1O7DC

The structure of the bovine lysosomal a-mannosidase suggests a novel mechanism for low ph activation
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
GDSAPLNEAMAVLQHHDAVSGTSRQHVANDYARQLSEGWRPCEVLMSNALAHLSGLKEDFAFCRKLNISICPLTQTAERFQVIVYNPLGRKVDWMVRLPVSKHVYLVKDPGGKIVPSDVVTIPSSDSQELLFSALVPAVGFSIYSVSQMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysosomal alpha-mannosidase
publication title The Structure of Bovine Lysosomal Alpha-Mannosidase Suggests a Novel Mechanism for Low-Ph Activation
pubmed doi rcsb
molecule tags Hydrolase
total genus 38
structure length 150
sequence length 150
ec nomenclature ec 3.2.1.24: Alpha-mannosidase.
pdb deposition date 2002-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.50 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Glycoside hydrolase family 38, central domain 1o7dC01
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1o7dC02
1RPKA 4NXSA 2QPUA 3DDGA 4JL2A 2WVUA 3L4ZA 4WF7A 4CGTA 2ZX5A 1JIBA 4UQCA 3L4XA 1QWNA 2XVGA 4GINA 3CZGA 1HX0A 3AXHA 1LWJA 1CGTA 3WENA 1DEDA 3BAXA 1JAEA 4J3WA 4UQ9A 1PS3A 4J3XA 1C8QA 4AIEA 5KEZA 4CN1A 4OJYA 2VR5A 4QAWA 1G1YA 3VNYA 2OW6A 1D7FA 3ZSTA 3QGVA 5KBPA 1PZ3A 2V3FA 2EO7A 3WNLA 2F61A 2WSPA 4J3VA 3H54A 3WN6A 3VGEA 5CGMA 1VFOA 3BVVA 3BAWA 1CXFA 3HG5A 1T0OA 2E4TA 3DDFA 1QPKA 1L0PA 1KBKA 1ODUA 4FNTA 2ZUUA 3BCDA 3VNZA 2BY1A 3TV8A 1WP6A 4NX0A 1HL8A 1KB3A 5CGTA 1MW3A 3M07A 4J3UA 1KXQA 4J28A 5BRPA 2YA0A 3HJEA 4MB1A 3VSTA 1XCWA 3BAYA 3L4WA 2FHCA 5I0DA 4PSPA 3WNPA 1VJSA 4DO5A 4H8HA 1SZNA 1G94A 1QHOA 3FW6A 1J0KA 2F7PA 2WVVA 3GXTA 1R75A 2XN1A 1I75A 3RILA 1B2YA 1WZAA 3ZR6A 3BUBA 3HG4A 1WO2A 1XH1A 4U31A 3A23A 2C7FA 2ZICA 4JFTA 3ZT6A 2D2OA 1JD7A 2DIJA 3AJ7A 2F18A 2QMKA 1B0IA 1EO7A 1BAGA 4M8UA 4PSRA 2OYLA 3ZT5A 1KCLA 2GJRA 3K8KA 1RP8A 2GUYA 3WMSA 2FHFA 4UZUA 3GXNA 3AMLA 1CIUA 2OYMA 4FNUA 3BLKA 3WELA 4FLRA 4B9ZA 2E8YA 3CGTA 3IGUA 4FNSA 2BY0A 4E2OA 1CGWA 3GXIA 2PWGA 3WDIA 1MW2A 2QLYA 3H53A 4AEEA 3BC9A 1Z32X 3CPUA 3IJ9A 1VFUA 1W9XA 2ZUSA 1HWWA 2XN0A 4DO4A 3BUQA 2OW7A 2DH3A 5TD4A 1GCYA 2WNWA 1KGUA 3D4ZA 3KL5A 1IZJA 3BUPA 1TQWA 2X2HA 1QWUA 1R34A 2XIIA 3LRKA 2PWEA 5E0FA 2D0FA 3L4YA 1UKQA 3CC1A 1ZJAA 3VSUA 3CZLA 2AAAA 3VGDA 1JDAA 2BHUA 1JXJA 3OLEA 4HOZA 3CZKA 3VMPA 1EO5A 1MWOA 1JD9A 1WZKA 1ZS2A 2ZUVA 3HG2A 1OT2A 1CGVA 2E0PA 2EAEA 4UQEA 3GXPA 3VMOA 1VAHA 2Y2WA 2ZX6A 4FLQA 4GI9A 4GO8A 1UD3A 3ZR5A 3BUIA 4J3TA 3WDJA 3D4YA 4H2CA 4H8UA 1AQHA 3TTSA 3EDDA 3BCFA 1QW8A 4FNPA 2DH2A 4JL1A 1CXKA 1WPCA 2VRKA 3L4TA 1MVYA 4AW7A 1EHAA 2GJPA 4UQBA 1QW9A 2WCSA 3DX0A 3OLIA 2Y4SA 5E1QA 1HXKA 4UOQA 3A6OA 3LXCA 3GBEA 3UERA 1SMAA 1KWGA 2BY3A 1HTYA 4GI8A 2ZIDA 3GXMA 3OLDA 9CGTA 3VGFA 4WLCA 2ZUWA 2E9BA 4JFWA 3KL3A 1R33A 3EJQA 2Y5EA 3KLLA 3A47A 2TAAA 1JL8A 1TCMA 2YA1A 3K8LA 2OYKA 3ECQA 3VGGA 2XN2A 2F2HA 2X2JA 3VGHA 1WE5A 2FYVA 1BSIA 5DFAA 3WEOA 4M56A 3VX0A 2F1AA 4OGZA 1KWKA 2XIBA 1U2YA 3A24A 4JFSA 3S5YA 3VSVA 2NT0A 3KE0A 1UH4A 4GKLA 1JXKA 2WVVB 2WPGA 3GXDA 2ZX7A 2GVYA 1LWHA 3CZSA 1KXTA 4UZSA 1UA3A 1XV8A 1S46A 4XB3A 2OSWA 1NM9A 2D3LA 3LXBA 1KTCA 1QI5A 2G3NA 2G3MA 3FAWA 3VM5A 3EJPA 1QI4A 4TVUA 3EJUA 1CLVA 2VT0A 1XD0A 1DHKA 2F1BA 3AMKA 4J7RA 3D50A 5E6ZA 1XSKA 3BVUA 4HOWA 2WSKA 1UD2A 1UA7A 1JDDA 3A22A 1PAMA 3BUDA 3EJRA 1PIFA 3S5ZA 1TQVA 3IJ8A 4X9YA 2F7OA 2BY2A 3WFZA 1O7DB 4ATWA 1BVZA 1OB0A 3EDKA 4CKQA 3S2CA 4KMQA 1GJWA 1UKSA 2ZXQA 2YA2A 3GXFA 4W93A 2DIEA 4H7VA 2YIHA 2EADA 1UOKA 1EH9A 3DX1A 1E43A 2QPSA 3BH4A 3L4VA 1D3CA 3UCQA 1MFVA 1M53A 1EA9C 1VFMA 1XCXA 1AMYA 3CLWA 4OIFA 1BVNP 1KXHA 6TAAA 3HG3A 4CN6A 2FH6A 4GQQA 4U3CA 3KWXA 4LQ1A 2AMGA 1M7XA 2BXZA 1XGZA 1XSJA 3CV5A 1KGXA 1MW0A 1H3GA 1PIGA 2WCGA 3TONA 1UD4A 5A2BA 2ALWA 1O7DC 3UEQA 2X2IA 3A5VA 1CXIA 3CZEA 4LPCA 1VB9A 3MI6A 1OSEA 2F7RA 1QHPA 2D0GA 5HXMA 3HZ3A 4FLOA 1HT6A 1CYGA 3BAKA 1TQSA 3WDHA 1GVIA 4HOXA 3KLKA 2ZX8A 4JCMA 3GBDA 4HP5A 2QV4A 3II1A 3LRLA 1KGWA 3ZT7A 3WY4A 1BG9A 1V3LA 5HDRA 1G9HA 2WKLA 5CXPA 1HVXA 2ZXBA 3BSHA 4CN4A 4FMVA 1JG9A 3A21A 1E40A 1A47A 1MFUA 4U33A 1MXGA 3GTNA 2QMJA 3LX9A 1PEZA 2EABA 2EACA 2CHNA 1JDCA 1E3ZA 2WYIA 1RP9A 2D3NA 2VRQA 3WNKA 3KL0A 3RIKA 4NXKA 1CXLA 5I24A 2WVSA 2VNCA 4AYGA 4HPHA 1SMDA 4U2ZA 2Y24A 4FNRA 3UG5A 3WY1A 1BF2A 1R47A 4GIAA 4AYSA 2BXYA 5A6LA 2VUYA 3L2LA 3IK2A 2CXGA 5EMYA 4KWUA 4FLSA 2EEXA 1CGUA 3BAIA 4X0NA 2NSXA 4B9YA 1CXEA 5CLTA 1XD1A 4NZJA 3LRMA 4U2YA 1HNYA 4MAZA 2YFNA 1UH2A 2WVTA 2FH8A 4LXFA 3EDFA 2PWFA 1E3XA 2D73A 1J0HA 1UD6A 1WZLA 1ZJBA 4OKDA 4BZYA 3W37A 2WKGA 3WEMA 2ZWYA 3VM7A 3ZO9A 1CPUA 2J25A 3BLBA 5I23A 2V3EA 3ZOAA 4J27A 4CVWA 2WANA 1NOFA 3LPOA 4JFUA 3DHPA 3W38A 1CXHA 1XH2A 5CLWA 5F7UA 1MXDA 2PWDA 4PCSA 2EQDA 4BA0A 1CGYA 3CTTA 4GQRA 2FGZA 1UASA 1IV8A 3BVTA 2YJQA 4JCLA 3D52A 3DX4A 3DX3A 1KTBA 3VX1A 4PEEA 2ZXDA 4AMWA 1IZKA 3BMVA 2YKKA 1AQMA 3EDEA 4UCFA 4WSJA 1V3JA 3VGBA 3TOPA 3VO0A 2CPUA 1HL9A 5E9AA 3VU2A 5A2CA 1XH0A 2OSYA 4AMXA 1PPIA 4J3SA 1BLIA 2ZUTA 1JF5A 1QI3A 2ZX9A 1PZ2A 3K8MA 3EJSA 1JF6A 3A4AA 6CGTA 3BVXA 1JFHA 3WNNA 4UQDA 2IGTA 1UH3A 1U30A 3TTYA 1J0IA 1G5AA 3EDJA 4JFVA 3BMWA 2YFOA 1GJUA 2XVLA 3UG4A 4NZFA 3DX2A 1R46A 4FNQA 2BHYA 2Z1KA 1OT1A 2WYHA 2OSXA 4H8VA 3LVTA 1MW1A 3CZNA 3OLGA 3WY2A 3BAJA 3D51A 1V3KA 3LPPA 5I5RA 1DTUA 1JI1A 5HPOA 1QX1A 1P6WA 2FHBA 2E8ZA 5A6MA 1OGSA 3ZQ9A 4UNIA 5A2AA 3AXIA 1BPLB 3BLPX 4NI3A 2XWEA 1TQUA 4GO9A 1Y7VA 1Q4NX 1AVAA 3LXAA 3L2MA 1CDGA 2C8NA 2EJ1A 2ZE0A 1KCKA 2ZWZA 3EJTA 5E70A 4GI6A 1TQTA 7TAAA 4DO6A 1XSIA 3FAXA 1VIWA 3DHUA 1CGXA 2WC7A 1KBBA 1UD8A 4UQAA 3WY3A 2XWDA 2BHZA 4HA1A 3H55A 2D0HA 3BSGA 3KEHA 1J0JA 1KXVA 1V3MA 1TMQA 1JGIA 2V3DA 4WSKA 2NT1A 3ZSSA 1WZMA 2PWHA 2XVKA 4UOZA 3WNMA 2ZXAA 1UD5A 2YOCA 2F7QA 1UKTA 3IJ7A 5BRQA 7CGTA 3WNOA 1U33A 4PCTA 8CGTA 1PJ9A 3K1DA 4AIOA 5DO8A 1JI2A 4AEFA 5E6YA 3BVWA 3DC0A 3UG3A 3L4UA 3VMNA 2FE0A
chains in the Genus database with same CATH superfamily
1A8JH 5CSBA 3K0WA 4XBEL 1OA1A 2X9YA 4I13B 5I18H 5J06A 3JTBA 5LGHH 3S34L 1QLRA 4AJYV 4EE2A 1JAEA 2J8UF 3ML9A 4ETQB 1IAIM 4NAQA 3BQUB 5K9OA 3ARRA 1JCKA 5EU6B 5L2KE 2EXWD 3QJXA 3V10A 1E5YA 4KK8D 5DZOA 2XXGA 2XN9B 4JFOA 1CJYA 3QGVA 4DGIL 4MHHI 4L3CA 2AITA 2HLFC 1XL4A 4AZ5A 3FF8A 1EVUA 4H13C 2WSPA 1T1XB 3U9UA 1UXWB 2BSBA 2R23B 3X12B 1PFOA 5DMGD 1EO8H 2OJZH 3U2SB 2XA3A 1RURH 1X5ZA 1EXHA 3FH5A 1ZA6B 4R0LA 4CL7A 3IGLA 4F7TB 2Q13A 2E4TA 2G4GA 4HHGA 1SUHA 4HK0A 4NIYE 4UNUA 2MCG1 2LGNA 3TT1H 2Q7YA 2FEDC 1A2YB 1ODUA 3DRQA 4PB9H 2EFKA 3E80A 4W6XB 4FI6A 3O3OB 1Z66A 3RTQD 3E8UL 2DM3A 5F9OL 3FSZA 3R8BB 4DN3H 1NFDA 1K4CB 3MLZL 2L8AA 3O2DA 3GBNH 3T4YB 5LWYL 5BRPA 3IPFA 1FH5H 2ZOUA 4JFYB 3WNPA 1R19A 1PX3A 4H8HA 1PLCA 3N1FC 4YDKH 1E5BA 1SZNA 2XIDA 1IC0A 5F3HB 1KC5L 2VLME 2WVVA 2FWUA 4FFWD 4K71B 2XN9D 5CMAB 3U7WL 2GABA 2XRAH 3C8KB 2BHFA 5D4HA 3BUBA 1GW0A 1RZQA 1XH1A 5E7FA 3AAZA 2H2SC 2IANB 3FF7A 3QO0A 4AYDC 1QSED 4EZYA 4Q0XL 4KZDL 2E47A 1P53A 1JHLL 4OCWH 3U46B 5C9JB 5I9QC 1JPGB 3QA3A 5K5YA 3HCVA 4CDGC 4M1GH 3L3JB 2NY3C 3C09B 3IRCA 4YO0A 3QWOA 4HYTB 3IETA 4O02L 5AZEH 4QOKA 5KSAC 43C9B 3MGAA 4IRJA 3OHMB 4WUKL 3FO0H 3VFWB 2WWKO 4K3DH 1N12A 5CU9A 4OY9A 3ZDXE 1DN0A 5GRVK 1QEWA 1YPZE 4AQAB 3CBRA 4RRPG 1QSFD 1MW2A 3TPKA 4DN4L 3WD5L 2X1XR 2P5EE 2WQAA 1SXAA 5FOJA 3W0WD 1U8NA 3DI2B 4MVBD 4BSJA 1NDTA 1NUDA 4B9GA 3O2DH 4DO4A 3VKHA 3IDIA 4AUJA 3F12B 3GHBL 4BKTC 4I0CC 1FNSH 4JB9H 4JJOA 1T04A 3PIQA 1WHOA 4EOWH 3QZWG 4H26A 2GEQA 1ZLUH 6PAZA 1N6QH 3GUTA 1X03A 1ID5I 4URKA 4UBDC 3MCKB 4R4ND 4GOSA 3GMOB 2E7LA 5FOBB 1M4KA 1DL7H 1XGYL 4JO2H 4MCYB 3BPNB 3BP5A 3KW8A 1DQDL 5DZVA 2ICEC 3VFUA 4CSSA 2EDBA 3DURB 4A6YB 1ZS2A 3HLAA 3LXUX 4N5EC 4HJEA 3FU9A 2G0LA 3O9WB 4N8CL 3U4BL 3QFGA 1N4XH 3WFBL 4K9JA 4AGOA 1M9SA 4UMSA 2K3TA 3X11B 4Y88A 2H2PD 4J3TA 4N2KA 5K69A 4H8UA 4IBQA 3U2IA 1F6LL 3F6IA 4H25B 4PJ6A 1JGLH 4N2CA 2WXLA 3MV9A 3U6RB 1BZ7B 4N2AA 1G9ML 4JFDB 2MQCA 4QPEA 1FFTB 2IPKB 4Z7QE 3GF8A 8PAZA 3HG1D 2ATKA 5FA3A 4FFYL 1A6UL 3P30L 2AJZA 1RIVL 4TQEL 4JWEA 4MJIE 2W60A 3O2VL 5B8CA 2G3ZA 4GT0A 5EEWA 2XQYA 5ECJE 1LP9F 2Y2TA 5D72H 4LVHC 3TJEL 3D1MC 4PJAF 2WUBL 2D7OA 3GJFB 4TL4A 1TJHH 3B9KA 3ZRSA 3HNSH 4X99B 5LGYA 1TCRA 1FNFA 4LSVL 4BWWA 3NZ8B 3EHBB 2LV4A 5DS1A 1ZEAH 1ZWIA 3BKMH 3VFMB 4MQXC 2F8VA 2VIRB 3IXTA 4O5LL 4QXGL 3Q48A 3LNEA 1NBYA 2A6IB 1HH9B 4PJGF 3O9WD 5IMOA 2X2JA 3O3NB 1AR1C 5AKSA 5DFAA 1KWKA 3HI1A 3RWGA 4BWUA 4CVZB 1KTLB 3LZNA 3VU1A 4PRBA 3W1ZA 2YIVX 1YEEL 2OMVB 2XG4A 2Y6TE 1QZNA 4IBYA 2Q3ZA 3QFJB 4XPBL 4NPYA 4TOYH 1OP9A 3MO1B 4JFDD 3UBXB 2KQNA 1Y6MR 2QL1A 3H1ZA 1FZKA 2AXWA 1Z5HA 4PLKD 4AGMA 3VXNA 3OAWA 1AC0A 4LP5A 4NDMB 3LIUA 3G5ZB 1YNTA 4DWHA 2QVKA 1TTFA 2IXQA 3MACL 4ZFOA 2VGLM 1VADA 3PRZA 2OMUB 1LO0H 4X98B 5CLYA 1KGJA 3CVRA 3EHBD 3DROB 3GB7B 3QYMA 2F5BL 4KKQA 1CLCA 3TVMB 4OUUB 5AOKA 5IESH 4AGLA 3LN4A 3NIDE 3PXHA 3T04D 1YC7A 1AHWA 3CVHB 1BQSA 1CVRA 4QRRE 2WP3O 3A6BH 1NEUA 3LD8C 4NQDD 3VEBA 3FCGA 1NGWB 3ATBA 2XVBA 3Q2VA 5IHUH 4J4PA 3IU4H 3MLYH 1U8OB 5FDYA 4ZZKA 3WN5C 4NO2A 3KLDA 4Y2OB 1OANA 5D2NE 4F57H 1WQVT 4ELMF 2MHAB 3Q0HA 2R4RL 1BZ9B 3JTSA 4X4MA 4XNMA 4JKWA 3HRPA 4ZUWB 4GAYB 4PU2A 3RWIB 1WWWX 4LLUB 1AE6H 1F3DJ 5CUSH 2WOYA 3H9SA 1XSJA 1U8MB 3O4LA 4WAFA 4MCNA 3DVGA 4BZ1L 1OK0A 4K3JL 4X9HA 5HHQB 2F7RA 3EF7A 2CRYA 5CEXB 4JO1L 1U3HC 4IKNA 1A3RL 1DUYA 2LU5A 2QVIA 3AU0A 4WRLA 4X7TB 4GUOA 4OI8A 1MCNA 1OF0A 4M5ZL 4XPTH 2ZX8A 5CZVL 1UM4L 3ZDZF 4RRPM 3GBDA 3RWJA 1CLZL 1XGQB 2E6QA 2OXGB 3II1A 4MNQA 3SYVA 4JFFE 1HCVA 1A7PL 5ESVB 2WXPA 4GT7A 5DFWH 5L8JB 1RIUH 3AUVA 1V3LA 4ERSH 1FH2A 3GI9L 2VR9A 3WE6A 5FO9B 4N1CA 3RAJH 4BHUI 1SJEA 2BNQB 3D12B 4A7VA 2ZKYA 5HYQA 3UAJD 1R5WB 2YUVA 2X05A 2ZXBA 5IGXL 1T7VA 3P2DA 5I73B 2GT9B 1BXXA 3A21A 3ZYJA 3EJZC 4GQZA 5LKNA 1S4IA 2VTFA 3LX9A 4JN1H 3D05A 1ACZA 5EBLA 3VWKC 5IQNA 1GS7A 4GPVA 4QO1A 5ISZE 4I2XE 4ICWA 4OGAD 4HAFA 2ERJC 4JHAL 2PPCA 5E7BA 1AXSA 5BXFB 5F3BA 3EUUA 2VRQA 2Y69B 1TVDA 4TNVK 5GGTA 1EIBA 3FCBA 1CLOH 3ZDYE 1H19A 4XB7A 1T7ZA 4AZCA 2I9LA 4XE0A 1BFSA 2DPKA 5FUZL 1R5EA 4DKDC 2J56A 3AB0B 4P3WA 5BZXA 5KVGL 2JNSA 1KIPB 1OCCB 1IFHH 1K5NB 2DQDL 4Y5YC 3IAPA 1U8LB 4QT5B 4G9FB 3K6IA 4BSVB 3E6FB 2GAFD 4V1DB 4WNQB 5A2LH 3IRZA 4X6CB 1FO0A 3DMMA 3ZHKA 2DL2A 4U2YA 1YDPB 1CL7H 1KJ3H 4W9GC 4F2MA 3L5WB 2PO6D 5IVZB 3BP4A 2H0FA 2G0KA 1C16B 1XGPB 3FT2A 3P11H 1A5FL 1OTSC 3U82B 4WFGE 3UP6A 1KLGA 2NTSP 1DSWA 3NQKA 4L2YA 3PGFL 1N7ML 4JG9A 1K9TA 1S78C 2P49B 4DKFL 2M26A 4YDLB 3B3BA 5KWYC 4Z7UB 3HI5L 3UIZA 3MLRH 3OKMB 3ZKMD 4FQCL 1RLWA 5I23A 3TJHC 1U58A 1FNGA 1JNNH 5KBMA 3C5SB 4PM1A 1PY4A 3HNVL 4JJ5A 2V7NB 1FCCA 2VJ8A 2DAVA 5D6CA 4RMQA 2V2XA 4HWBL 3NJXA 3PYCA 4DPRA 1MUJB 3WFHA 3OR6B 4QRUA 1UADC 5INDA 2NXZB 4LEXH 1ICTA 1UJTA 4LRNH 1URZA 1T0PB 3AREA 3FUDA 2ZXDA 5D7JC 4L0PB 3QJQB 1IZKA 1IUZA 1X6LA 5GGTH 4D0BB 2WBWB 3MMEB 4NHUB 3FOMB 3MGTB 1U6AH 2CPUA 3QE6A 4L4TE 2GK0A 5IFHL 3GSNA 3MJ7B 3QXVA 2QXLA 5E9AA 2Z91A 3VXSB 1SHSA 3QZNA 2HH0L 1H5BC 5C0CA 5HGBA 3VXMB 3ARFC 3O3AB 3N55A 2C9VA 5I5IA 4G71B 3O6KH 4LOVA 1G5AA 1YY9C 2Y6SD 3N43B 4GKNB 1UB5A 4PVBA 4N0UA 2XXCB 1BG1A 5I6XB 3UYPB 4G7VL 4U1GC 5ICYA 5IB3B 4MXVF 2P8MA 5ACLA 5FYLH 4Y1SA 5JMOC 1IM3A 3FT4B 1CZ8H 4GIOA 4NFDA 4KXZH 5BZDB 2BSTA 3D51A 1V3KA 3MTRA 2E27H 4OJAA 2NQCA 5F0JB 3KJ6H 3KPQB 5DQDH 5SWZE 5H94B 3DXAB 4X5LA 3E2HC 3L8QA 5ABAA 1CG9B 1XF1A 2IDQA 3V4VA 3O4OC 4IS6B 1GN9A 4YE4L 4AUUA 4OD3H 4E81A 3D4GA 2XWEA 1L7TH 1RJYB 3JV6B 3VXSD 4ACTA 4R26H 4OZIF 3MNVA 5CBAB 4IBWA 3HAEB 5ANHA 5HHOE 4UDXX 4NCDA 1H0DA 5CZRA 5T3XL 3U4EB 1MJUH 1F4YH 2HYMA 1UOLA 2J43A 4HU2A 4RIRA 3VXMD 3EFDL 2NUPB 4RISL 1RD6A 1UEYA 2LU7A 1I1AB 1IGMH 5CAYB 3ER9B 5FWRA 3GSNH 4JFEE 4UQAA 4YXHH 5HHXH 3WY3A 5FLVA 1EV2E 3NPSC 2W0FB 5CJQL 3KEHA 3BSGA 5EA0L 1MAML 4FS0A 3T2NL 3IMTA 2CDFB 1NC2D 1UUNA 5GS0L 4LVOC 4W9ZA 2FQGA 4FX5A 3TH2T 3H0TA 4LK4A 1A1NA 4ORGA 4EMZA 2FEEI 5J9PA 4L23A 3ERXA 3DXAD 3ZE1B 5IFAL 5J57B 3CN4A 4NQVA 4NRXA 3S3DB 4XP5H 4HBQA 3V4PA 5JPMA 4KHXL 2B77A 4HK3J 3EADA 4CU7A 5JXED 4WI7A 3ATAA 1A4BA 4X0KA 3L3OC 5C0BD 3T77A 4UV4H 4N4YB 5F8RC 4X4ZA 1DEEA 4G1MA 3RTQA 3L5IA 5BV7L 3EH2A 2CLVA 3WIFA 2W9DH 3V4UL 3VI4E 3MKKA 1MFEL 1U8HB 1WIPA 1TNNA 3V4VH 3CX5K 4JFZL 3N42B 4KVNH 4ZPVB 1U2HA 1I1AD 4PRDA 4Z7OF 1ZCRA 5KBPA 5T1MB 3CFJA 3G5VA 4QHKI 5JIDA 1JNLL 1GGCH 4KTYA 3PGDB 2C3XA 4P46D 1N8OE 8FABB 4CW1A 4IKKA 1VEMA 1FI8C 1HHIB 4FP8L 4YHNB 3GRBA 2XTJD 3OV6A 4OCSH 3VXUE 1OGAE 4JDZB 1QSEA 1X9RA 4WI4A 2V2WA 3MCG1 5CHNB 4ZFQA 3BEVB 3TO4B 5AYUH 3VD4A 2X7LB 3K2KA 4JY4A 2YEZB 2YGNA 2YL8A 1Z1WA 1IL1A 4M93C 4YHZH 1HI6B 4QUOA 2EKJA 3ARGB 2ZKMX 4XN5A 3JSSA 4PG2A 3E1ZA 3BDYL 3SKJH 4OCXH 1AHMA 1TJXA 3C2AH 4MJ5A 3KGRA 1I9IH 4EKXA 3HHMA 5I26A 3WN5A 2XTSA 4KKCD 4XTRC 3ZIYA 3V4PH 4RAUB 3T6ZA 4UTAL 3F85A 1URUA 3ULUD 4JFYA 1QSFA 3NEOA 1E28A 4L4VB 2DI8A 2JKJA 3S9DB 4EZWA 1ZANL 3A3YB 4HPOL 3W0WA 5FV1L 5CMAA 2Y5QA 4L8DA 3P4LA 4N26A 5ADOH 1RSFA 2OTUB 4HJGB 1AR2A 1B0IA 4Q56A 5KN5A 3WAJA 4BRJA 4F01A 1SVBA 3JTTB 4G8IA 1KCUL 1A6VH 2ENPA 4N3UA 4PSRA 4AGPA 4UINL 1O7DE 4HKXB 3S96A 2WXMA 4ZD3L 2XXMB 5TQ0L 3SZKC 4ZW7A 3IJEB 3ROLB 3TA3A 3AMLA 4FQHB 1BVOA 2XWTB 1SM3H 1KCRH 4D9LL 4XNUH 2IIJA 4UDTB 3GMLB 1HXMA 1KCVH 2EYRA 4FLRA 2Y2YA 3IDGA 3LMJH 1F4WH 2IPUK 5EC2B 1Q9OA 3BN9D 2PWGA 4XI5C 43C9A 1EPFA 2HUEA 3BUYB 2JK5A 4OBRA 3FO9A 1CDYA 1KBGH 2N56A 1MCQA 2J73A 3BKYH 3LIZA 5ACZB 4APQD 5I71C 5KUKA 4OZHB 3EYFA 2X87A 1N5AB 1WISA 4ZNCD 1B3JA 1XH3B 1M7DB 4LSPH 4R90L 2IWEA 5CZXC 5DVKA 3MNMA 3I6LE 3S98A 1N0XH 3WJLC 4K15A 4LLQB 3WGVB 3X1FA 2DMHA 3FU6A 5BJTB 1G7PB 4GAJL 4LCWD 3B7YA 4NKQB 3LRKA 4G8GE 2X4PA 3UAFA 3HG1A 3OMIB 4JRWA 3Q2NA 3B56A 4O00A 4BQ9A 4G6FD 4EJ1C 3BSZL 1QR1A 4V33A 5IVXE 4GSXA 3PHSA 2VQ1A 2X6AA 3LEXA 3ALPA 4Z7IA 4R5XA 3PXJA 4NT6B 4HETA 3VMOA 2RAIA 1BJMA 4FLQA 1TQCC 2PYEB 3Q8FA 4PRHE 4YHLH 1DBBH 3MLXL 3CX2A 5CGYD 1BMWA 2R2BA 3FO2B 4HXBH 2AEQH 3QVAA 1L3NA 1MJJA 2CNYA 3B9DA 3WKYA 1KYDA 5D1ZB 1A7RL 3ASNB 4WJ5B 1JPTL 3HRZA 1OSYA 4JM2D 4DTGH 1DQKA 4MNHB 4ODTL 3LIZH 3MBWB 4LIQH 3VAEA 1TJIH 5DR5H 3UERA 5I1DB 4XCYB 2FWOA 1I3VA 1DLFH 3V9CA 1ID2A 4HLZH 4JRXD 3BHBA 1FNEA 3CVBA 1QTPA 2ZOWA 4YFDB 5EU6E 3B53X 3RVWD 2H6OA 4K2UH 3EYQC 2VSCA 3V6OE 3NZ8A 2J8UB 3DGDA 1GOGA 1TZGH 2HB0A 5HHMB 3WXWL 1EMTH 1J8SA 3RX8A 4PR5B 5SWSD 3QDGB 2Z6FA 3A6CH 3PWPE 4MRCA 5MI0C 4NQDA 4G70B 1UH4A 4X5XB 3F8UB 3L45A 2ZX7A 1LWHA 1G43A 1U8IB 1NIFA 3APMA 3F58L 1B6UA 5GGUB 1L5GB 2VDKH 4G8EA 3ZKSD 1INEL 4PWKA 4XHJC 3K6NA 5EORH 3TIDB 3EW3B 1BDYA 4F00A 4YSOA 5C8JA 5JOFA 4MA3B 3OQ3B 3A4EA 4FABL 4M29A 1MHEB 3MO1A 3T08A 1XSKA 1GPOL 3ATFA 2P80D 3F3HA 2HKFL 4UDYX 3S35H 1CB4A 3MRGA 4XBGA 4Y16B 3HG0A 2E7DA 1L9RA 3G5ZA 4PJFF 1QO3B 1AQDB 5DJZA 2M83A 5LG1A 3DUUB 2F7OA 1RERA 4CU8A 4WI8A 1BVZA 2KYIA 2D31B 1GC1C 4H1LA 4B27A 2IANE 2YAEA 1JGUH 2A7BA 2EDFA 2IDTA 5JOPE 3DX1A 5B3JE 3H2QA 4HUCA 3GDBA 5DA0B 3QORB 5I16A 1SU8A 1BVNP 5DEZA 1GS6X 3GZPA 4GQPH 5F7NC 4Q9QH 4OD1L 2W95A 3FN0L 3TP4A 2YKTA 1FYTB 3TONA 4WSGA 3UAJA 3CZFA 5DEFB 1QBMH 2A38A 4RSYA 2X2IA 1BM3H 2D03H 4DK5A 1ZIAA 5ICZB 3SODB 3CQPA 4RFNC 2Q2LA 2R15A 3U6XS 2CHWA 3VXTA 5DGRA 1D7CA 1ED3A 5BUGA 1HCFX 2ZWKA 4E9VA 1F90L 1G87A 1GIGH 3OB0K 5GRWA 5GZOC 4FQLH 2FEEL 4BYHA 3ETTA 3G6DL 5CEXA 4HC1A 2Z1PA 4NERA 1F3DH 3DYTA 1D9KC 4ONGH 2OSLB 2JXMB 5CJXC 3X2QB 4B50A 2Z4QA 3FB5B 2GYSA 2GBTA 3GKWL 1MDAA 5DD3L 5HDRA 4IRSC 2Z31C 4MD5B 3GIZH 1G7LA 4ZXBC 1II4E 2ZUQB 4ZFZA 1HQRA 1BJ8A 1JZ8A 4R6UA 4QRQA 2OX5A 2ZOKB 3O6FB 5IJCC 3NP3A 2D1LA 2IGFL 4FXLA 4H1LH 1NCGA 2IDCA 3FHQA 5LNDA 1DVQA 2PO6A 2PR4H 3RGVC 2Z9TA 5A43C 1YYLH 1MLBA 3DTDA 4EUPG 4Z0XA 1JGDA 1RP9A 3T8VA 3LQAC 2E9IA 3SGEI 3SB3A 4R5IA 5DUBA 1SYSA 1CXLA 1UM6L 1D6VH 3ARDD 3QUML 5KSUA 2G5BA 3BAEL 1SMDA 1NGXB 1BF2A 2F68X 4N2FA 2AJVL 1OAKL 2IOIA 4ODVH 2NZ1A 2WJ7A 1CICB 2J5LC 1ADQL 4HIJB 4ILDA 1ZYLA 2XA8H 4NZJA 1E9PB 4LU5H 1SEQH 3MRHA 4BQ8A 5DJ0B 2NY0D 4QXUL 5H35A 3WUWG 3U36A 2B4CC 2Y1VA 1KIUA 1SNRA 4WU7A 4PJIA 1UM5L 1MF2H 2FH8A 2ICCA 3EGDA 4M43H 4NKDA 1DFBL 5TF0A 4HC1H 4ANVA 4LLYA 2ZNXA 3ORJA 3RG1C 1IQWL 1LP9B 1ZJBA 3IDUA 2GFBB 4PJAB 2EIMB 4OZGF 1U8JB 4PJEA 3PREA 2D2CC 3ZOAA 5SX4I 1I7RB 2O4EA 3W9EA 5JXAH 3OC5A 4AG4L 1F4HA 2C34A 4CSPA 1MXDA 1G1CA 1FE8H 2W81C 5C92A 3QBTB 4PJGB 2CCWA 2F0CA 1IV8A 3PDOA 5J12C 1MI5B 5DRZA 4RWYL 1T4WA 2IBBA 2QELA 4M8QA 1IAII 1MIMH 3QFJE 4YE0A 1DVSA 2YMXL 4N6RB 3EO1A 1D5BB 1ZKAA 4KXDA 1YECL 2ZAGA 1AY1L 5D2LA 4X5RA 3GBML 4IIQC 5F1NA 4PW9A 2OZNA 1ZHNA 3QJTB 2CCVA 1DJZA 3HMXA 4EZUA 3CFIC 3ARTA 3FRUB 1A7QL 3WIAA 2CLRA 2HT2C 2K70A 3KNBB 1JF6A 4IMLA 4X50A 3IKCB 4WWID 5D7IA 1AIFA 5DRXA 2R1WB 2X6VA 3O3MB 5ESQA 5I76A 3OZKA 1FBIH 2G2NA 1WCQA 1I8LA 5AAMC 1KJMA 4WFEE 1UUSA 4LL1A 4PG9A 5F6HI 1JQKA 5I1HH 4YNYB 3DHJA 4GQ9L 4JPQA 2NY1B 4N0YL 1WUZA 5KS9A 4LPWA 1IGTA 1OP3H 3CZNA 5BW7C 1UZ8B 5CEYB 4DIXA 2GI7A 4TUKH 1EEYA 4HWEH 2F1EA 1MI5D 4KPHH 2QFFA 1QX1A 5JW3L 1KMGA 1NC2A 1NAMA 4O9HL 2ITCA 2VM9A 1SHMA 3FTSA 2AK4D 5E5MB 4N90D 4ELMB 1LEIB 4Y9FA 4GLRH 1TQUA 5L88H 1AO7D 4Z8FH 5CP7A 5CF3A 1AVAA 3G9GA 4X6EA 2C8NA 2G5RA 2Q20A 2V0AA 3KWVA 4OFIA 5JXEA 4C56B 2VKWA 2YRPA 3K72B 3KBEA 3HBPA 1JUFB 5CSZA 1Q9LA 1DVFC 4YUEH 5C0BA 5IQ7L 1MN4A 3KPNB 4IYKA 5E6UB 2EC8A 5GRXG 3R19A 4KKBC 4PJ9D 2G9HB 3HC3H 2WC7A 3F84A 3QUXD 5HDQL 4YHKH 2HFGL 3HMXH 4PJCF 4LT7A 4ODBD 4UUJA 5AWNH 1E9QB 2WUCL 1T22B 1JGIA 4R4BA 4U1SB 3RWCA 1MRCL 4EZPA 2DB8A 3P3YA 3GSQA 4WU5A 4TNWK 1JTTA 4P46A 5DC4B 4U6YA 5LN8A 3CFEA 3ZDZB 4HD5A 5A1AA 1A9VA 2JJWA 2BNQE 4P5TC 4GW1B 3GSOB 3UG3A 3QZLA 2DWEA 3G04B 1RUKH 3VA2C 4NNPH 4AY0A 2A6KB 1OGTA 1J05B 2EE2A 2DMGA 3L4XA 2MH4A 2WNGA 4XXCC 5DJYB 5IM7B 3T6WA 1GYUA 1ZDQA 1NAMH 4NRYA 1MLCA 3ARUA 2BSCA 2B1AH 2WINB 4JHUA 1B0GB 5LG6A 4B53A 3O8XD 1KB5A 1G7QB 2F61A 3FNKA 5JUEH 5GRYA 5DZ9A 4MQTB 3H54A 4G9FE 3S3PA 1AGFB 2NY5C 1E4WL 3LN5B 3P9MA 4RMSA 4V1DE 5DYOA 4JO4L 3QRGH 5F2FA 1BQRA 2Q6WA 3CSFA 1X5KA 3I75A 5A3IC 2W38A 4G6MH 3C08H 3L9RA 3I6GA 3BCDA 2VLJA 1M2VB 1BXVA 1HHIA 4PV1C 1FZMA 1FJ1B 3ALXA 4X8JB 3D85A 3FOLB 5I9QB 3FQ4A 1JERA 2K6WA 3QFDA 4IRZA 1JK9B 4Z5RB 4X6FB 3HJEA 1IEBB 1JZDC 5T1KB 3FONB 2NY3B 1RUPH 4WHYH 1E67A 4Z7UE 3AG3B 5B1AB 1W80A 4PRIB 2HFFA 32C2A 4P4KC 1NGZB 5FUOL 1HI6A 3MBXH 4JLRB 4R7DB 5F88A 2VWEE 3VQ2C 1AMXA 1I1YA 5ID1B 3MLVH 4BQBA 2DYPA 4NFBA 1TSHA 2YBRA 4X4XB 2B08A 5C7ZA 4U31A 4APQA 3I2CH 3KBHE 4YLBA 2X6UA 3SCMD 4GFTB 1RJCA 4S0SD 1S9XA 3CFBA 4MXWH 1XO8A 1F5WA 1MWAB 3KXFB 4G9DB 3SDXF 5I1EH 4EZQA 4OM0H 4TRPH 3V0VB 1GS8A 2VH5L 4NOFA 1CT8A 1KB5H 4AL8H 5ICXB 4FNLL 3GYRA 4OUOA 4LCWA 5EU7C 2VDPL 3ULUH 3LHAA 2D7PA 2CQVA 1PQZA 1YNKL 1KDIA 1O5PA 2Y36L 4P07A 3OKYA 2NY3D 7PCYA 2DD8L 3UGXA 3TBTA 4X5QA 1ZAGA 4NUJB 4PRID 5EZOL 1UB6A 1ZTMA 3VXQA 2X4TA 3T6QC 3WXVH 1QFOA 4O51A 3DBSA 2ICEB 3HC2A 4PBWD 2CUAA 2XN0A 4IRZH 5MERA 2UZPA 1OGPA 3MA9L 1HL4A 3D4ZA 2Q8BH 1UJ3A 3C75A 5F1SA 1OK8A 3CUPA 4B6ZA 2G60L 1NL0L 4A55A 4FADA 5JPNA 4NO5A 1QUPA 3KPRA 2IADB 5ALCL 2DDQH 2VSMB 2ARJA 4IOFC 3IWUA 2V9RA 4JM2A 5LNGA 1IKFL 2W1NA 3M17B 4KQ4L 2B14A 3AY4A 4P5MA 2VDNH 3KLQA 4ZS6C 1PTZA 2F53B 2F8OA 4A39A 3MNDA 4YHPB 1JXJA 4GRLC 1FC1A 1MCPH 4YN3A 2WO4A 4OZIB 3F7RA 2Z8YA 2QGEA 4RFEA 1BF8A 4UBDD 1T7WA 3FHAA 3T49A 4JRXA 4LVHB 2G2RA 4M1DH 2HMIC 2XFGB 3T1FB 1FUNA 1JPFB 4JGMA 3TH3T 5EPMB 4JPVH 3WDJA 1YY8A 2BRRL 2W9EH 2FECL 4ELKA 3IE4A 1AD9A 3RUGF 4H6IA 1N64L 4ZPTB 2P46B 4YHOL 5SWSA 5L2JA 1WTLA 4PRPB 3I85A 1T5KA 4FJZA 5DFVC 3G3LA 4I85A 4JEGB 1AR1B 2EE3A 1MCIA 1RZ7H 2WCSA 3ZE1E 2IJ0C 2VLLA 1KEMH 3TL5A 2CGZA 3UTTB 5CFAA 2TSAA 1RULH 1SN2A 3IXAB 5G4OA 2EEDA 4I87A 4G6AD 3V7MA 2KZKA 1KWGA 4YPGB 1Q0XL 3QISA 4LVEA 3RBGA 2QGCA 4NB7A 4F7CB 2I9TB 2OCJA 2AXGB 2IWFA 9CGTA 4PJBF 3FQXA 5I1DA 1M57B 1O9VA 2XCMC 1NGPH 3FCTB 5FGBA 1DJXA 1B0RB 2P80A 1RK7A 2FB4H 4JFXA 1JL8A 3PWNA 3U30B 1C12B 3K8LA 2OYKA 4EZJA 4UZGA 1E27A 1X5IA 1IAIL 1NFAA 3APFA 3G6JB 2FYVA 1SLXA 2IQAB 3OKOB 4OGZA 5EUOA 1NOLA 3UJTL 4HIXL 1XAUA 3C60D 3MQIA 1B6DA 4Z7OB 4JNFA 1TZOA 1U95A 2H4EA 2X70B 4GKLA 4MCZA 4MQXD 5TFSL 2JB5L 4PB0L 2BOCA 4E42A 3CZSA 3VQ1C 2IDUA 3PDDA 4WO0A 5C0JB 1E4XI 3VJ6B 3LD8B 2D3LA 2YLAA 4DP2X 1AR1D 1P7QA 4P5RA 3P69A 2ADIA 3LHPH 5DHVA 1OWRM 1D5IH 4ZUUA 4HMDA 3FRPB 1S7WB 3FU8A 4QF1B 2NW2B 3WN5B 4HG4J 5AD0B 4FQPA 4JREC 1KT2A 1NFIB 4HFUL 3NJHA 2WSKA 2HFEA 3GDCA 2WHVA 5LAXA 3LQZA 2ITDA 3D5OF 3FMGH 4RGND 3OWEA 1K8DB 2YWYA 4NUMA 2NYZA 4YJZL 4UT9A 2AGJL 2BO0A 5HYIA 2X4SB 1Q9WB 4J3OD 2F7IA 1AC6A 2R2CA 4BFOA 1OB0A 2R51A 2YOAA 3R06B 5FYJE 4RCAA 2ATAA 1VFBA 4L4VE 3MRCB 3RU8H 4AQEA 2MQ3A 1RZGB 4JQXC 1UOKA 3FB7B 4O2EB 1OLLA 5TQ2H 4KTEL 1RHFA 1U3HB 3DPBB 1M71B 4KDWA 2ODHA 2ATPA 3BPCA 5E8NB 5E1AA 3Q05A 1AMYA 1U4FA 3HG3A 5E51A 3U9WA 4JMNA 2WWNA 1ZE3H 1INDH 4L29A 1XF3B 2AMGA 2J2ZB 3SDDD 3UTQA 3ZZ1A 2B0SL 1EHLH 4X5WB 3NSDA 4R2GD 3UEQA 1F41A 1HS6A 4HS8H 4N22A 1QEXA 1A3QA 5JDSB 3TWCH 4XODA 1UATA 4RA0C 2QHRH 4OLZL 3STZB 4ZQKA 5DHVH 5G5DB 3BD3A 2J55A 1QBAA 3CN2A 5AVTB 4F1SA 3FB8A 2NY7H 3VWKB 1AP2A 3KLKA 2ERJB 5JQ6H 2IF7A 2E7CA 4HP5A 3ARDA 2OMZA 1JTPA 5FA4B 1GY1A 4OCRH 2QR0A 3ZT7A 3ZLQC 4Y9CA 2EYTB 2YSSB 1H3PH 4MNGB 2O5ZL 4UT9H 4Z77B 2XFXA 2EIBA 2FT7A 4Y5YB 3EXLA 3UOAB 2JMRA 3ETSA 1NCAH 3O2WL 5CBEA 5AVWB 2VOTA 1MFUA 5EUOF 1YAIA 3UBXG 3G5XA 3KPLA 4WNJA 4JZNB 4KH9A 3U7YL 5DLMH 4JHZA 5HVFB 3HC0B 4PRNA 4BKLB 2DQGL 1YVLA 3EFOA 5A16A 4GSUA 4WTXA 3VFPB 3GPSA 1DR9A 3FUNA 2QPEB 2PYEE 1OKEA 1X7SA 4U2ZA 3SPCA 1F18A 2V37A 3FTXA 1TJGH 5IREA 1IC4L 3FKUS 4P3CH 2EH7L 3SQOL 3T3PF 4YZFF 1X3DA 3UZEA 4EQ3A 2YPVA 3P0YH 4MAZA 3PGCB 1H15A 1UH2A 3R0NA 3BGMA 5EN2B 5T3XD 4HIJA 4K7PH 3EYOA 4GMTL 3HVNA 5D7JB 5I19L 2FT8A 1TYEB 2VDRL 4G7YH 2YD7A 4JGNA 2MCAA 2XOTA 3U9PH 3UPAA 2WXIA 5FDWB 1TZIA 4WEBH 1ZPLA 2A9DA 5HJ3A 1KXQE 5BZWA 5HHME 1NOFA 1H5BB 1F97A 3QQ9C 1KYOK 1OTSD 2YN5A 3ARFB 3DHPA 4LBEA 3IAQA 5CLWA 5GS0D 3B2MA 4PCSA 3QDGE 3NG5A 1NANI 5KOVC 2YGOA 1UASA 1ZS8A 4PUBH 1K8IB 2YJQA 2ROYA 1GSMA 3C12A 4U1GB 3TJHD 2OS7A 4AMWA 4GMSL 4IK6A 1VRSA 3IBEA 2BWIA 1V3JA 3U1QA 5E9NA 4K7PX 3V0GA 2QDWA 5JNYB 3VE0A 3HMWH 1NJ9A 2CR3A 4P2QE 5BVJB 5HP5A 2WIIA 4YX2H 3B83A 2AK4A 4GKZB 3WMPA 1SLVA 2V9QA 4R96A 4UV7H 4YBLC 1AO7A 3E2HB 1X5YA 1IBDA 2BVOA 3L3HA 5DJ8B 2Q86B 5D7JD 1N70A 3O4OB 4JFVA 4IMKA 1BZEA 2DIAA 3MRFA 1YEWA 2IWKA 2VR6A 1U2CA 3B5HA 5FKPA 3HUJF 3RWFB 3FFCB 1GGIL 1ILUA 2Z0OA 3B43A 4YFEA 2YPVH 3BQVA 3LRHA 4G42B 1LEGA 2Y5TA 2CKBL 2CLZA 4NN7C 3QWQB 2Z1KA 4PJ9A 4PJFB 1PX8A 1LO5B 3FUHA 4XBEH 3FULA 4H8VA 1BBJA 3QUXA 1LJMA 3WY2A 2V5MA 3S34H 2HA1A 2B1OA 4N9GB 1XZ0A 1UCBL 3GUFA 4FKEA 1WZ1L 2J4WL 2P8LA 3W5NA 3CJJA 3NPSB 4ALAC 5A6MA 2GQHA 5EO1A 4YSSA 5E2WL 5ECGA 1ZLWH 2PMZA 1KPVA 5F9DC 1G7IB 4F8NA 1QABA 3A4DA 4O02A 3T8XA 1BQKA 1E7UA 4LVOB 1FYTE 5CINL 1FVDB 5CLXA 5IOPA 1CDGA 3QRFM 4BCXA 4Z7VA 1KIRA 2ZWZA 3KH3A 1SU6A 3QXWA 2APTA 4RLDA 3PE9A 2NX5B 2JTDA 3TFKC 5CEZE 3OJDA 1X7TA 2IAMC 4JZJC 3LB6D 2WQVA 3L3OB 2FD6L 2PCPA 5F93C 1KPUB 1MCOH 1U92A 2FYYB 1CQYA 5GIRB 5L7XL 3HBGA 1GL4B 5F9OH 4EZOA 1A4KB 3VRJA 3CQQA 3K7UA 1KV3A 2Q76A 4JBSA 4PRAA 4MYPA 4KIKB 1HOCB 3MLZH 3DK0A 4KDVA 4DCQA 1QKZL 1VDGA 1NDGB 1TMQA 1XBDA 2VYRE 1GZHA 1COBA 1RUML 3O8XA 4FYRA 4JDVA 5LWYH 4YS4A 4JJHA 5A40E 4ZAKC 5CP3A 4AK1A 3MJGX 3HHSB 5BRQA 3SIKA 3BWUC 3WNOA 2I60L 4GXVL 1J5DA 4EZTA 1U33A 3COOA 1RY7B 3D69B 4L9LC 4X8GA 4KJYB 3OWRA 5F6IC 5T1LB 3B2XA 5DO8A 1KC5H 1P5UC 1L9NA 5IJVB 4QRTA 2GITB 2AFNA 4Y4FD 3U7WH 2N7SA 5IWLA 3SYOA 4EN3C 3BE1L 2Z0BA 3AC0A 4OLEA 1PCXA 3TBSA 5IQLA 1IAOB 4QMEA 5CIPB 3HZVA 4Q0XH 5EZJA 4J3XA 1JHLH 4U49A 1G1YA 4PJXA 3UDWC 3JWOC 5FHAL 4KROD 5A2FA 4U1IB 4NZTL 5F7EL 4M93B 3SDYH 3VNYA 3FQUB 1JV2A 3MRBB 3L54A 1SF5A 4O02H 3GWJA 2F8XC 2ZKXA 4WUKH 4JY6B 1P7KA 1U8CA 5D8JL 4DT2A 4XN7A 5KYXA 5IHZA 1AKPA 3FSOA 3LV3A 3DDFA 1NSNH 3PS6A 3BPLC 4TSAL 3SCMA 1TDQA 4DN4H 3EKCA 1D5ZB 1L0YA 3ECWA 3WD5H 2WN2A 5KBDA 4PJ7B 5D7KE 2QFPA 4QHMB 3PWJB 5DQJB 1I8MB 3GMRB 1YEHL 3GHBH 1ZVHA 1LP9E 4F2EA 3EBHA 1X04A 2HRHA 5CP3H 1FL3B 2KLSA 4HV8B 4MB1A 2JWYA 1XCWA 3QRBA 4PJAE 3U6XA 2BP3A 2XJLA 1JVLA 3BP6B 3HAEG 3N1PC 1KJVA 2GIYA 3NGBC 4J8RA 4PWIA 4DZBB 1RK1B 4OZGB 5BS0B 3GXTA 5DJAA 3RPIB 2FSEA 3B37A 1I8KA 1XF4A 1XGYH 4PJGE 2AXFA 2DKMA 3CN1A 3ZTNL 2JJTC 1DQDH 2HJKB 2YARA 4R7XA 2F18A 4PS4L 2OXHA 4TNFA 1FHGA 5I71B 4N9OB 1JWMB 1EUUA 1L9MA 3HAIA 3BIKB 4N8CH 3U4BH 3QNYA 1TFHA 4P57B 3DJZA 1OOAA 3WFBH 2WXFA 3S3SA 3CK0H 3GGWB 2FJFB 4FNUA 1WDZA 4AZGA 1FFPB 3MV7D 2E8YA 1RLBA 2EUZA 3RVXD 1G9MH 3NRFA 4LLDA 3FQWB 4H8QA 4R8WH 3QI9C 1A6UH 3HLKA 4GSRA 1RIVH 4TQEH 3AZUA 3KPSB 4AEEA 4RGMC 5A2JH 3O2VH 4PV8A 3CMOL 4APXB 3HAJA 3TJEH 5TF1H 2WUBH 3QJFB 3DV4B 3OHXA 4BRVA 1CGSL 4L1LA 4LSVH 2VXQL 1MJGA 1LYQA 4BH8B 1D6EB 2CDGA 1OQXA 5TD4A 3QEHB 4XI5D 5JHAA 1I3GL 2IH1B 3T0DA 1EDQA 4O5LH 3KPMA 1S7UB 4YSPA 3ULVC 2HLAB 1TQCB 4KO5A 4QXGH 1PYWB 4S1DC 1PKQB 4ENEC 3PHAA 1T7XA 2UWEF 4ELME 1IEAA 2PWEA 1MREL 3TNMB 4HW6A 1KYFA 4D3CL 3QJUB 1J9QA 3MV11 5I1JL 4RDQG 5CZXD 1HHHA 3OGCA 4MA1C 1ZJAA 3QULB 2WK2A 3DGGB 3TU6A 4WGWB 4MAUL 4C56E 3X13A 1OCRB 4ZYKB 3D87B 3M17A 2VDOL 5HGAB 3SGJA 1Z9LA 4LP4A 2VC2B 2HPOA 2EVJA 1GTFA 1R3JA 5IHHA 3QK0A 2AQ1A 1EK3A 3K6FA 1KXVC 1WBXB 2ADGA 2VXSH 3BUIA 3CHSA 3SYPA 1KB9K 3WNJA 2EZ0C 3DOSB 1KEGL 1J5CA 1DQIA 1NH6A 3BCFA 1ROWA 3MACH 1WTGT 3L4TA 2CUIA 4PJCB 1L7IL 3C60A 5DEJA 3ZDZE 1EFXD 1SJHB 2VE6A 3S8FB 5EOTA 5I17B 4JHWL 2A77L 3EBGA 5MI0B 1G7HB 1BFOA 3N41F 3S36L 1TO4A 1A65A 2ZIDA 2Z93B 3W39B 3UTSD 3ZIMA 1MFDH 4XN8A 1T3FA 1W72L 3MREB 3J7HA 4K5PA 3AFLA 4YGVB 2FGWL 3F65A 1UC6A 4F7CA 2I7OA 2LFGA 3CDCA 3P77B 2LE9A 3SE4A 3DK2A 4KXCA 4KAQL 2MPAL 3WG7B 3WEOA 2QT6A 2VO5A 5FFLA 4YGAB 3IDJA 4K07A 3FFOA 1OF2A 4IWPA 1C5BL 1CFQA 2PN5A 3CSYA 3D39D 4K3JH 4HJ1A 4WFFD 4CADB 1HHGA 3HB3D 3DI3B 4U0RC 12E8L 3MUGA 4AYBA 4EI5A 1A3RH 1TVHA 2A83B 2DL9A 3KM2A 4PP1C 1NIAA 2L7UA 4UB0L 2ADJA 1OD7A 3LH9A 3O0RL 4XRCA 1LD9A 4OT1L 4M5ZH 1FP5A 3AMKA 1JRHH 4J7RA 5CILL 4ZMLA 3U1SL 5FB8A 5KBKA 1UM4H 1CLZH 4U3XA 4QAMB 1MG2C 3SDDA 4XP1L 3IDMA 1A7PH 4P3DA 4HHAB 5HVHC 4GUQA 4Y2NA 1A6TA 3EAKA 1N67A 4PRIE 3GI9H 4U1NA 3GS0A 5IB1B 3CLEL 5JW4Q 1TQVA 3DBXB 1Q72H 4FZPA 4XNDA 1NPNA 3TBWB 3HBZA 4ATWA 2FJUB 5AL8A 1T2JA 4P8QA 3JWDC 4HWBA 2HT4D 4RFNB 5E03A 2CE6A 3EBIA 4TVPE 5FO8B 5J89A 4N85A 1EH9A 3K6DA 4JHAH 4RMWA 4KJQC 2LLNA 4TSBH 4XMUA 4FKKA 3KXFE 4L37A 1M53A 4H6HA 3UAAA 5JDJA 3IJHB 1MHCB 1E3FA 4WO4A 5C0IB 3BWUF 1J8KA 2LQRA 4NIKB 4F7EB 3IBOA 3CAZA 5FUZH 3SDXB 2ZYSA 3WFCL 2BXZA 2IMNA 3VVWA 1D9KB 1ES0A 1MW0A 1PIGA 2DQDH 4J3OH 2VZVA 3OXSA 2YQ2A 1QMUA 4KK9C 4IRSB 2Z31B 5GSRA 4ZXBB 1SXNA 5HXMA 3L3IB 1X5MA 4UQ2B 4MNQE 4NN5C 4K3GA 1FORL 2HJLA 3CH1A 4G6KL 2CGYA 3RGVB 2VDML 1FNLA 5I6PA 1A5FH 2KLTA 3D25A 4XO8A 1VCAA 4MXVE 2OQJA 2J21A 5DD0L 3PGFH 1N7MH 2QV4A 3L3DB 4DKFH 2Q10A 2YPKB 4M6NL 4AIZB 3QAZC 1JWSA 3HI5H 1N0LA 4FQCH 1QFHA 3GSRA 3BRGC 4POZD 2MSPA 4LSUL 4NRZA 2XWBA 3VFNB 4GUCA 3QDJB 1T1WB 5AB0A 3L3GA 4PJDA 1BZQK 3HNVH 3HOGA 1ADWA 3DRTA 3HE7C 3F01A 1FVCA 2EYTA 1JZ5A 1JG9A 4A04A 5EFIB 1CD1A 2J5LB 3CPLB 4HWBH 4RBPK 3QNJA 4JMXA 1D9KD 3P0VL 2F53E 1D5MA 2E86A 3RGHA 1R3KB 2ZCHL 4Y5VC 4OZIE 1IM9B 1FAIL 5K39A 3LPFA 4P9HC 3WNKA 4EF3A 3JVGA 2IO5A 1RU9L 5IFHH 1OLZA 3PUCA 4MRBA 2X38A 2WB1A 1CF8L 2EVFA 2ZWNA 2D9QB 4U1JB 2JJSC 3BW9A 4AKQA 4I18C 2CXGA 4ABWA 2NZ9D 1ND0B 1HEZB 4Q6IA 2I27N 2UYLA 1A6ZA 1XMWA 4PRPE 3V5DB 5I66B 3DOHA 5IQMA 5KYWB 3CVDA 4JGJA 3KDMB 2DMKA 4MWFA 4WW2C 1B2WL 2QSTA 5DTFA 3RUGB 1P6FA 4U7MA 4G7VH 4HQQL 3UTTE 4G11A 5M7QA 3QDJD 3V9EA 5MEQB 5J12B 1D7DA 1E3XA 2DOCA 3LSOA 3KYOA 5FAAA 4ZZFA 3VCLB 2A9CA 5HYFA 5C5BB 2NXYC 2XYBA 3TCTA 2LOEA 4IIQB 4TQHA 4UT6L 1JXFA 1QNZL 1SLUA 5DUPL 2WANA 4YE4H 2CGRL 2HG0A 5C0RL 3CKDA 3SKUD 4D9QD 3IGAA 5IB2A 2PWDA 4PGCA 1ZVNA 2NYKA 3ZMNA 4Z7OE 2XQBL 4ELDA 5T3XH 1X5LA 3DX3A 1XGTA 5ERWB 4P05A 3EFDH 4CU6A 4RISH 3K91A 2HX9A 5C0CE 4RAVB 4ZMQA 4JRYB 3EDEA 4DSYA 1N59A 4K8RC 3LKOA 3MJ8B 2XT1B 2WXQA 3B2UD 2WXNA 1HHJB 1OHZA 1JHTA 5A2CA 3ULVF 1PPIA 4YHYC 5IUCA 3FQRA 4J3SA 3VH8B 1JF5A 2R7EB 4N0UE 5CJQH 3T2NH 1PZ2A 2BNRD 1MAMH 2C9QA 2YMOA 4Y19E 5DGQA 1WD8A 4IBZA 1CBJA 3DJRA 1IBZA 3WNNA 5GS0H 5DMKB 3TTYA 3TA4D 3MC0A 4GB9A 4BELD 2OBMA 4OCLC 3BN3B 2ZT9C 5L8KB 1NM4A 2I7SA 3UJJL 5IFAH 1FL5A 3ZQWA 2BVPA 3ME0A 4PGEB 4KHXH 3PP4L 3SE8L 2ZONA 4GEJA 4UTAA 4FNQA 3TBVB 4LEOB 2AQPA 2HT2D 1DVFB 2DYSB 1MW1A 1P1ZB 1HEJC 2EDWA 5BRZB 5BV7H 1EO8L 2IH3A 1RURL 1MFEH 1QLFA 3KCPA 1YN6B 5HPOA 3T0VA 3UITA 1XHHA 5HHNA 2EECA 4LVNB 3MODL 3M1BA 3PWVB 5IMKA 4JFZH 3SDAD 1UXLA 3QJSB 3QQNA 4LHUB 1JNLH 3O45A 3TH4T 5JLZB 5CGBA 4TPRL 3JQOB 2ZE0A 2EJ1A 1Z0MA 4Y4FA 3FB6A 2CIKB 4NKOB 3QPQC 2ETWA 1TYJA 3MNZA 5AW6B 4E9SA 4XCFH 3EJTA 3GLZA 3NRPA 1CL7I 4LASH 4FP8H 4P5TB 3BJ91 7TAAA 4UYQA 3T2LA 2EVIA 4RESB 3IDYC 2ELBA 3Q9QA 4Y1AB 3DX6A 5F7YC 2XWDA 2R9HC 4U1KA 1JBJA 2OMYB 2AV1B 4JUSA 1UWFA 4PMEA 2AQQA 4G80B 1J1XL 5LLIC 4KKBD 4WKXA 2L7EA 3UYRL 2CJSA 5BOZG 4MNGE 3FU7A 4PCTA 4JFHD 1LE5A 1IFGA 3V2AR 1OSZA 2GTZA 3IFNL 3MUY1 4UTAH 1VEPA 5D1XC 1DE4A 2CJUL 1NPUA 3QS2A 4NXSA 2QPUA 5I2IB 3UPRA 1QRNB 3JBG7 1YCSA 4OLVH 4UWQB 3TEXA 2BS71 1ZANH 3CZGA 4HPOH 3DPOA 2IEPA 4OW6A 1MQKL 3RFZC 4Z3JA 3BSZA 3GLEA 1AGDA 5JZ7C 1FGNL 1FLTX 3BKCL 2YC1B 1AZRA 3NDZE 1FFNA 4PLJD 4Z3FA 1KCUH 2WIMA 5CIPA 4NAJA 2FUTA 4UINH 5HGDA 5HPMA 1ZGLB 3ELAT 3AABA 5GSVB 5TQ0H 2C9SA 3IVKB 4Y1AD 1ACXA 1GGTA 3O2DL 3O3DB 4D9LH 1LQSR 3VGEA 2IFFL 4P4KB 5TTRA 5IBLC 5F89A 4DKAA 1YYML 2HVKB 4CRPA 3PPEA 4I89A 5HVWA 4KXZI 5KYUA 3HFFA 1F86A 4LLMA 1JE6A 1S6NA 3GSUA 3ZW3A 4F9PC 4HUUB 4BXVA 1NC4D 1DKYA 1MPAL 2YRLA 3LKNB 1CN4A 3QCUL 3T3PB 5JO5A 4HR1A 2EVGA 5I6NA 4OR1A 5FCUH 4ZX4A 4NQTA 4JO2L 2MCPH 1URLA 3QSKB 2ARWA 1IRAY 4PJ7A 5IF0B 4K4KA 5EBWA 1E6JL 1TVBA 4UF7C 3QIWC 4UQ3B 3DOIA 4EXKA 5DQJA 3MV7A 2W9LA 4GAJH 4DAGL 5IKCA 5EZPA 4M6OH 1FC2D 3O81A 3NCBB 2AQRA 3Q2CA 4P0DA 3KWUA 5E00A 5AAPA 3QXDA 4YL9A 2NW3B 3U0TB 3M7FB 2XU9A 4JQIL 1P5VB 5SV3A 1JZ3A 3BSZH 4K7PY 1JGLL 2DIJA 3AJ7A 3B6SA 4IBLT 3PWLA 1OPOA 4Z7NF 3NSFA 1A1MB 3ZN6A 1CWVA 3S4SA 3JV0A 4U3SB 5CIPH 5TE7L 4BKSC 4HLJA 1Q0EA 2FICA 1KCLA 2GJRA 1Y0LA 2GUYA 4YIQB 2E56A 3F5WB 4B5EA 4Y4KD 5D72L 3KWWA 3MLXH 4H5SA 1XL6A 4OGYL 4LRIA 2PP7A 1S7QA 1QQDB 4FXKA 1J8HD 1JYWA 4OU3A 2RQEA 2YUXA 1F1DA 1A7RH 1S8DA 1JPTH 3D0LB 3FFCE 3STLA 1XGUA 2MQGA 3BC9A 4ODTH 2FWLB 5IBTL 4EDXB 4OQ1A 4PREB 5B38A 1RL1A 3A67H 3FCSB 3HUJB 3ILDA 4PJFE 4GRLB 4QHLA 3STBA 4NP4L 2H6PB 5D70L 1ZT1B 4JANB 3X1GA 1JK8B 2OP4L 4PJ5B 3B7TA 3SPJA 2FJHA 1MDTA 3QJFA 5IR1B 3RVVD 2ZSWB 3POHA 4XZUB 3WXWH 3MLSL 4DGYL 5JORB 4WW2F 1GR7A 1EFXA 3LKPA 2MWCA 3CC1A 3IU3A 3SYCA 4I48A 4UIMB 1JF1A 3P73A 4KUCF 4CA4A 1JDAA 3Q06A 2NX5E 2A9ML 3V6ZB 2P42B 3DO4A 1S5HB 3AQZA 4WHDA 1WZKA 1HK6A 3Q2WA 1DQQB 3SY0A 3CCHA 1AI1L 1RSYA 3F58H 3D3VD 4M4RA 3UTSA 1INEH 3GXPA 2WLYA 3VFTA 1JZ6A 2Y2WA 1W0WA 4YOKA 2N7BA 3IT8D 4MD4A 4DP0X 3HZMA 2VXUL 4F7PB 4FABH 2OKMA 4ODUB 4HEMA 5D6DC 2ZOLB 5DD1L 1Q9KA 1LILA 3ULAB 1DQTA 4F33A 1GPOH 3HEIB 3CDYA 2HKFH 3NUKA 1NGQL 2IAAC 2Q8AL 1K3IA 4PJ5D 4FD0A 5CJOL 4QXWA 1QW9A 1XT5A 2AJSL 2CA4A 3KGUA 3DX0A 3D39A 2Y25A 1YMMB 4LOUC 4PP2A 3A6OA 4JO3L 4HUKB 3KAVA 1WCBA 2WM0A 2BC4B 1A7OL 4LSTH 4C4UA 4NBYB 3PV6B 3VXRD 2RR3A 4L8BA 2UUDH 2KPNA 3CHRA 3RGBA 4JN2B 3CN0A 1BV8A 4JFWA 4N8PA 4OD2A 1R33A 3EJQA 4OLWL 5MEPB 2AK1L 4AENB 3TF4A 5C0DB 4QCIB 4TNWF 3DX8A 3CFDA 2Z93A 4JREB 2AEIT 2OL3B 3NCJL 4A2LA 2GHZA 4OD1H 3I2WA 5ANMB 3QR0A 4Y2DD 1W0YT 3FN0H 1WJ3A 3PNRB 1SFDA 3A24A 3DIFB 4N0CC 4AVKA 4WK2B 2NT0A 3AG4B 1I49A 4P4RB 3TC9A 4AM0Q 1IJ9A 1KFAL 4P23C 2A6JB 2H0JA 5ID0A 1ADQA 1UYWL 2WBKA 1FFRA 3MBED 3QO1B 4FI7A 2JIXD 3S2AA 3GNML 4ERSL 3VM5A 1MELA 4I9WD 4HS3A 1F90H 4NYLA 2J20A 2HTKD 2VT0A 4PY7B 3RV1A 3Q13A 3NABL 1YMMD 3VFGL 1ML0A 3G6DH 4P2YA 2X44D 3SQRA 2P5PA 4FTDA 2XKNA 3BZFB 3R7RA 3AT8A 4JN1L 2QSQA 4YWGL 3GLAA 4NQEA 4XN2A 2DEWX 5DD3H 4LHJB 5EV7A 4W4OA 1T0NB 2PYFB 3KYMB 4EVNB 2ICWB 5K9KB 4OZGE 1B4LA 5BS0E 1L9SA 3SE3C 4HHAA 5FGRA 1TIUA 4XZ4A 3S2CA 3MRMA 2IGFH 1IFHL 2QQQA 4Z6AT 1YJDL 4GRWH 4A7TA 3ULSB 5AUMA 2VZ1A 3UTZB 4FFZL 3GC3A 4W9CC 3UCQA 2H47C 3RQ3A 1XCXA 4EI0A 1SDAB 3U0PA 3DETC 3JVFC 5GGQL 1RJZB 4XNQA 4I0PC 1F1GA 1EQWA 3EOAA 5DCCA 3O3EA 5B4MD 5FYKE 3FQ2A 3ZKXC 3BAEH 4AE0A 4KQ3H 3NFNB 1O7DC 2VKXA 2AJVH 2AJUL 3EUDA 4F7EA 1PG7W 2VJXA 2AZAA 4L3AA 5D4QA 2VSKB 1ADQH 1D9KA 3LOWA 3MA7A 2EDMA 2P5WA 1RQ5A 4LLAA 1I4FA 3RIFK 3KPSE 4QXUH 2NY6C 1UM5H 1G1OA 4IIZA 1DFBH 4KKLC 3II3A 1GC1H 3NIFB 3OKDB 4L05A 5LB1A 1IQWH 1L6PA 2Z92B 1ESOA 2R2EA 4GJTB 4MASA 1ZLUK 3CVIL 2YK1L 4M5TA 4N24A 1QLEB 3EGXA 1RI8A 3HZKA 1FPTL 1PKQE 1MY5A 3LKSA 2WINM 1MCCA 3Q44A 1FDLL 5F0PB 4HWNA 3GZQA 4D0CA 1X7QB 2W8CA 1IBHA 1GYWA 4IHBA 4W81A 3W57A 4AG4H 2YL5A 3VFNA 1ONQB 2UWEB 4M3JA 5ADPL 3QDJA 2I5YL 4MJ4A 2EABA 4MKTA 2DLHA 2CHNA 2GUOB 4RWYH 3SGDH 3FRPG 4R5TA 1DDHA 5DJ2A 4Y4HD 4TLUA 4E5XB 2YMXH 1FFOA 3CZJA 4HUWA 1EXUA 4NXKA 1YECH 2QTEA 4DHLA 1AY1H 2MIZA 3H42L 3IPBA 1GZPB 3GBMH 2SODB 2WLHA 3LNIA 4KU1A 4QRPB 3QE5A 2P24B 1KPRB 3DX7A 3MOAH 2KQMA 1NIBA 3AUWB 2VZTA 1A7QH 3VW3H 4HZ1A 1P1VA 2CIIA 4HFWA 2BRQA 3L2LA 2WLZA 4V2BA 4PJCE 2R29L 3OZ9L 1X5FA 1ET8A 2X4QB 4KH2A 3RWDB 4EZMA 2X5PA 3APCA 5DMJB 4Y2LA 4XP9L 3SBWC 3CDGA 4OD3L 3V9FA 4KJWD 3QJOA 1RZFL 1WFTA 2YXVA 5I1LB 3P4NB 1ETZB 1CFVL 2B9BA 3NT0A 1PF3A 3N41B 1CFNB 1MJUL 1F4YL 5IVNA 2BNRA 5I8EB 1S2EA 5JW3H 4O9HH 2QZQA 3KG5A 1D2OA 4MMZA 2WTRA 1NMBL 4YBLB 4Y0GA 4AQ1B 1I7UA 1XH2A 5F7DA 3WJMB 1UVQB 3AT0A 1OY3B 4UU9A 3OKKB 2YD0A 4HEPA 5KG9B 5JHDA 1Q1JL 5IQ7H 4AZIA 4QEGA 5HDBF 4TSCL 1OM3L 4L3ED 4AQZA 5B21A 4CMMB 4ETYA 3L16A 1SHXA 4NN7B 3RKDD 4QLRA 2EYSA 3WHXB 3L95A 1W9MA 3N1GC 3G6AB 5CD5C 2HFGH 2OSYA 4BUHA 1HYRC 2DQHL 4G1EB 4N2EA 3SDAA 2WBJC 5B39B 3ESMA 1S9YB 3QIBC 4PLNC 4LAQL 2B3RA 1MRCH 4ZNEA 1JFHA 2IGTA 2DBJA 4HZLA 2YQGA 5C08B 1R46A 2XQYK 1PZ5A 2ZCKH 4KVNL 4KMLB 4QHUA 2EIZB 1E5AA 5C0AD 1GGCL 4H8WL 2WOBA 1JS4A 1MKFA 1XXDC 3Q43A 2IAMB 4JZJB 2NR6C 4PVLA 2AJ3A 4WI9A 1CD9B 1T4KA 1XCTB 3II2A 2OMXA 2WZPD 2EWFA 5SWQB 1T80A 3OKEB 3BKJL 4IU3A 4E9XA 1LQ7A 1MH5B 2GAZB 1ZTXE 4UI2A 2XWZA 4FL4C 1G5GA 3TIEA 4FQXC 1QVOB 2VL5A 3SDXE 2JCCA 2R27A 3G5YB 4M7LL 4ZAKB 3RDJA 3EH5B 4HD9A 3OK8A 3PWVA 1EERB 3F6JA 4L9LB 5CD3B 2BFGA 4Z76A 1E4WH 4ADIA 4GO6B 5F6IB 1E6OL 2VDLL 2H32B 2MQ0A 5AW2B 5B3SB 5MENB 1P5UB 1J5OL 2IH9A 4JO4H 4G2AA 1KGYE 1A6AA 4OCXL 1WFMA 3NEEA 4LDOB 3RJQB 2PW1A 4NQCD 5FECB 4EN3B 3BZ4A 3EGSA 3I6KA 5DS2A 1AD0A 1FL6A 4NNYA 1JWUB 3IFOB 4XMKL 1PJWA 5BCAA 5F7HA 4N2GA 2DICA 3SBQA 1YUKB 2X4OA 3ROOA 3H7BA 2GA9D 3PHOA 1GYVA 3TFKD 3LKQB 3LZPA 4ZK8A 3FH7A 5HYJD 2P47B 2OMYA 3APNA 5FUOH 2X3CA 2BFVL 2CK2A 4MAYC 5DRNB 1JI2A 2VLRB 3E3QE 4TKWA 3BXNB 5FYJU 2IBZX 3VMNA 3CFCH 5F1KC 1XF2B 3VD5A 4N8UA 4C57C 1HOEA 4JL2A 3L1FA 2APBA 3K5RA 3MFFA 5EU3A 4ZAKD 5LBGA 1QWNA 4XXWC 5ACMA 5DZLA 1DLHB 4HIEA 1R5VB 1NC4A 3BPLB 4ZTOL 4Z7WA 1YO4A 1DUZB 3AWEA 1T0MA 5DZJA 3ABGA 1OAQL 1WIUA 3JT0A 2VH5H 1E7VA 3V6FB 1SF3A 4OJCA 1KBGL 3CXHK 3T0EC 4HOMA 2J1YA 1Q94B 3MZGB 5KSBF 3WNLA 4FNLH 4Q2ZA 3QXAB 2VDPH 4E9LA 4BXSV 4QXTA 1K72A 5CGMA 5AB9A 3VD1A 3NGBB 1Z9SB 2X53A 4ODXB 2Y36H 3AXLA 2A0LD 4WJKB 3LKRA 1SEBA 2DD8H 4S10A 3RUGE 4F91B 4MA8L 5GZNA 2BY1A 3P4OA 1A1OB 4O2FB 1MEXL 3GI7A 2VLRD 2PXYD 5DS8A 2G4EA 3PFUA 5LCVH 2W59A 5KVFH 1TO5A 2ORBL 3SYAA 4P2RB 4Y4KA 3MA9H 1UWGL 2V0OA 3GMPA 2LTQC 4GLRI 4CKVX 2G60H 1H8LA 2R1YA 2A74C 4PJBE 1J8HA 1XVSA 5ALCH 4FCHA 1HAWA 2WLIB 3QQDA 2AAVA 1IKFH 3WS3A 4KQ4H 5DRWB 1BMGA 1T6BX 5DJCA 3D2UB 3SGEH 5CCKH 4L1BA 1ZHKB 2E3VA 5CR8A 2PUQT 3T09A 5DJDB 4F7MB 3EOTL 2AEQL 2A2QT 4JFTA 3QI9B 1M05B 2HUHA 1JD7A 2O6CA 4ANXA 1EZLA 4RGMB 4KI5C 2ZKWA 2YS4A 2C9AA 5LO7A 1HSAA 1OE2A 3HPLB 4JRYE 4KX9A 3LQMA 4U1MA 2D7TH 3L2NA 4FEMA 4LIQL 1P4BL 3VI3B 1MJ8L 1MAJA 5TH2B 1ZV2A 3T9WA 3FT1A 4AVHA 2BRRH 1T20A 4PAZA 4K23L 2R0WL 1DLFL 1E4KC 1F2XK 1IKNC 4B3EA 1NAKH 3TPUB 1N64H 4P2RD 4YHOH 5DK2A 4JG0L 4CC4A 4P59L 1ZK5A 4YSUA 1CGWA 1OZUA 1GCFA 3WDIA 4K2UL 3V52L 1BWWA 3HKZA 1F4XL 5T3ZE 1HQ4A 1L3WA 4QI3A 4MA1B 4ZFFB 1HSBB 1QQDA 4BJLA 3PAVA 5H37G 3D3VA 5IP4A 4DP4X 1JN6B 2JKTM 3MROA 4DERA 5L9DL 3V5HB 5IVXF 1HWWA 1Q0XH 4DPBX 3VEAA 3KPRE 5GS2D 4MMYB 5EUKB 1WS8A 2F58L 3K46A 4PBVC 3VFVB 5BRZE 2YGVA 1MRDL 1P9MC 2GCYA 3V0IA 7FABL 1U8KA 3D9AL 3KL5A 5B1KA 4XH2B 5JQIB 2EEFA 4GG6A 3L5XL 4RNRA 4JL9A 2EO9A 3BUPA 2F54D 2Y07L 2QVTA 1ZLDA 3ZTJH 2YI9A 4BSWA 1I1CA 1IAIH 4H8PA 5DSCA 3ZE2F 4CVXA 5DZAA 4DPCX 3ZL2A 1XIWC 2R2HB 4HXAL 3UJTH 4HIXH 4HKBB 4XN9A 2GSIB 2H8PB 5TFSH 3ILEA 4X6BA 3TN0C 4PB0H 4B9QA 3VXRA 2E76C 1VFAB 1GGUA 2DTSA 3BT2L 4H40A 1RZ8B 4JX0A 1AKJB 4Z95L 2PR9A 4NLHA 4NENA 1NTDA 1VAHA 4PWFA 2ZX6A 4J2XA 3D4YA 3HHRB 4K9EC 3R4DA 5E8OA 4IU2A 1EJ8A 4HFUH 1E0OB 2HN7B 4Y2DA 1CXKA 2YXMA 1FVEA 3MN8A 1CE6A 3NSYA 1QSVA 1ZT7B 3DSNA 3L7EA 3U7AA 3S4SG 4X9IA 1THCA 2AGJH 1QPXA 4NNXA 1FIEA 1K2DB 2EZ0D 2WXOA 3MBEA 1VACB 4QTFA 3KM1A 4Q9QL 2P8PB 2JIXA 5FXCH 1QRNE 1CIDA 3ZTDC 5FX3A 2Q5BA 3F7KA 4U0RB 4TUOA 4TTDD 4RZCA 1YMMA 3UZQB 5EUOE 4N68A 1AYOA 1N3NB 4XR8C 1HAUA 1OCWL 2Y5EA 3I6SA 4IHOA 5J1TC 1F8TH 3ABLB 1ZOXA 1RZKL 2H1LM 3H9HB 4KTDL 3ASWA 1J9SA 1G9NC 3ZVVA 2HT3D 4GW5A 4JHBA 2HCZX 1BSIA 3KCWA 4FQLL 4M56A 4Q9CA 4JDEB 2B0SH 5HVHB 4JUTA 4F20A 4JNXA 5EOQL 1KUMA 2OL3A 3WEXB 3IGKA 1KXTA 4DFHA 2VITB 1KYUA 5JIQA 2WAQA 3J8F7 2RHEA 4W9DC 4AW4A 5F7LB 3SKOB 3S5LA 4W9JC 4AT6A 5L2KD 4WZ9A 1OAZL 4NKMA 5F70A 3RNQB 3MUJA 1DHKA 5ETUB 3T3PE 4YZFE 4GG8B 4WHTA 1MRFL 3ILQD 3K71B 4WEMB 3S8WA 3CVHL 1HKFA 2X10A 3OG4B 2YL6A 4IKLA 1EUTA 4YSEA 2YJLA 4ZX3A 4TN9A 5TDOB 2HKAA 5HHPB 4I4WA 4ENZA 1HXYB 2Z34A 2M2DA 3V0JA 3RNKA 3ILPB 1I4LA 3O2WH 1SRDA 2LHAA 2WAHA 4YDIH 1FZOB 5MEOA 2DLTA 2J88L 4MB3A 5AVVB 3O3BA 2FO4A 3U7YH 3LVEA 1K4DB 2EDOA 5HI5D 4NN5B 2WQRA 4WV1C 3UGEA 5JW5A 1EA9C 3L3OM 2NOYA 5FHBL 1BWMA 3BP7A 4N2BA 2DQGH 4U1HA 4MDIA 5IJDC 2FBJL 1KN4L 1W8NA 2CBOA 2ZWSA 4MD0B 5KVDE 3L48A 4DCNC 2VLMD 4G8FB 2WLLB 3QAZB 1KY7A 4Z18A 1T2QL 3QW9A 1DQJB 4D0DA 2OL3H 3GTTA 4LCCA 3Q8CA 1IC4H 1VB9A 4JPSA 4OJDH 4S1SL 1TJMA 1WAAA 5DURD 4KVCL 1L9TA 1QHPA 4LCYA 2EH7H 3HE7B 3NFNA 3SQOH 4MX7A 1KTJA 3WJJC 2HFTA 3O11B 4JFQA 4NZUL 5KOMC 4IGBC 1HH6A 2A73B 1OW0A 1BEYL 2CKBA 4W9FC 4Y4HA 3WLBB 4LF3B 3HUJE 1QFUL 4K94C 4GSQA 2RIKA 4HBCL 4O2CA 4Y5VB 4GMTH 4JAMA 1RHHB 5EC1A 3R8QA 2GJZA 1UQSA 2VDRH 5DHDA 3T47A 1I7TA 1SBSL 2ZYIA 5LN4A 1MIML 4AZBA 2W07B 5E8EB 1HWGB 4R4FL 2Z0VA 1BVLB 3VWJC 3AGWA 5H2BB 4I18B 3S7GA 4JQVC 2P5ED 4N2IA 2IOOA 2PW2A 3GTNA 5J3HD 3BX7C 5HTSA 1A9EB 1XMEB 2R69L 1I8UA 5E5RB 2WO2B 5B7EA 4WW2B 5KSVB 5HGHB 3F7YB 3QNXA 2IV8A 3B2DC 5IJKC 1UXMA 1V54B 1E3ZA 3RURA 4GMSH 4X8CA 5C86A 3NIGF 1FN4A 1QHQA 4JGUA 1SJXA 3GM8A 2DWDB 5I1HL 5JW4R 4ZTEA 2NXYB 3OKNA 4A37A 3IK2A 3DUSB 4FLSA 3QJHA 2EEXA 1KPRA 4HCIA 4U05A 3F62A 2FJGB 4OZ4B 2NTFB 1GGIH 2BLFA 2BP8B 1IAKA 4RRPA 5G2NA 3RL1A 4BFKA 25C8L 4KI5F 4L3EA 4P5KB 2CKBH 2P26A 2WVTA 2PWFA 5F44A 1BFVL 1W16A 2C3VA 4M5SA 3Q2LA 5C09B 2G75A 2Z0UA 4YH6A 1I85A 4GUPB 1NBQA 1UCBH 4YUEL 2CD0A 5EB9A 3QZWA 1WZ1H 2J4WH 2J25A 2X40A 4ZMYA 1DN2A 4YHYB 3A98A 4HALA 4KRPD 1N2RB 4F9LA 4L5FE 1QPPA 2DJ4A 3EG9B 4HH9A 4XX1G 4ZUTB 2QKWA 4AMKH 1BXAA 5ANME 5FK9B 4MJID 2FLBT 5GHWL 1AG0A 2H3KA 3HMXL 3I9IA 5CINH 1NGYB 2EQDA 5CJBA 1OXYA 5D7LB 5C0AA 2WMPB 1R3HA 1QZ1A 2C9RA 4XVOA 4UMGA 3OC8A 4YHIA 3X14A 1KG0A 1JGEA 5GGRA 1AQMA 4WSJA 5L7XH 3ZYIA 4X80L 4PJHF 4FHJA 3KS0J 2WZPA 4EDWL 3FUMA 3LZQA 3HS0C 1BP3B 2WQWA 1QKZH 4NSKB 2ZSVB 5C0NC 3MGOB 1RUMH 1JV5A 1WUNT 4P2OC 2ZOTA 4XP4L 1FZJA 1IIIA 2FATL 5D5MF 3MRIA 3ZKND 4G1EA 3OPZL 4W4NA 2I60H 3NESA 5EIIB 2XVLA 2APFA 3UG4A 5B39A 3CD4A 4LPTA 3WS6A 3EBAA 1F2QA 2IPTL 3SYQA 4W70A 3H7LA 3RWHB 4NQCA 4ZSOB 1PDKA 1TU2B 1FNAA 3BE1H 3LJ3A 2OLDA 2XWCA 1HKLL 4OV6F 3P3UA 1AGEA 3IDYB 3PDGA 4C58B 1KJ2B 2V4LA 2WWOA 1IGJB 2MFNA 2PTTA 5FHAH 4XGZA 3ZL1A 3RDTA 4NZTH 1BPLB 5F7EH 4OI7A 5E94B 5HHVL 5HYJA 1XCTA 4UNVA 2EDDA 4JW3A 4N0FA 3PAYA 3QQ4B 4QRRD 3QJVB 4OSUL 4D9RE 4LLWB 1UWEL 3D0VA 5IEHB 2VERA 1EGJL 2UV3A 1SFHA 3QAQA 4OAWA 4R3SA 4KJPC 4GI6A 1IC5L 3HBQA 3PAUA 5D1XB 3SKMA 1Y18B 4TSAH 1EBAA 5E6IA 5IW1A 5FM4A 3PU7A 3JV4B 3CC5B 1YEDB 2X41A 4HGWB 3WLWC 3DA0A 3RFZB 4J2QA 4QTIH 3CG8A 2ESVB 1EEZB 3JWNC 1M1SA 4JPKH 1IJNA 1YEHH 2X4NA 4HEPG 2VXQA 3WKPA 3ZSSA 2WTOA 4RBPH 4J23A 1A3LL 3IJ7A 2F7QA 4NPJA 2WZ0A 2XWXA 4MTMA 2RAKA 4XNXH 5I1EL 8CGTA 5JW4N 3LKQA 3MXVH 4LKCA 4WKZB 2BMKB 4EBQL 1CDCA 3L4ZA 2UWEE 4TYUA 4N25A 1XR8B 2PXYA 3SGKA 1DEDA 3ZTNH 5JIMA 5FLUA 5C70A 1C8QA 5A6IA 4PS4H 3GSXB 1YEIL 4OJYA 3VH8G 4FTVB 2HZHA 4JFFD 3IF1B 5TJWK 4F7KA 1YQVL 4F24A 4BH7B 2ND0A 1D7FA 3QG7L 4QRPE 3OM3B 3J2PA 4BNEA 2FRGP 4QKTA 4M7LT 3P9WB 2BIQA 3I9GL 3G9AB 3CN3A 3KPTA 3QIWB 1FV1A 4JKPL 1E2WA 3QHFL 3SBPA 2C26A 4G83A 4NOBA 1MVUB 1BVKA 4JCWA 4QIRA 4FN0A 3BVNA 3UXFA 3QXAA 2JB6A 3SPIA 5ISZD 2EEAA 1KNOA 1ZV9A 2VZ3A 5I0WA 1WF5A 2CO6A 3SDCC 2EX3B 2WLMA 1A6WL 2TRHA 3CMOH 3I9PA 1UACL 5EBMB 5EEYA 1G7JB 4NC2B 3MYZA 1AAJA 4GBXA 1LNUB 1WHPA 4OZFB 43CAA 3ZY7A 3HS9A 1KENH 4LHUG 2QZ5A 5HY9A 3BAYA 4A7GF 1BLNA 4PSPA 1MCPL 1W72A 4JPIB 5FYJL 3TJPA 4Z78A 2GF4A 5D4IA 2KS0A 1Y6NR 4ISVA 3GSWB 5AB2A 1G94A 2Z35B 3HE6C 4DQOL 3AVEA 3WL9B 4Z3GA 4L4TB 1MREH 1CFTA 4D3CH 3RILA 4L8SA 3OXRB 5I1JH 3WTYA 5J6SA 3TEYA 3MRKB 2CDEA 4CDHA 2KH2B 4DOHB 1N18A 5FF6A 4BK8A 4MAUH 3LZFL 3OG6B 3QIWD 1BD2B 4HF5L 2Q3XA 2WLIA 2YLHA 3K81A 4J12A 4U6XA 4WFGD 5DVOA 3IFLL 5F9JA 1S7RA 2VDOH 2BSED 1RK0B 3VTMA 4HKJA 3CXDL 2CPCA 2Y7SA 2TSBA 3CZUB 5HDBB 3KLSA 3K8KA 1QYGL 2F54A 2YAPA 3V55A 2MEJB 3JV5A 3LH8A 4AVIA 3DO7B 1NCTA 1KEGH 2OMWA 3K5SA 2AF2A 4FGMA 4LESA 4RQQB 2F8IA 1RZJL 2RAJA 4HKZA 4RMTA 2IC2A 3TNNB 1L7IH 4JVPA 5SWZB 5C08E 2D7MA 1J10A 3PJNA 3GXIA 5GS1C 2YL9A 2NY4D 5AAWC 3IDNB 3BEWB