNLA 3O3MB 3T49A 4UDYX 3DX3A 2X3WA 2Q13A 3KDRA 2Z0NA 1OA1A 1OAOA 1QWNA 2WYHA 2YI8A 4FZSA 3DPPA 2RT6A 1DKYA 4HY9A 3DDGA 4BNEA 4WPCA 4EZTA 4AZHA 1E1DA 3BVUA 3SOGA 1TQWA 2YKTA 3T46A 4JWCA 2F7RA 4JWDA 1QX1A 3ER9B 4IW0A 2YL9A 3LVTA 4JWIA 4EZNA 3RPMA 3BVVA 4FZOA 3ZEDA 2GF4A 1DKZA 3B52X 1R5EA 3ABHA 3CZSA 1QWUA 3DDFA 3EJQA 2GAFD 4EZPA 3G9GA 2ALWA 1TQSA 2YLAA 3QE6A 1TQTA 1OA0A 4R5IA 3PLTA 2YL5A 4R5KA 3SYVA 1Y2OA 2FICA 1SUFA 3B51X 3HAHA 4IWOA 3BUQA 3D2EA 2RAKA 2X5CA 3I2WA 2JNKA 2LXYA 1GNTA 2N3KA 2EX3B 3EJSA 1HWWA 4AZCB 2WYIA 1R33A 3VEAA 2QFFA 3Q84A 4NPHA 4F00A 3HAJA
chains in the Genus database with same CATH topology
4BNEA 2RAJA 1X04A 3I2WA 2ELBA 4DCNC 4WPCA 4ATMA 1ZWWA 3DYTA 1X03A 4WPEA 3Q0KA 3OK8A 5C5BA 1URUA 3SOGA 3QE6A 4AKVA 2YKTA 2X3WA 1I4DA 1I4LA 2EFKA 2Q13A 3M3WA 3QWEA 2V0OA 3LLLA 2X3XA 3HAIA 2Z0NA 2X3VA 3ABHA 3PLTA 4H8SA 4FZSA 1I4TA 3SYVA 1Y2OA 3ACOA 3G9GA 1WDZA 4NSWA 2FICA 2C08A 3CAZA 4AVMA 4NQIA 3Q84A 3HAHA 1I49A 4I1QA 4DYLA 2RAIA 3QNIA 2Q12A 2EFLA 5C5BB 2Z0OA 2D1LA 2RAKA 3HAJA 2D4CA 2Z0VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BNE A;  2RAJ A;  1X04 A;  3I2W A;  2ELB A;  4DCN C;  4WPC A;  4ATM A;  1ZWW A;  3DYT A;  1X03 A;  4WPE A;  3Q0K A;  3OK8 A;  5C5B A;  1URU A;  3SOG A;  3QE6 A;  4AKV A;  2YKT A;  2X3W A;  1I4D A;  1I4L A;  2EFK A;  2Q13 A;  3M3W A;  3QWE A;  2V0O A;  3LLL A;  2X3X A;  3HAI A;  2Z0N A;  2X3V A;  3ABH A;  3PLT A;  4H8S A;  4FZS A;  1I4T A;  3SYV A;  1Y2O A;  3ACO A;  3G9G A;  1WDZ A;  4NSW A;  2FIC A;  2C08 A;  3CAZ A;  4AVM A;  4NQI A;  3Q84 A;  3HAH A;  1I49 A;  4I1Q A;  4DYL A;  2RAI A;  3QNI A;  2Q12 A;  2EFL A;  5C5B B;  2Z0O A;  2D1L A;  2RAK A;  3HAJ A;  2D4C A;  2Z0V A; 
#chains in the Genus database with same CATH topology
 2YIV X;  3A98 A;  3T47 A;  5E84 A;  3D52 A;  4WPE A;  4JNF A;  3BVX A;  2OBL A;  2F18 A;  4M0M A;  2OZN B;  2OW6 A;  4G6Q A;  2X3V A;  1I4T A;  5KBP A;  3T48 A;  3DX2 A;  2JNS A;  2YI9 A;  4AZC A;  4JWE A;  4H6I A;  1X03 A;  4IM2 A;  3Q0K A;  5C5B A;  2F7P A;  4KIK A;  1SU8 A;  2EFK A;  2WIN M;  3BUD A;  3DX1 A;  3BVT A;  3F7W A;  2YLL A;  4IWQ A;  4DYL A;  3DPO A;  1JQK A;  3RV1 A;  2ND1 A;  4EZY A;  3BLB A;  4JNE A;  3RV0 A;  4EZR A;  3OK8 A;  4E81 A;  2OW7 A;  2MI7 A;  1PS3 A;  3BUI A;  1SU7 A;  2ND0 A;  3HAI A;  3VKH A;  3GI7 A;  3LMF A;  3KAW A;  3DX0 A;  3ER8 C;  2D1L A;  4EZS A;  2RAJ A;  2ELB A;  3D51 A;  1HXK A;  2F1B A;  4AKV A;  3FD9 A;  4EZO A;  1YWM A;  4AZI A;  2V0O A;  1WDZ A;  3CAZ A;  2YL8 A;  4PO2 A;  2RAI A;  3QNI A;  2O0I 1;  2EFL A;  3EJT A;  1U00 A;  3L3O M;  3EJR A;  2Z0V A;  1E9V A;  3UIT A;  3I01 A;  1E2U A;  4AZ7 A;  2YIB A;  4AZB A;  4HYB A;  5FIG A;  4JL9 A;  3O3N B;  1W9M A;  4F01 A;  4H8S A;  4UDX X;  3DX4 A;  3T4A G;  3QA8 A;  2PY6 A;  5C5B B;  3D4Z A;  2D4C A;  4KIK B;  4NSW A;  2F1A A;  3DYT A;  4H6H A;  3D2F A;  2NCZ A;  3QWE A;  2X3X A;  3CV5 A;  4EZZ A;  4HR1 B;  3C7N A;  1O7D B;  2OO2 A;  1GN9 A;  3I39 X;  4EZW A;  1O7D C;  4EZU A;  2Q12 A;  3OWG A;  4B9Q A;  2YL6 A;  1LQ7 A;  2ZXQ A;  3CVR A;  4AZ5 A;  1TQV A;  3CKD A;  2QKW A;  4IM3 A;  3I04 A;  3OHX M;  4HR1 A;  4R5G A;  3D4Y A;  4DCN C;  4IM0 A;  4JLC A;  1ZWW A;  4EZQ A;  3BUB A;  4JN4 A;  4D8J A;  1I4L A;  3M3W A;  2YIA A;  3EJP A;  4AVM A;  5TKY A;  3QNJ A;  2Z8Y A;  2Z0O A;  3BUP A;  2GA9 D;  2EWF A;  4ATM A;  4EZV A;  1SU6 A;  4AZ6 A;  1HTY A;  2PMR A;  1TQU A;  4R5L A;  2QXL A;  3ACO A;  4NQI A;  4FM3 A;  3B53 X;  4AZG A;  3DPQ A;  1R34 A;  3L3P A;  1URU A;  2F7Q A;  3VEB A;  3ERC C;  3O3O B;  4IWP A;  5FLE X;  1I49 A;  1DKX A;  3EJU A;  4E3C A;  4I1Q A;  1X04 A;  2OBM A;  4FZP A;  2FYV A;  3BVW A;  1UPX A;  1I4D A;  2F7O A;  3LLL A;  1ZYL A;  1MJG A;  2C08 A;  2LM0 A;  4R5J A;  4EZX A;  3KAV A;  3D50 A;  3CZN A;  2KHO A;  1GNL A;  3O3M B;  3T49 A;  4UDY X;  3DX3 A;  2X3W A;  2Q13 A;  3KDR A;  2Z0N A;  1OA1 A;  1OAO A;  1QWN A;  2WYH A;  2YI8 A;  4FZS A;  3DPP A;  2RT6 A;  1DKY A;  4HY9 A;  3DDG A;  4BNE A;  4WPC A;  4EZT A;  4AZH A;  1E1D A;  3BVU A;  3SOG A;  1TQW A;  2YKT A;  3T46 A;  4JWC A;  2F7R A;  4JWD A;  1QX1 A;  3ER9 B;  4IW0 A;  2YL9 A;  3LVT A;  4JWI A;  4EZN A;  3RPM A;  3BVV A;  4FZO A;  3ZED A;  2GF4 A;  1DKZ A;  3B52 X;  1R5E A;  3ABH A;  3CZS A;  1QWU A;  3DDF A;  3EJQ A;  2GAF D;  4EZP A;  3G9G A;  2ALW A;  1TQS A;  2YLA A;  3QE6 A;  1TQT A;  1OA0 A;  4R5I A;  3PLT A;  2YL5 A;  4R5K A;  3SYV A;  1Y2O A;  2FIC A;  1SUF A;  3B51 X;  3HAH A;  4IWO A;  3BUQ A;  3D2E A;  2RAK A;  2X5C A;  3I2W A;  2JNK A;  2LXY A;  1GNT A;  2N3K A;  2EX3 B;  3EJS A;  1HWW A;  4AZC B;  2WYI A;  1R33 A;  3VEA A;  2QFF A;  3Q84 A;  4NPH A;  4F00 A;  3HAJ A; 
#chains in the Genus database with same CATH homology
 4BNE A;  2RAJ A;  1X04 A;  3I2W A;  2ELB A;  4DCN C;  4WPC A;  4ATM A;  1ZWW A;  3DYT A;  1X03 A;  4WPE A;  3Q0K A;  3OK8 A;  5C5B A;  1URU A;  3SOG A;  3QE6 A;  4AKV A;  2YKT A;  2X3W A;  1I4D A;  1I4L A;  2EFK A;  2Q13 A;  3M3W A;  3QWE A;  2V0O A;  3LLL A;  2X3X A;  3HAI A;  2Z0N A;  2X3V A;  3ABH A;  3PLT A;  4H8S A;  4FZS A;  1I4T A;  3SYV A;  1Y2O A;  3ACO A;  3G9G A;  1WDZ A;  4NSW A;  2FIC A;  2C08 A;  3CAZ A;  4AVM A;  4NQI A;  3Q84 A;  3HAH A;  1I49 A;  4I1Q A;  4DYL A;  2RAI A;  3QNI A;  2Q12 A;  2EFL A;  5C5B B;  2Z0O A;  2D1L A;  2RAK A;  3HAJ A;  2D4C A;  2Z0V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...