1O7DC

The structure of the bovine lysosomal a-mannosidase suggests a novel mechanism for low ph activation
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
GDSAPLNEAMAVLQHHDAVSGTSRQHVANDYARQLSEGWRPCEVLMSNALAHLSGLKEDFAFCRKLNISICPLTQTAERFQVIVYNPLGRKVDWMVRLPVSKHVYLVKDPGGKIVPSDVVTIPSSDSQELLFSALVPAVGFSIYSVSQMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysosomal alpha-mannosidase
publication title The Structure of Bovine Lysosomal Alpha-Mannosidase Suggests a Novel Mechanism for Low-Ph Activation
pubmed doi rcsb
molecule tags Hydrolase
total genus 38
structure length 150
sequence length 150
ec nomenclature ec 3.2.1.24: Alpha-mannosidase.
pdb deposition date 2002-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.50 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Glycoside hydrolase family 38, central domain 1o7dC01
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1o7dC02
4UNIA 4WSKA 4PCTA 5F7UA 4AIEA 3UG5A 3ZT7A 4UQCA 4DO4A 5I24A 4PSRA 5BRQA 4OGZA 1WPCA 7TAAA 1BVNP 3ZR6A 4UOQA 2XIBA 3K1DA 3WDJA 1GJUA 5E1QA 1HX0A 1UD4A 3L2MA 3VMPA 4H8VA 3LRLA 2D2OA 3KL5A 1BAGA 5DO8A 2GJPA 3L4XA 1JDAA 3BUQA 3WNNA 1KWKA 4U2YA 3ZQ9A 1GCYA 1JI2A 5I23A 3WELA 4OIFA 4B9ZA 2XWEA 1QHPA 2ZX9A 3WEOA 5E6ZA 2XN2A 1DHKA 3DX2A 4JFSA 1WE5A 1SZNA 5CXPA 2F61A 1UD6A 3WENA 3ZT6A 1G9HA 3VSVA 2WYHA 3HG5A 1CPUA 4U33A 1WZLA 2E8ZA 3WEMA 1P6WA 4FNTA 5CGMA 4UOZA 4BA0A 1O7DB 1Q4NX 5A2AA 3CZLA 1JIBA 4XB3A 3UCQA 2E9BA 4GI6A 3TTYA 2E0PA 1E3ZA 2OSWA 3FAWA 3UEQA 4UCFA 3AXIA 3BAXA 4JFTA 1CXIA 2WPGA 1NM9A 1CGXA 1KTBA 3A24A 1KBKA 4NXSA 5E9AA 3GBEA 1MXGA 4CN4A 1R33A 3WNLA 1UH3A 2QPUA 2X2JA 3CC1A 1CGWA 3II1A 1HL9A 1G5AA 4J28A 1KXTA 3HG4A 2CHNA 1CGUA 4OJYA 4NZJA 3A23A 3BUIA 3D52A 2D3NA 2DH2A 1UASA 1U33A 1VFOA 5A6MA 2X2HA 4UQAA 4GO8A 1XCXA 1XSIA 3WMSA 1CDGA 3OLEA 2ZX8A 1AQMA 1S46A 3LXCA 4PEEA 3VX1A 3EJPA 4J3UA 2F7RA 3BLBA 3OLDA 3W37A 2OSXA 3TONA 1PPIA 4U3CA 1UD3A 1J0KA 2Z1KA 1QI4A 2F7QA 1TQVA 2WSPA 2OW7A 3ZSSA 1VFMA 3S5YA 4ATWA 1TMQA 2ZUWA 3L4ZA 3A6OA 3CLWA 8CGTA 1Z32X 2XWDA 2ZUSA 5HPOA 1LWJA 3EDDA 3GTNA 1M7XA 4B9YA 5I5RA 1JFHA 3UERA 3D4YA 1Y7VA 3VGBA 4GI8A 3BCDA 4GO9A 1XV8A 3DHUA 3GXDA 1TQTA 3RIKA 2AMGA 2QPSA 3H54A 2XVLA 2F1AA 1JF6A 4AMXA 2ZX5A 3GXFA 1JGIA 3UG3A 1QWNA 2VT0A 4FLQA 4FNPA 2WVVB 2XN1A 3BAKA 1CYGA 2BY0A 2FE0A 4FNUA 2F7OA 3BMWA 1KBBA 2ALWA 2VRQA 3CTTA 1J0JA 1UD8A 2D0FA 2EAEA 4TVUA 1J0IA 3WFZA 1BF2A 1CXLA 2V3EA 2OYKA 2GUYA 1O7DC 4JL1A 2PWEA 2XN0A 1UD2A 3LPOA 5CLWA 2NSXA 1JAEA 3VMOA 2FHCA 2ZXQA 2V3DA 4JFWA 5A6LA 3FW6A 2ZICA 5E70A 1WZAA 1G94A 2QMKA 3AJ7A 3CZEA 1TQSA 3DX4A 2AAAA 1MW0A 2WKLA 4AEEA 2VRKA 4LXFA 3IJ9A 1IZKA 2F7PA 3K8LA 4UZUA 4AEFA 1BG9A 1CGYA 1RP9A 2WYIA 1CIUA 1CXEA 2WKGA 4AYSA 4FMVA 1CXHA 1EA9C 1W9XA 1XH1A 2BY1A 3L4YA 3OLIA 4FNQA 1R47A 2Y2WA 2F1BA 2VUYA 1VJSA 4GI9A 3HG3A 1XCWA 3IJ7A 1PZ3A 9CGTA 2PWGA 2PWDA 3BAWA 4HPHA 1RPKA 3DX0A 5A2CA 2ZUUA 3ZO9A 4FLSA 4GQRA 4PSPA 2ZWZA 1IZJA 3BVWA 4LPCA 3VGDA 1KCLA 5EMYA 3ZOAA 2XIIA 4MB1A 1QI3A 4CGTA 1UA7A 4PCSA 3LVTA 3BSGA 2GJRA 1EHAA 4M8UA 4NZFA 3IK2A 3QGVA 3CZKA 2BHUA 1M53A 3CZSA 2EQDA 1JD9A 2D73A 1DEDA 2YJQA 3BVTA 1OGSA 2OSYA 1H3GA 2YFOA 1XH0A 3L4TA 1QW8A 1ODUA 1QW9A 2BHZA 2WVUA 2PWFA 1PJ9A 1WP6A 4J3WA 3WY4A 5CLTA 1WZMA 3VM5A 3RILA 4WSJA 1OB0A 4M56A 2WSKA 2ZUVA 2G3MA 7CGTA 1T0OA 4HA1A 2ZE0A 2WNWA 1WZKA 4J3TA 1PS3A 3KWXA 1D3CA 3TOPA 2FHBA 4FLOA 1XSJA 1HVXA 1QX1A 3KLKA 1ZS2A 2ZX7A 4H7VA 1PIFA 2QV4A 1I75A 3EDJA 2WVTA 2J25A 1MFUA 1R46A 3CV5A 4JFVA 3BVXA 3WY2A 5I0DA 1RP8A 2D0GA 1DTUA 2Y5EA 4DO5A 1GJWA 4WF7A 1V3KA 1BSIA 4GQQA 1TQUA 2F18A 2BXZA 1XGZA 2QMJA 1CGTA 3D51A 4FNSA 1CXFA 1CGVA 1VFUA 4H8UA 2C7FA 5KEZA 1IV8A 3L2LA 1JXJA 1OSEA 3HG2A 2ZUTA 4FLRA 2ZXDA 1JF5A 1TQWA 3BLKA 3KEHA 3DX3A 1MW1A 1XSKA 2C8NA 2E8YA 2YOCA 2EJ1A 5E6YA 1JG9A 3CZGA 3LXBA 1C8QA 2PWHA 1U2YA 2TAAA 1E43A 1JI1A 4JL2A 3VO0A 3WNMA 3HJEA 4LQ1A 1EO5A 2YA2A 2DIJA 2FH6A 3A22A 3AMKA 3VGHA 3H53A 2BHYA 1MFVA 3A47A 2NT0A 1KGUA 2OW6A 1R75A 1QI5A 3EJRA 4CN6A 4X9YA 3VGEA 1MXDA 2EEXA 1XH2A 2BXYA 4WLCA 3KL3A 4KWUA 1JDCA 1HT6A 3L4WA 4H8HA 4UZSA 1PZ2A 3ZT5A 4UQ9A 3DDFA 3OLGA 4GINA 3KL0A 2XVKA 4CN1A 1B2YA 1XD1A 4UQBA 3A21A 2IGTA 2EABA 4HOXA 2WANA 1UKTA 3EJUA 2FHFA 4GIAA 1QPKA 1PEZA 1XD0A 4JFUA 4J3XA 4J7RA 3IGUA 4NI3A 1BLIA 1MW3A 4HOWA 2VNCA 2GVYA 3AXHA 5A2BA 1UOKA 3KE0A 2NT1A 3S2CA 1TCMA 1LWHA 3TV8A 3UG4A 1AQHA 3GXPA 2OYMA 6TAAA 1JDDA 2FYVA 1KWGA 2ZWYA 4NXKA 1KB3A 1UA3A 3EJTA 2G3NA 3GXTA 3LRMA 2FH8A 4GKLA 4UQEA 3A4AA 4DO6A 5HDRA 3BCFA 4U31A 1J0HA 3MI6A 1KCKA 2QLYA 3EJQA 1HXKA 3VU2A 2OYLA 1JXKA 3EDKA 1UKQA 2VR5A 3VMNA 1KXQA 2WCSA 4MAZA 2BY3A 3D50A 2E4TA 1MVYA 1MW2A 1KTCA 2ZX6A 1ZJBA 5HXMA 2YA0A 1HWWA 1QHOA 2WVVA 3WNOA 1UH2A 1PIGA 3LPPA 3AMLA 1HL8A 3BC9A 3WDIA 1E3XA 1AVAA 3BAJA 4AW7A 1AMYA 2DH3A 4JCMA 4JCLA 3BH4A 1VIWA 2BY2A 3LX9A 4J27A 3EJSA 3K8MA 3KLLA 3W38A 1UD5A 3ECQA 2F2HA 2FGZA 4FNRA 3S5ZA 3BLPX 1B0IA 1NOFA 3DHPA 1OT1A 3CZNA 4BZYA 2D0HA 2EACA 3VSTA 1UH4A 1WO2A 4HP5A 1V3LA 3K8KA 3WNKA 2EADA 1E40A 3ZSTA 3H55A 3WY3A 1V3MA 2X2IA 2DIEA 4AMWA 4AIOA 3GXNA 3D4ZA 3EDFA 2YIHA 1HNYA 1L0PA 3VSUA 2ZXBA 3L4UA 3TTSA 2EO7A 3WNPA 4U2ZA 2WC7A 1EO7A 3BVVA 1KGWA 2ZXAA 1CLVA 2WVSA 1JL8A 3DDGA 1BPLB 1BVZA 5KBPA 4UQDA 4E2OA 4CVWA 2YKKA 3GXMA 2CXGA 4J3SA 3BAIA 1OT2A 4OKDA 1KXHA 3VX0A 1V3JA 3BUDA 3DC0A 3BUPA 2D3LA 3HZ3A 1MWOA 1PAMA 1HTYA 3GBDA 1U30A 3WY1A 3FAXA 6CGTA 4NX0A 3VNYA 5CGTA 2V3FA 3M07A 1ZJAA 4X0NA 3BMVA 4KMQA 1R34A 3BVUA 3LRKA 1A47A 3WDHA 3GXIA 3VGFA 1VB9A 3VNZA 3BUBA 2Y24A 1JD7A 2WCGA 2YFNA 2Y4SA 2YA1A 4AYGA 1VAHA 5E0FA 1GVIA 1EH9A 3CGTA 1UKSA 4H2CA 5DFAA 5BRPA 3L4VA 3BSHA 3EDEA 3VGGA 2XVGA 3WN6A 1D7FA 1G1YA 1KGXA 3VM7A 4QAWA 3IJ8A 4HOZA 5TD4A 4J3VA 4CKQA 1QWUA 3DX1A 1SMDA 3LXAA 3A5VA 4W93A 2CPUA 3ZR5A 1CXKA 1SMAA 2ZIDA 3BAYA 3CPUA 1KXVA
chains in the Genus database with same CATH superfamily
2QQKL 2AV1A 2HFGL 4AIEA 1T5XB 1MHPL 2YUXA 3IGKA 1BZ7A 1IILE 1TJGL 4H4NA 5E8OA 1BVNP 3L6FB 3H8NA 3DOHA 3KPNA 1RMFH 5E08H 4K71B 4KUCF 4AIXA 2ATPA 4O2EB 4OUUA 3ZMEA 4P4KB 4H8WC 4AZUA 1G6RH 1OPOA 5IQ9B 3X11A 4NN6B 3CSGA 1XR8A 1UJ3A 1QEWA 2QADB 5F9WC 3V0JA 3NDZE 5A2JH 5F7EL 1RUMH 3MV8E 2VWEC 3P02A 8FABA 1LO3H 4L0PB 5GISL 4ZMVA 2YK1H 5DWUL 1AGCA 1DHKA 4Z3GA 2VLRB 2X28A 3DO7A 5IKCA 3F7KA 4FEMA 2F53D 3RWDB 3ZL4L 1MRFL 5KSBE 3D30A 4HXAH 3WFDH 2XZAH 4A55A 4F57H 1NFIB 4ZXBD 4EN3D 2DMKA 2HJFB 3WENA 1SBSH 4KDTC 4JY6A 1NEPA 1MJ8H 4DKAA 1HYSD 1WZLA 1ZTXL 1QFWM 3D08A 1GGCL 3MDJA 3C6SA 5D2NE 3SJVD 3QFJB 1EAPB 1PAZA 2OI9B 2DYPB 1RK0B 1FP5A 3QR0A 1DLFL 4UTAA 4Y4FD 3C75A 1NDGA 2ERJB 4WFGD 1KIQB 2WPGA 1X5AA 4P46B 4MS8C 4UT6A 1ZIAA 1KBKA 4XGZB 3WIAA 3AQDA 3NIGF 4ALAC 3BGMA 1GZHA 1BVKB 2WBWB 2I69A 4ZUTB 3KPMB 1AD9B 5DS8A 5IBTH 1NIFA 5KAQG 3UPRA 3U48A 4I1RA 3KYNA 4PW9A 4OJDH 1U33A 2AJ3B 3TVMB 4PJDE 5IMKB 3T4YB 2QQNH 2X2HA 4M7LL 1WUNT 4DZBA 1JWMB 1Y18B 5HHOD 3WMSA 4XT1C 3HR5B 3UCRA 4R5XA 1TQBB 2EECA 4PY8J 1S46A 5B39G 3ZLQC 2Y7QB 1A7OH 4PEEA 4E41A 1ZK5A 4KH2A 5CIPA 3UACA 5IB1A 5TK2A 4S11A 3VG0H 3WJLA 4K73A 5INDB 2ID5A 3O81A 1C5DB 1T22A 1OAUH 2X6MA 1WEJH 1NGYA 8CGTA 2Z35A 5DZJA 5HPOA 4D9QE 2R39A 5JNYB 4UDYX 5DT1H 2NY1B 4V2BA 4GI8A 4ORGB 3QWNA 3MV7E 4ZUUB 5ICZB 1GHFL 4CRPA 1L9RA 4KMTL 5BUPA 1N67A 5DRZB 1A8ZA 2R0ZL 4BKLB 3IVKB 2EDFA 1P5UB 1MF2L 3O3DA 4LLYB 3V5DB 3I3DA 5C6TL 1JF6A 4TQEH 1FF5A 4FZ8L 1WGOA 4HZ1A 4X5WB 3RWCA 2ODIA 2AK4D 2OBGA 3ARED 1MJGA 1F3JA 1SUFA 4FNPA 3RFRA 3UH8A 4NQVB 2XWBA 4XC3H 2F7OA 1A8JH 1LYQA 5ITFB 1E4JA 3BMWA 5D7LD 3SB3A 1P2CB 4A6YH 1AFVL 3FOLB 3P9MA 4OZGA 4WFHD 3DUSA 3ME0B 4OB5L 4U7KA 4K3HA 2WP3O 3H2QA 4M1CD 4B7IA 2AS5M 1WFJA 4JL1A 4S0TD 2J56A 4OM0H 2AV7A 2DDQH 2YOAA 1S9VA 2OJZL 2VDRL 2HKFL 3OTTA 4FI8A 3S7GA 4R5TA 3W39B 4EZPA 1GOGA 1RURL 5ISZB 1TQSA 5DQDH 4GXVH 3NPSB 4YSUA 5CMAA 3F12A 3TBVA 43CAA 1DANT 2VMDA 4BUGA 1JK8B 3DLQR 3FUKA 4AYSA 4NNYB 1I8MB 1EA9C 3UTPD 1F3DJ 4GFXA 1JZ7A 5BOPA 5EUOE 1J11A 1X5YA 3FL7A 4UQ2A 1YMMB 2DW5A 5BZWA 4K3EH 5IESL 2DL9A 1Q8MA 4EUPH 2FGWH 1G4MA 1UM4H 3OD3A 1IBGH 4DESA 3H6JA 1JHKH 5C9KA 4ES9A 3J7HA 1SN2A 2VGLM 1WF5A 3ZO9A 3T4AC 3VWKD 4HCFA 1MFNA 1TDQA 1NAMH 1U3JA 2GJJA 3DIFB 5TDNB 4YNYA 4R96B 3K4ZA 1ZWWA 4Q0XL 1TEGA 3QJHB 4IBUA 4ZQKB 5D70H 1RFDH 1OARL 3LN9A 4WPCA 1ICTA 1EHAA 3CPLB 4JE4B 1X5IA 4AGOA 3Q05A 1RY7B 5AZ2L 5J4MA 2GF4A 4GBXB 4J3BA 4U1SA 5IK3A 2C3HA 4HWZB 5EPMA 2EDBA 4FP8L 1ML0A 2W81C 1TETH 3N9GH 5EO9B 3R19A 5HDBF 3TT3H 5AOLA 3GUTA 1L4IA 4FS0A 1KLUB 4FOMA 1FIEA 4LARH 4ZMTA 4JM2D 4LVHC 4Y5XB 4FQXA 4WU7B 2V5YA 2FJSA 2PPCA 1HQRB 3LN4B 5DD6B 2BHZA 1B6UA 1KYOK 1ADQH 3WN5B 1AGEA 2OZ4H 4XNMB 1CICC 4ZO9A 2MQ0A 1UFGA 2GT9B 5CILH 1NCHA 4JDZA 5DUBB 4LLMB 4JHWL 3EYSL 4HKJA 3MOAH 2Y6TE 4XBGA 4IM3A 3QXVA 4NQQA 4R84A 2DKSA 1DJXA 1EHNA 4NSWA 4I2XE 4XOCA 2W38A 3OAYH 4PTTA 1PS3A 4IJTA 3GSQA 1JZIA 2YGPA 3UC0L 1SLXA 1HVXA 1UOVA 4J2XA 1FYTB 4AL8H 2AJSH 4HS3A 5CU9A 2J25A 4YSPA 3S2AA 4FTVE 2AXWA 1SVZA 3ABGA 4DO5A 2QDVA 3IRCA 4QHNA 4PJXB 4H0HB 3UBHA 4WF7A 3RFZA 1BSIA 2WW8A 2YN5A 3ZE0B 4AITA 1XDTT 3RIAF 1A6ZA 3VD3A 4FNSA 4JO3H 2W0FA 4N8VA 3RE0A 3IDIB 2R4RL 1JXJA 1EBPA 4EDWL 3QRGL 5A40E 5CBEB 1RJZA 2UWEE 3ZKSD 1F4YH 4JFEB 3U82B 4TUOB 1A7BA 5L7XH 1Z5HA 2YMXH 4UDTA 4LGSB 3L5XL 2EJ1A 1GRWA 2J8HA 3TN0C 1BQHG 3P9LA 1G5GA 1SJMA 3L5JA 3N5AA 3FHAA 4GLRH 1HOCA 2YC1B 4HGMA 4OCRL 4P23C 4P3DB 5TH2A 3TV3H 2H32B 4F5CA 2VM4A 1XIWD 4QXUH 1QSZA 4E41D 1YQ2A 2G5RA 2E46A 1MFVA 1SJVA 2H1PH 3QNFA 2CRYA 5K93A 5D7IA 4B95C 1KCSL 4CN6A 3DX9A 4F7KA 4G6KH 1MXDA 5EORH 5JPNA 2DM3A 4JN4A 1L0YA 2Z8SA 1GL4B 1P7QB 1HT6A 2K0RA 4ERSL 4IOFD 4S0SD 5CZVL 3BH8B 1VFBA 1U8HB 1BYNA 4P2OD 4CN1A 1B2YA 1P7KB 3DPBA 3QCUH 2WLMA 1XD1A 5SWZB 4NUPA 1UWEL 1A4AA 4X6FA 2XN9B 2C26A 2P7TA 3E2HC 4M03A 3ECWA 3ULUC 2DQUH 5IVXA 4UYPA 1FSKC 4JFUA 2JI1A 4I3SL 4XP6L 5CBAB 3O9WB 4KJWC 3ARDA 1SJEA 5HHQA 2BSRA 1OGPA 4WTXA 4E5XB 5GS1A 3VJ6B 4Y9CA 3L1FA 1AKPA 5E99H 2R2EB 4NM4H 1R0AL 3CE1A 4LCCA 2Z93A 2J6EL 5I8EB 2X38A 4O2CA 1D6VH 3I2CL 4TQIA 5JHLL 3ML8A 4XNYH 3IFOB 4Y9GA 5CGYC 5IHZA 1BLNB 1A7PH 2K1MA 1NPJA 4R7DA 1HCZA 5T3ZH 3EYQD 1GR7A 2H3NA 1WYJA 2H3KA 2CSPA 3V5KA 1ZV9A 3FULA 2EDJA 2F74A 1WAAA 1AP2A 1UADC 3MYJB 4DN4H 4CU6A 1I8IB 3MLYL 4OFVA 4RZCB 1ZLWK 2Y5TB 1P69B 4C4KO 4CC4C 4GAJL 1QPXA 4W1TA 3RWHB 2R0KH 3BXNB 2I32A 4WJ5A 4KJPD 1J8SA 35C8L 4ES8A 3K0WA 4QXGH 5T8IA 1I3RA 3LHAA 1OM9A 3RPIB 1IAIL 4XMLL 3LQZB 1E9PB 1T83C 2BRQA 1AVAA 3RGVD 1I7RA 3QO0A 2O5YL 4YH6A 2MCAA 1WBYA 1GGUA 1VIWA 4G5ZH 5IBUB 1SXBA 3QWOB 1D6EA 2EYRA 1H0DB 3BLPX 1NDMB 1OT1A 1J1OL 3ARQA 3FQXB 4JWDA 3MOQA 4HJIA 5JOPD 2IFGA 2V8MA 4M02A 1KPVA 4OV6F 4PU2A 4YDJB 3VE0B 5C0RH 4LSRH 2CAKA 3L95A 5LBSH 5KG9B 2OMUA 3STZA 3LKRA 5SX4I 3NA9L 2WLLB 4UTAL 3QUMH 1J10A 2NCEA 4EZSA 2IVFC 4AIOA 2GCYA 2CBTA 2Y6SD 4UT6L 5IQ9A 1HNFA 1UACL 1W0WB 2YQBA 3R0NA 3ZZQA 4FQXD 4PJFE 4HGWB 3PQYD 3MGTB 3WXVH 4GRLB 2JB5H 1EWHA 2EDXA 2P45B 5B7FA 1BPLB 5DVOA 4HIXL 1FFPA 4UQDA 2XBTA 2OO2A 2HKHH 2YD5A 3MLZH 4XZUA 2RR3A 3VD7A 5DO2D 3QQXA 1E9QB 5E94B 5DEFB 3F7WA 1R5WA 3QULB 2HJFA 2ARJA 2K8MA 2ZPKH 1I85C 4EXKA 4TV3A 1FFOB 3HC0A 4JG0H 3A67L 4OBRA 3MPCA 2WIIA 4ZX6A 4Y5YB 1MWOA 1EGJL 4Y2DB 4HKZA 4LSPL 5K9KB 1F1GA 2ZYSA 4U6XA 3QZNA 4H2AA 4V11A 2ENSA 2YMTA 4NM8H 4G70B 3MC0A 4LLVB 3PWUA 4Z78A 1E2UA 3P0YL 1W0YT 3F6LA 5DC4B 2W92A 4KXAA 4IEFA 1ASPA 4EEEA 2EZ0C 2OPCA 4AYGA 4L37B 3LRSB 4AY0A 4KZDL 1ZMYA 1YEGL 5J6SA 2OMTB 2K6YA 2MCMA 1DVYA 4LEXH 1Z0NA 1MCHA 5T1KB 3L4VA 4XMTA 4YAQB 3RBSA 4NUQA 2OR9H 1BF8A 2GITA 2OLDA 4YIQA 5TD4A 4J3VA 3V0HA 1IAOA 4NZTH 3IN2A 2K8QA 4GG8B 4YN3A 1JMZA 5T5FH 5C07D 3ZR5A 4YSSA 3NGBC 1D5IL 1CXKA 4R7VA 2Y7QA 2BIQA 3MRKA 4UNIA 1MG3C 5EU5B 1DBML 1ZA3B 1TIUA 1FO0A 5I1KH 1IFGA 2VN6A 3KZ8A 2EDYA 3MLXL 3WXWL 4ZFGL 1C08B 3G04A 1UXMA 2GK0B 4OZFB 4ZAKB 5B3SB 1HSAA 2OMYB 5HHNB 3EBHA 2E5EA 4TUUA 1LK2B 4F1SA 3S88H 4JG5A 4NQCB 4HJJH 3VMPA 2D2OA 1DJSA 4NWUH 3KYKH 4PJIF 1IC7L 2R2HB 2VDKL 4BKLA 3LDBB 3GLEA 3O2DH 1MOEA 4L23A 3EO1A 1P0SE 2R29H 1CT8A 2I25N 3KYOA 3HZKB 5KBDA 5D8JH 4GG6E 4XPHL 4DGVH 3HPLB 4XOAA 3WTWA 3BZFB 5JUEH 4YDVB 1K8IA 4NQVA 4N20A 4NZRL 3DX2A 3VXTA 4WW2F 2CUHA 3IXTB 4KKCD 5K1NA 2QGCA 2E75C 2JJSC 3LB6C 4XO5A 2NY3B 4HMDA 4X5XB 3MYZA 4PV8B 4DN3H 4P5TA 3UJIL 2F58L 2Y36H 4Z23A 4IWQA 4IBSA 4CU7A 1CF8H 3C6EA 4FZPA 3CJJA 4OCMC 1F86A 3ILPA 5GIRA 3ROOA 5ICYB 2JWYA 5CGMA 1T1XB 3CZLA 4JX0A 1KGCD 2APVA 1ZLSL 1WFUA 4F27A 3SPIA 2VDMH 5AOMA 5C0CA 3V4VA 2OSWA 2GTZA 1NCWL 3AXIA 2KZ1B 8PAZA 4X6CF 3GUFA 5HGGS 2KPWA 4BSJA 3VXSE 2P8PA 3ARVA 1GS7A 3GBEA 3QJVB 3D39D 4WGWB 5DURD 3CC1A 3SGJA 1CFSA 4JKMA 2OTWB 3QNZB 2CGZA 4KTGA 5JA8B 2FJGB 1KXTA 2IANA 2WCPA 3BZEA 5AKTA 1RVFH 1YMMA 4R2GC 5I1EH 1OSZB 1XB3A 5B38A 5JO5A 4HU2A 3APCA 3DGDA 4I5BB 5IMMB 1DQLL 2J1YA 2NNXA 5FO7B 2CM5A 3B9VA 1CK0L 1RSYA 2EFKA 4BH8A 4IGBB 4JO1H 4PJBA 3AG2B 1OCWH 3EH4B 1IKFL 3NCJH 4D9RD 1FA4A 2B59B 3W3BA 1E6JL 2L7QA 4POZC 1NCOA 4YSAA 3LZLA 3T48A 2A74C 2NY6D 3KPSD 4MAYA 5C09D 3EFFA 1RZQA 1MUJB 1SBBA 1YO4A 5A3IC 1VRSA 2CHDA 3CQFA 5DD1H 1D5MA 1M7XA 4TRPL 5E5RB 4Y5XA 1WHOA 1RIHH 3W56A 3CH8A 2AI0H 4GO9A 1ZXQA 5T1DH 3WUZA 2CR6A 5ACLA 1V05A 4W70A 3X17A 1F4XL 4ZD3L 3NCCB 4ENED 2WOBA 2QQKH 2HFGH 5I1IL 1KENL 1MHPH 5FFLA 3RWFA 1TJGH 2PPFA 1G7QB 1M6OA 2C9SA 2RJMA 3BOVA 1AXSB 5EIIB 3V8OA 2OL3A 3PP4L 1CFVL 4H1LB 4CC1A 4KFZC 4X6DA 3OJDA 1J8HD 4MS6A 5IG7A 1BG1A 5KANG 5GRWA 1JN6B 1ZV2A 3DA0A 4U1NB 4WWKD 4YR6A 4HFUL 4BM7A 1A6AA 3UTSE 2CXKA 4H6HA 4LPVA 3UBGA 4D8JA 4PVLA 5F7EH 4X4YA 2VYRE 2GTQA 5IQOA 1Z5LB 5I18L 4PJXA 5EFIA 4KROD 4TNWF 1WZAA 4FHJA 4ECNA 1BD2A 3G5ZA 3MO1A 4OZ4A 5DWUH 4X7TB 3UIZA 4PLNC 4WDIB 5E8NB 3LS4L 2DM4A 3OR7A 1MRFH 3ZL4H 3BZDA 3MTRA 1HILA 3ZZ1A 4AEFA 1PL3A 1D9KC 3ORJA 4Z7UE 2X0VA 1NIAA 4GJTB 1UZ6E 3GRBA 3PDOA 4M0MA 1A6UL 3G08A 1ZTXH 1RQ5A 4TVPL 1GGCH 2P5WA 4UILL 1LDSA 5C97A 4KDTA 4IK6A 4NHCL 2H32A 1DLFH 1W9MA 3BAWA 1JYVA 1SDDA 3Q06A 3HMXA 5CNHA 1QSFA 3IPEA 1NUNB 3ECUA 3OAZK 5F89A 2YKTA 4H6IA 1DZBA 2AITA 4MB1A 5DJZB 4G1MB 4LLDB 4J4PC 4PCSA 3ZHDA 1XEUA 5DJ8A 4PD4J 4QRTB 3WEAA 3BW9B 4KI5D 1EMTL 5CUSH 4ZI8A 2HRGA 2GUOA 3CZKA 4LHUG 3DXAB 2Y3AA 2BVOA 4JM4L 1ODAA 3CX5K 2I07B 3WTYA 5DFVC 3BVTA 3S37L 1A21A 5JMOC 4GP4B 1DKXA 2DEYX 4FN0A 3FB7A 2YL5A 4M7LH 1OANA 1XGRB 2B4CL 2PW2A 1Y1UA 5DSCA 1H6EA 4XP9L 1RZPA 1CS6A 3PJNA 4MVBC 3QYNA 2KLSA 2RAMA 4JFQB 2SODB 1E4WL 5I0VA 2EIDA 4IRZA 5E4EC 4CMHC 3ABHA 1CCZA 2R2EA 5LNEA 2N56A 3Q9QA 5I8EA 1RUAL 2JCWA 2YHGA 3BPOB 1KFAL 1PZCA 1T0OA 1USQA 5EWIL 1HXMB 4FHBD 1WZKA 1PDKA 4HK0A 2E6JA 1PFCA 4P5TD 5J6HB 3ESVF 3SGDH 3CDGB 3QO1A 1K2DB 3T0EB 1XX9C 4UIKL 4OZIB 4XZ4A 3QUXA 4YGVA 5CKAA 2APXA 3ETSA 5B4MC 1GHFH 1TPXB 5C0DB 3SDXB 4KMTH 5D7HA 3U4BL 5ANHA 1BREA 4ZMWA 4A7TA 2R0ZH 3RHWK 1ZA6A 2Y5EA 2OXHB 1MF2H 3IF1A 5D93C 5C6TH 5CZKA 3HG1A 3P4NB 4FZ8H 3VTAA 4D0CA 4NENB 2AHIA 1F4WL 3HG0A 3TFBA 1XGZA 3FUMA 1JZDC 2FZ3A 5LNDA 4G6ML 3RPIA 3D3VA 3DMMB 1A4JA 1AFVH 4Y19A 1NIBA 4XCNB 2CDFA 3P40A 2EKSA 4YHYC 3FT2B 2J43A 3W0WB 4OB5H 4HULB 3P4LA 4PRBA 5GSRA 3LIUA 4NPHA 4NP4L 5D6CA 3GRGA 1XL4A 3FFCA 3FHQA 1FL5A 3K6FA 4NKQB 5KSAB 3BWUF 3MNVA 6PCYA 4G9DA 2FT6A 1TZGL 2OJZH 2HKFH 2VDRH 1LO4L 4A39A 1EO5A 1RUKL 3BN9D 3SE8L 1RURH 3QUHA 3NSCA 1G7HA 2H4EA 5F3BB 4DP4X 5I73B 1AGBA 2ETWA 4RAVA 5CJ8A 3LPGA 4KITB 4QI3A 4NQIA 3N06B 3EGXA 3TBSA 2P24A 4MAYD 3QQ3B 2HFFB 1XH2A 4N2KA 3AS1A 1R3LA 4BUHA 1JCKA 3T8VA 4UZSA 3MRGA 4YPGA 4Z3FA 3RWGA 1T0NB 4HUWA 5IESH 2X10A 1LE5A 3BVNA 2IH3A 1LO5B 4RRPM 1PLGL 1PEZA 3FKUS 1KBVA 2EC9T 2YJLA 5EU6A 5BV7B 3EOTL 5AZUA 4BBWA 3UTOA 4Q0XH 4WEBL 1NAKL 1OARH 3T4AA 1ZDSA 4FG2A 4P2RE 3SKNA 3OJMB 5IMLB 3WTTA 4HXBL 5AZ2H 1UUSA 1KIUA 3I04A 4FP8H 3L48A 5JIKA 2NZ1A 1XF2A 2UXTA 3O4LE 3X3FL 5HVHC 1FO0L 2AK4B 4PJHA 4QY8A 2LQRA 4DHLA 4U31A 3LZQA 3MI6A 4PGEB 5D7LB 4OD2B 3LKQB 3NJLA 3SDAB 2X6UA 3CFEA 3HUJE 5TDOB 2Y22A 1OE1A 2WCSA 4JHWH 3EYSH 1IGML 3ZRSA 4X4ZA 4GSRA 3QEHB 1ZK9A 4MCZA 1MVYA 1CICA 1JYXA 4LSVL 4QPEA 1URIA 2AZAA 2W60B 4OZFG 2MI7A 1LMIA 4CSPA 3MXVL 4XR8C 1DQIA 3KMDA 3FO1B 3UC0H 5F70A 3BC9A 4GW1B 3AU1B 1AQDB 2F8VA 4KDWA 2I7SA 4LAQL 1DZ0A 3F7RA 2EP6A 5ISZE 2DLHA 4GG8A 1UD5A 2FGZA 3QJXA 2XJLA 1FL6B 1QSFD 2OJEA 1XB6A 2F54B 3BWAA 1IGJA 2PLTA 1N0LB 3GKWL 5EU5A 1I4TA 1OGTB 2H8PB 2YD8A 2UX7A 2JI2A 3RWIB 2B16A 3WNKA 2PYEA 1MIEH 2EADA 4MS8D 4RRPA 3LJ3A 4MJ6A 2R4RH 3GM8A 4AT6B 2Y06L 4EDWH 1QO3B 1L9TA 3V4VL 2I5YL 1HCFX 3MUY1 5I0ZA 3QRGH 4OZGF 5K59E 1UG9A 4DETA 3ROLB 3CAFA 3VWKB 1REIA 4WI8A 1RL1A 5F7WC 3L5XH 3J8F7 4JHAL 3X12B 3G5XA 1JNHB 1RJLB 4Q74A 3LD8C 3HE7C 4FTDA 4OCRH 4CL7A 3KLHC 3TN0A 4PCYA 3PV6A 1GZQA 5D6DC 2ZOLB 3FT9A 4IBVA 2Z7ZA 4OZHB 3F7VB 4GP8B 3Q0KA 4WNSA 1DKZA 1KCSH 5EC2B 3T2OA 3LHPL 3NTCL 1FH2A 2KL6A 4FXKB 4URTB 4ERSH 5CZVH 5LAXA 3DV6A 3ZHLA 1NOAA 5IW6A 2AXFB 3DIDA 4DKFL 5C0NC 4X4XB 2YKLL 1UWEH 3DVFA 1J05B 1XEDA 1NCCL 3PIQA 4RMWA 3WIHA 1ZJAA 5IIEB 3F58L 3F5WA 1JZGA 1PY0A 3FN9A 4XP6H 4I3SH 1UURA 1IJNA 3HG1D 3OHXC 2X6CA 3SYVA 4M1DL 5EEZA 3AUVA 2FATL 5KN5A 1H9DA 1EFXB 1GOHA 1CZ8L 2ZOKB 1R0AH 5AEAA 4DF9A 3OB0H 2J6EH 1H15B 3I2CH 5JHLH 3D3VD 2X12A 1W6WA 4U0RC 4XXDB 4UOW0 1EH9A 2DWEB 3MUZ1 4ZX5A 3WN6A 1D7FA 1AS6A 1YECL 3MRRB 1QPPA 4I5BA 3DX1A 1U3HB 3SKOA 4FQQA 2CPUA 2BP5M 4NRYB 3MLYH 5HSFA 3BPNB 3C6LB 3CBJB 4PJ7E 5F3HA 3SDCC 1T5WA 1VPOL 3LPWA 4GAJH 2R1WB 3UZVB 2X3AA 3Q13A 5IEKB 3U36B 1WPCA 4LU5L 4H8WL 2MSPA 3VI3B 4GP5B 4H1LG 4CC4A 35C8H 1EEZA 4RNRA 1XH3A 1S7TA 4HKXB 3WDJA 1IAIH 4XMLH 5TF0A 1R3HA 2Y7NA 4MNQE 4B0MB 3JSSA 2BM3A 2HUEA 2DAVA 1BEXA 1JPGA 2O5YH 4G43A 4MZIA 1HHJB 3VG9B 4HMEA 1T83A 4KXCA 1JWUA 5IHWA 2QSCL 3BP6B 2FECL 2Z34A 4J3OC 2HVKA 2HTLD 4IRJC 5EU6D 1J1OH 4GAGL 3LKNA 1QR1B 4YE0A 4YHOL 2ZX9A 1JMXA 5I1DA 4AVJA 1N4XL 3DTUB 5DRWB 3P9WB 4P2OB 4DCQB 1DYZA 3QUKB 5FYJL 5ID1B 1IIKA 2UYLA 3WSQL 1SZNA 2JELL 3NA9H 1RU9L 4UTAH 3HMXL 5ESQB 3V6OC 3KCPB 4OFYA 4UT6H 4MA1C 1X6NA 4YZFF 4EPSA 4RGOL 4U1NA 4UM9B 2FJUB 1UACH 3DRQA 3WEMA 3KVDD 1HHHA 4U1GC 5E9NA 2OKMA 4BEIA 4UOZA 3OR6B 3KPPB 1ES0B 4HIEB 5D5MB 5T3XL 2E0PA 4ZFQA 2BWQA 3UEQA 2I9TB 1BAWA 3LNHA 1NM9A 2XXFA 3JV6B 1F1DA 3FB6A 1M1SA 3L9RB 1F42A 2YR3A 1IFHL 1A65A 4HIXH 1BWWA 5C3LD 1C9SA 3DOIA 3MGAA 1ET5A 1E7UA 2N1TE 5E8NA 1SLWA 1AG0A 3I75B 1NICA 2X2JA 3TZVC 3OF6D 1DVUA 4DUVA 5AW7B 5BXFB 4DOHE 2C3GA 2CGYA 3RQ3A 3BUIA 3A67H 4IRZL 1YYCA 4E9TA 5E00B 1TUPA 5CIPH 3DO3A 1MN4A 3I9PA 4LSPH 1I85A 3FPXA 4AE0A 4B9PA 1HIML 4HD5A 1IX2A 4QT5B 5IVXF 4N28A 4JPWL 4N5EC 3LXCA 1XVSA 3EH2A 4XMZA 1WS8A 3I02B 1BJMA 4JFFE 1JXGA 3P0YH 4EZUA 3KXFE 4MBOA 2Z1KA 1A2YA 4Z6AT 5LAPA 4KZDH 2OW7A 1YEGH 1VFMA 3DV4B 5EU3B 4YBQC 4APQC 3FQUB 3T0BA 1JSYA 1WFIA 2VRAA 3UROR 3PUUA 2BOBA 5CS7A 5F6IB 1U58B 1ORQA 2X7LB 5IB4B 1XGRA 2Z0UA 3GIVB 2BVYA 1WAAF 2F5BL 4N3TA 3BCDA 4DERA 3TN0D 3UXFA 4POUB 3FFDB 1D5IH 1TZIA 1U0QA 5DZLA 5FF6B 3UBXA 1HJCA 1OSPL 1V55B 1A4KA 4P23D 3GXFA 1DBMH 4JDEB 2DWXA 3PPSA 5E9DB 1OK0A 4RMSA 5HYSG 1HXMA 2BK8A 3MLXH 3PQYB 4JLRB 1QRNE 4UMGA 3WXWH 3X3GL 4Y16B 4C83A 4ZFGH 3IEAA 3RZCB 1K2DA 4ELKA 5LBGA 2Q3AA 4YBHA 1SHSA 1MRCL 4HGKC 5D2LB 1IC7H 2NSXA 2XPZA 2VDKH 1AYOA 3QXWA 1L9PA 1PJWA 5ACZB 3DJZA 4EIGB 1BHGA 2I7OA 5FAAA 1T20A 4ZG1A 3AJ7A 4LCYB 2IIJA 4XPHH 2AAAA 3UL4A 4MNGB 3ULUD 4KKLC 2VRKA 1MJUL 4E9XA 4PRNB 4KRMB 4NZRH 4KJWD 3MZGB 3FT1A 1VACB 3FQRA 4N9GA 4ZZFA 4JY4A 4MA3A 2H6UA 3MRIB 4A7GA 5IHBA 4DZ8A 3OLIA 1XF3A 1UWYA 3ABMB 4ODTL 4XCNA 3PHQB 2XX1A 4AJYV 3U46B 3UJIH 2F58H 1R47A 3L2NA 4TUKL 2YPLA 1PX8A 1TVBB 5CGYD 3F2LA 2QKWA 4PBXA 5D72L 2QVTA 4H8QA 3INOA 4AENB 1ZLSH 1BFTA 3B5TA 1ZVSA 4N68A 4ETQA 4PSPA 1NCWH 4TNEA 3Q8AA 5AFAA 5F3BA 5TPWL 4PREA 2IFFL 2AQNA 2D4DA 3FQ1A 1U41A 4FKHA 4Q9RL 4ODXA 4CMMA 4KKAD 3P3YA 3WEXA 3RLSA 3FB8B 1MCCA 2OULB 1SF5A 3V7MA 3H2WA 4GOSA 3TNMA 4EKJA 4MDIA 1S9XB 4G5AA 2R83A 4YK4C 3IN0A 3QORC 1HK6A 4IBTA 4P06A 3ZEDA 2J5LB 3NA4A 3TCLB 3VYOA 1ODUA 2B5IB 1QW9A 1I82A 1DQLH 1P84J 1VGEL 3L1EA 2R1YB 3PAVA 3DYTA 4QUOA 4YHLL 3SQRA 1ETB1 1CK0H 3AQZA 4QRQB 2G2RA 3LMJL 2OMXB 2VN5A 4TNVK 5KSUA 1IKFH 3UTTA 1CG9A 2OTUA 4B7LA 2AJVL 3RDJA 2H6OA 4JPQA 5KYUA 1E6JH 4JRWA 2ZYIA 5AVRB 2L7EA 2V4LA 4BHUI 1NGPL 2VW6A 2QPEB 1ZS2A 4TRPH 4X6EA 2A74A 1BZEA 2YRBA 4F15B 1MWAB 1TTFA 4PY7B 5KVFE 5KANI 3QUZD 4NO5B 1R46A 2X3BA 4EQ3A 3AC0A 3PGCB 3ZYOA 5HDOA 4C47A 2B7DT 15C8L 1JZFA 3DVGB 1F4XH 4ZD3H 4A2LA 4HWBA 4BWTA 1GAFL 2G5BB 4GQQA 4N2CA 5I1IH 2F18A 1KENH 4K7PX 3FXIC 4N90E 3DI2B 5BOJA 1ZE3C 4H8UA 5FYKD 4GW4B 5KEZA 1XXFC 3ZKNC 1ZEAL 1I4FB 1CN4A 2PP9A 3G6DL 5G5DA 3FO1A 4P0DA 3PP4H 1CFVH 3JXAA 3E3QC 4RETB 1AKJA 1AO7D 2A0LC 2JKNA 4N0UA 4Q9BA 2CPCA 4N2LA 4AMKL 5BS0E 4JKPL 2WXKA 4HFUH 5HJ3A 5E6YA 3KWWB 1MCWM 2VE6A 3QIBB 5MEPB 1H3TA 5AYTA 4AVHA 2NY4B 1RHHB 5H2BB 3HN5A 4DAGL 1FG2B 4JL2A 4KKQA 4S1DC 4OLXL 5I18H 4X5LA 4N2OA 1MAJA 3AMKA 4PJCA 1OGTA 2ZOTA 2B9BA 2W8CA 2CLZB 3ALXA 4Y8DC 3POHA 4M3KB 5D4JA 5IOPA 1PNDA 3LS4H 5FGCB 3VFGL 4AT6A 1E4XL 1K4DB 1QABA 3KNBB 4OF5A 3WIHL 3ZVVA 1MLBA 5E4AA 1NCGA 2HB0A 4WLCA 2XXCB 4KWUA 1N68A 2EZ0D 3OGCB 1KN2L 5JIQA 4P2QD 3ULUL 1D9KA 1A6UH 4L1TA 4TVPH 4V1DD 4UILH 3O3BB 4I3GA 1PY4A 1RIVL 2WANA 1LEIA 1MEXL 1N70A 1HXYA 4NHCH 2AXJA 4F7PB 3TJHC 2W59A 1XD0A 4LCWD 5D96B 1GH7A 3I6KA 3A4DA 4J8RA 1N5YL 3KBFA 3F7VA 4Y4HC 2VTFA 3SYCA 4OD3H 2BW5A 4F00A 1T1YA 5KZCD 2R15A 3RTQD 1EMTH 1K4CB 4DP8X 5JPMB 4FXKA 2IALB 3CN3A 1XWVA 4JM4H 5FYLD 5KVEL 4LLWA 3LV3B 5IV2B 1PG7X 2GJ6E 2HVJB 3S37H 3WFCL 2GK2A 2IPTL 1RZFL 4Z8FL 2BNUA 5FX3A 1UC6A 4NKMA 2B4CH 5DMYA 4PRHD 4XP9H 3CFNA 2VM3A 2DJSA 4GKSA 3ZY7A 2P46B 3C9NA 2EIBA 4L5FE 1E4WH 1N3NA 5J1TC 4PJBF 2X4PB 1JXKA 4QRSB 4BZ2A 4FQHA 3VXOA 1MREL 2A9CA 2DI7A 2YBRB 1XGUB 4RGNB 3T1WA 1RUAH 4F24A 5EWIH 1T5KA 2WVVA 2BCKB 5DHDA 5I66B 3AMLA 2OSLA 3LB6D 4UIKH 4AQAB 2X5CA 3MRRA 3AWEA 2CO4A 2KLRA 1JV2B 3LX9A 3I01A 1CFBA 3FQTB 3ZRCC 3KWVA 3U4BH 4A66A 1DO5A 1B0GB 3E9TA 2BSCA 3NSDA 3QDHA 5KSVA 1UGKA 1PQZB 2ISDA 4M5ZL 3RY6A 2I9LB 1G87A 3WD5L 1SFDA 2LT9A 1F4WH 4IKNA 5F97E 5CEXA 5D1QB 1OW0C 3VI3A 4P8QA 3D2UB 3IDYC 4G6MH 3OBAA 5AVSB 3DVNA 1MFDL 3NJGA 3Q5YA 4X6DF 1BIIA 3H7LA 2YIHA 2BINA 1E8WA 4WAFA 1WG3A 4J6RL 4P3CL 1FZOB 2YSSB 3E38A 1O0VA 4XAKE 4NP4H 5KYWB 5C0AE 5FYKL 3QISA 4NNXA 4FEIA 3T0XA 4PJXF 3RWEA 1LO4H 1NBCA 4XB8A 1RUKH 4KH9A 5BZDB 4L3CA 1Q0EA 3SE8H 4L1HA 1A1MB 4JZJC 3LSOA 3UTTD 3DXAE 2CKBB 1U8CB 2FIKB 3V55A 1LEKB 1MY7A 1X5HA 4QOKB 5DVKA 5K59F 2VISA 5M94B 5ESQA 1X03A 3BAIA 1OT2A 1VEPA 1NCIA 4L4TB 4BH7A 2B08A 1AZUA 4HF5L 4WGVB 4KK5C 1RSFA 2CJSA 3IDGA 3IU3B 4BE5A 2PTUA 4GRWB 4N8UA 5A3ID 1GYCA 2R8SL 4LVNB 3I3BA 3OR6A 2M83A 5MI0C 1ES0A 1U93A 2X3XA 1PLGH 4NQXA 3RX5A 4ODWB 3S5LA 3FDWA 4P05A 4F7CB 3WDHA 2VN4A 3EOTH 3I84A 3L9RA 1U2HA 3G5YA 1YVLA 3FD9A 3LQMA 3RBGA 4WEBH 1VA9A 1NAKH 2EXSA 2WCGA 5EUKA 5HYIA 5JOEA 3TH2T 1D5ZA 1I8KA 4M6ML 4HXBH 5C1MB 3RPBA 1T0PB 4HHGA 4L9LC 4ADGA 3PWVB 1KTDB 3MJ7B 5I6XC 4O2FB 1AKJD 2FT7A 3L7EA 3FU7B 4ZW3A 1RHFA 1ZHKA 2L0DA 2F53E 4FG4A 1RZIA 4NFDA 1L9QA 4NO0A 3X3FH 1HEJC 4ONGL 1FO0H 5CD3B 1L0QA 5DJXA 2Z31B 2JKWA 2XZQL 3G7TA 3KM2A 5DRNB 4IRSB 1U3ZA 2RACA 1WC7B 5DJ6A 1P4UA 1T03L 3SJVE 1CQYA 3P2TA 2ED9A 4UQCA 3ZZLA 1NUGA 1W91A 3KLSA 4PSRA 5L8KB 2HMID 1IGMH 3RX7A 1B9KA 2NW2B 2AZUA 3PWLA 4CKVX 4WFGE 4LSVH 3RY5A 4G9FB 4FQ2L 3MXVH 3KBEA 5AD0B 2R69A 1ETZB 5HYJE 2C3VB 2YARA 5J9PA 1D9KD 1U58A 2X7LA 1W6LA 4LAQH 4EOWL 2GJPA 3OHXM 5E51A 4AYFA 1K85A 4NSKA 4PJ5A 1BCIA 2FX7L 3IMWA 1AANA 2JF1A 2AXGA 2OP4L 3QFDA 3MRHA 3GKWH 3RY4A 1JCVA 3HNSL 5HHOE 2VKXA 3M46A 2EVHA 3EYUH 4Q2ZB 2FUTA 5KVDL 3ULVL 2ZYHA 5DMKB 1FNEB 3O8XC 2UUDH 3QT2A 2Y06H 4PWFA 4J4PD 3V4VH 5IHHA 4M1GL 2I5YH 5IQ7L 4HH8A 4BK8A 4JGNA 4HK3N 1I4LA 4GMSL 2J2ZA 2H3XC 3DHMA 2WYHA 4Q4EA 4JHAH 4PGBB 4W6XB 2WV3A 1BVLB 1ACYL 3N43B 4C56D 4OF0A 3V9CA 3ILDA 5DFVD 1FCGA 4RDQF 2ENPA 1AZBA 1JS4A 4ZW7A 2IPUK 3WL9B 5JIHA 4KTEL 1TJXA 3B9AA 2WTPA 4L8DA 3S3DB 3HE7A 1JGVH 4PRNA 3FU5A 4TLKA 3MRQA 4CN4A 5D6DA 1X4ZA 2HWZL 3H3BC 4FA8A 5G4MA 3LHPH 3NTCH 3HZYB 5E6RB 3QDJA 1VESA 1HI6B 3CSYB 2AK4E 4U6TA 4X99B 4LPUA 1YUHB 3A23A 4N2MA 1QLFB 2ICWB 1CWVA 2SEBA 5C5BB 3D05A 1NFDE 2LLLA 3RVXC 1UA6L 4DKFH 2XTSA 5D7LE 2IXQB 2YKLH 1XCXA 4DP9X 1K6QL 1TQCC 1NCCH 4WFHE 4PRAB 5AYQA 3DYMA 5TE4L 5IB3B 2ZNXA 3F58H 4H40A 5B4MD 1BBJB 3GMLA 2GEQA 2FATH 1NCDL 4YSOA 4HUKB 2XPGA 4XP1L 1CZ8H 2LVEA 4O51A 4Y8AA 5BQ7A 3KLAA 2RB8A 3GSRA 3OHXA 4GS7C 4P2AA 4Y5VC 3TT1L 5T1JA 1QI4A 4Z7OB 3UYPA 2X1XR 3GEWB 1EUTA 1JTOA 4E81A 4G8GA 3EGSA 4HWBL 4OU3A 1TTBA 5I1LA 3W57A 4LDCA 2GI0A 1PCXA 2L04A 5F88B 2C7UB 2PF6A 4PJHF 3TCLA 4WTQA 3UTPE 1YECH 4HIIA 1T1ZA 4XNZC 3QARA 3RIKA 2OL3H 2W0KA 4MLIA 2A6JB 5E1HB 1VPOH 2HJKA 4FG6C 4N2DA 4IW4C 4HETA 4JRYD 4FLQA 4UB0L 3GI9L 3GMNB 3CFDB 1CYGA 1U8JA 4LU5H 4H8WH 4EZVA 3SDCA 4FNUA 4HR1A 5LBVA 1KBBA 1V10A 3ERXA 1J0JA 5IMOA 3BIAX 3CU1A 4EKXA 2VQUA 2E56A 3VFWA 4P2YA 4N0CC 2W5PA 3QQDB 3ATBA 1G7MA 2Y7LA 3WTVA 1VCAA 4W9IC 1U6AL 4PP2B 4R5IA 2QSCH 1BYPA 1JHTA 3M1BB 4GKNB 4OZHE 4PFEA 5K9QG 1GMEA 2Y9RT 1LQBC 4P9HC 5F1NA 4GAGH 4Q8BA 4YHOH 1NUFA 2AKRA 1N4XH 4XVUC 4IRJA 3F7YB 1ERNA 3AT0A 1ZSDB 3OV6A 4RFOL 1E9OA 4UT9A 5FYJH 3RGHA 4YC2B 3WSQH 5GZNC 2H32H 2JELH 3L3IA 1RU9H 1MCFA 2BY1A 1HAUA 3QW9A 5C71A 3HMXH 5IB5A 1N26A 3B4NA 5BJTA 4XPTL 1SXAA 4NO0D 4RGOH 3US1A 2AJUL 3V6OA 5EU7E 5MEPA 3GLDA 3ULSB 3C5JB 3B56A 5T3XH 2PWDA 4LKXB 1J8KA 2DQDL 5CCKL 4Z7WE 4JFDD 3ZDXB 5DZNA 2XWJA 3ATEA 2WQSA 3MX0A 4JVWA 4NDMB 1IFHH 3LEYL 4HC1A 3K6SB 3QB7C 3EF7A 4ZNCD 3CZUB 4HV8B 1U00A 5BVJA 1FVDB 1U8IA 5IJBC 2OZNB 1HHIB 3OSKA 3MRMB 1SNRA 4AQOA 1HINL 1R3JB 3U7AA 1YC8A 1IBFA 5JHBA 2X9WA 2YPKB 3P4MB 4PRPD 3OVUB 5AW1B 3RKPA 4IRZH 4L8CA 3TPUA 3BFQG 2IDQA 3E1F1 3O3BA 5CU5A 5AB2A 1HIMH 4S0HA 5EO1A 4HUUB 2N7BA 2LW3A 4JPWH 3K80A 2F8IA 1IGYA 1DQKA 2D7PA 5IR1A 3ULUF 1F00I 1FV1A 3FTGB 1HNGA 5ANMB 1AZRA 3C8KB 4Z77A 3QEQB 4Z7VB 2J1XA 3IDUA 1JNJA 4WGKA 4B9QA 4GW5B 4E41E 4XVJL 3PP3K 4KVPA 4PJAB 2WBJB 3B8YA 2D7NA 4RX4D 3TOPA 1E2WA 5TDPB 1E0OB 1XSJA 3FB5B 4JW3A 3Q8BA 1I75A 1A9BB 2GPZA 1AHWB 4NKOB 1E7VA 2F5BH 2ZTBA 3ZQWA 3PS6A 5BMFL 1W2KT 5HJDA 2GHWB 5IQMA 2CMRL 2H6PA 3JWDL 4ODUB 3FU9A 3VH8B 3ARGD 3SQBA 1OSPH 2QTVA 1ACZA 3NSFA 3KLHD 2C3XA 3HS0C 3ERCC 1S5IH 2NCZA 3NABL 2VLKB 1CGTA 4AC4A 4KQ4L 2EYSB 1DLHB 1KLFA 2WMPB 1CBVL 3N40F 1J1PL 3JT0A 5IM7A 3QDJD 4QYOB 4FLRA 3X3GH 1UWXH 3K72B 2EC9U 3BLKA 2OR7A 5BUGA 5MEOB 3C87A 4NQSA 5DZ9A 1MRCH 5F21B 1HU8A 4Y4KB 4WK4B 1C8QA 4OZGE 3V0FA 3HZVA 2CCVA 3FRPA 5C0ND 2K7QA 1PQZA 3NH7L 1EANA 1Q1JL 1UM5L 1XAUA 4HHAA 5G4OA 2NY0D 3RIFF 4ZUSA 1UATA 7PCYA 1QMUA 2BHYA 2QXLA 1F6LL 1MJUH 2VQ1A 1I3GL 1R75A 1I8AA 3EJRA 4APXB 3GZQA 3L3KA 1QD0A 2VXTL 3L3JB 2XG5B 5K1VA 4PR5B 2VZOA 3LRGA 5CSZB 3BPCB 4H44C 4ODTH 4G8GD 4OIBA 5DK0B 1QVOA 4G42B 5DJ0B 5T5NF 2J57A 4ZRGA 5HP5A 2PYFB 2BP8B 2XVKA 4TUKH 3S0PA 1TLMA 5D72H 5DUML 2VXVL 4OCXL 2EABA 5GQBA 4L29B 4XCYA 1MJ7L 2XI9A 5BZDA 3TA4D 4D0BB 3RV0A 1BLIA 3BEVB 4NI3A 3QCVL 3QP3A 2GVYA 5TPWH 2DQCL 5B7EA 2IFFH 1LQSR 2FIKA 1LDPL 4Q9RH 4JKKA 3VI4B 2RH0A 2W07A 5JDSB 3VXPB 3VFPB 5JOPE 1PBYA 4IHOB 5E7BA 3NZ8B 2JMRA 4CDHA 3MRPB 1O6SA 3IU3A 1WITA 2YQ3A 4B96A 4EZWA 4OH2A 3EYFA 3KDMB 3G9AB 3TNNA 2NUTB 1FHNA 2XV0A 2CK0L 1BM7A 3LY6A 2OXGB 4MNHB 2GY7B 4DO6A 3MRJA 2GJZB 2HFEB 1VGEH 3QORA 1B4LA 2CHXA 4YHLH 2R69L 3EZJB 4MKMA 5C2UB 1T4KB 3VU2A 5B38G 3LMJH 3MROB 3OG4B 1UKQA 2VR5A 4HIJA 4N0RA 4AUYA 3PQYE 4J3OD 3RWJA 2DS4A 4AKPA 2AJVH 1JNNL 1MW2A 3WGUB 1KTCA 1YEKL 2CDEA 3OKOA 4M5YL 4CNIA 1ZJBA 4AJ0A 4HJ0C 3MJ7A 4IM2A 1M1XB 1KOAA 1JERA 3QXAB 4I0CC 1QBLL 3BPLB 3X1GA 3LPPA 5BVPL 1NGPH 3MNWB 5IW3A 3C09B 4OF8A 4UAHA 2W9EL 4I13B 1UT2A 2PCFB 3KPLA 4KRNA 2EH8L 2X3WA 3ECQA 1C16B 3PY9A 15C8H 3EH3B 3JWOL 4HAKA 3WEBA 4JO4L 3KR3L 1GAFH 4ZSOB 2PXYD 5D1ZB 5HJBA 2EEBA 4FXGB 5DD5L 3ZSTA 2EUVA 1ZEAH 1M7IB 1BZ9A 3GSNA 5JW4N 3B7TA 1ETZA 3BKYL 4RIRA 3GZPA 1FVEB 3TZVD 4OZIF 3EJCA 4KJQC 3ZMRA 4YDLB 5AAPA 4MQ7A 1A6TB 4L3EA 5FB8A 4E42B 4AJVA 4JKPH 5CR8A 3SDXF 4MMZB 4DAGH 1CI3M 4F80A 1DDTA 1KIRA 2LAAA 2XU9A 3QQ9C 4OLXH 3I85A 1F8TL 3KPQB 4YZFE 1PKQA 4N2EA 1DJHA 3FTXA 1EUUA 3W9EB 4N5ED 4F5CE 3B2DC 5C07E 1MFMA 1J1XL 3MLPA 4A7GF 4F8TA 3VFGH 3I9IA 1E4XH 3TO2B 3WIHH 1ROCA 2VR4A 2WNGA 4QJ5B 2VLJD 5D7IE 1KN2H 3CDZA 3ULUH 4M8VA 3HZ3A 4XMWA 4G6FD 3NFPB 4YBQD 4APQD 4NYLB 3K71B 3ULVF 4PJGB 2VCOA 3WNJA 1G9EA 1RIVH 4JRLA 1MEXH 4HZLA 4BELD 4N1HB 1QBAA 2PY6A 1AIFA 4YHPB 1OB1B 1VFAB 3EOYG 3O3EA 1N5YH 3ZBMA 3B2UC 5CLXA 5IVXE 3BZ5A 1MFBL 3T0DA 4WKXA 3DTXB 1F2XK 3QUZB 5ADPL 4HS6A 2B39A 1YHPA 4G7VL 4XNUL 4GIOA 5HD8C 5H94B 5KVEH 3EAKA 1QLFA 2CO7A 2XY2A 3EOBB 4TNGA 3S48A 5AOKA 1A4BA 1D2OA 2IPTH 1RZFH 3GB7B 4Z8FH 1VKXB 3Q5OA 4YSTA 5I1AB 4DCNC 3WU1A 3UAJC 5I8OL 5F6HI 3A5VA 1IAMA 4OSUL 3TIDB 2G4GA 1HKLL 1BBJA 3RB5A 3QWRD 4JZNB 4NN5B 2W94A 2P8LB 4WSKA 5I24A 1AO7B 1P84K 2BNRB 2N4IA 1KGCE 3L13A 3ARXA 4LNRB 4ORZC 1MREH 4R90L 4OGZA 1LGVA 4XN9A 3CUPA 1RH8A 4DP1X 4KKLD 1OA0A 4QHLA 1D5XA 4XODA 1K5NB 3FTSA 5IFAL 4PI0A 4C59B 3D39E 4ZMLA 2JK5A 2W95A 5J1AA 1NBZB 5ERWB 1QFWI 3QQ4B 4UT9L 1G7JB 2O6FA 1KT2B 5JIMA 3WNNA 1QEXA 3U0PA 4GUQA 2ILLA 2FUQA 2NRDA 4H0LC 3JWNC 1G7LA 1L9MA 2TSBA 2JIXA 2NDGA 5FGCE 4M5ZH 3SKMA 4LEOB 2XA3A 2XN2A 3WD5H 2Z8YA 1R9FA 4P2QB 1CDYA 3IFLL 4V1DB 3TIEB 1TCRA 1QLRA 2FK9A 5CXPA 4WCYL 1MFDH 4YO0B 2ITDB 1OTTC 1OW0A 4D9RE 4HC1L 5CHNB 1ZHNB 2QSVA 4J6RH 4P3CH 4PG9B 1J9RA 3KPSE 5C09E 3VRIB 4F7MA 4JVUA 4PP2A 5FYKH 3M1BA 3QORD 3M86A 3RDTD 3RTQB 4UI2A 2FR4A 1O75A 1KB5B 3ER9B 1I1YA 2PO6B 1OF2A 4LPWA 2UY6B 1S9KC 3ESMA 4JN2B 5F7AA 2FWUA 3EUDA 3REWA 4A7QA 4HUVB 4QHMA 4PRHB 3QA3B 4JZJA 4NC0B 3W9DA 3RVVC 5HYQA 3O41A 3O6KL 4EI5C 4HF5H 5IJVB 2R8SH 3BZ4B 3NJXA 4K2UL 3SYQA 5MHSD 1SYVA 1U4FA 4IMLA 5I15L 3EYOA 1J8HE 4LVOB 3GPSA 4HDIB 4Z0BL 2XLLA 2VAAA 3P2DA 2FYYB 3SQOL 3V0DA 5CO1A 3KLDA 3H3KA 3PYCA 4CADA 4AIZB 1HESA 1DSFL 3GI8L 2F7RA 4HV8A 2VDLL 2G2NA 3QHTC 4Y2NA 1FVDA 4KRPC 4XN4A 2OSXA 4M6MH 1D5BB 3KS0H 4HEME 2H26B 4CJ1A 2CJ3A 4NC2B 2NW3A 5ICXB 3A6OA 4U1HB 5DRXA 3KVPA 5KOVC 3UGUA 1GYVA 3T4AG 4L3ED 2D3VA 4ZPTB 4ONGH 2VIRA 1Y7VA 2BC4A 1N8ZB 2XZQH 4N85A 2A0LD 4HUUA 1Z0MA 4M7LT 3HLAA 1R6VA 3T0VA 2QBWA 3H54A 1JXFA 2YAMA 3MREB 1S9WA 1YQVL 1T03H 4JR9L 3UG3A 4S1DD 3TX4A 5ANMA 4GAYB 2WLIB 3C8KA 2FLBT 4XC1L 2HLFD 1MHCB 1U8KA 4FQ2H 2WBJA 3H7BA 1KYAA 1M05B 2D0FA 1CURA 1KYDA 3FB5A 3STLB 2P44B 5C0JB 1BYOA 5AG9A 5L2KD 3BJ91 4KI5E 3TBWA 1AHWA 3E9UA 1T21A 2XX0A 4DW2L 1WTGT 4EOWH 2ESVA 3GMOA 2FHCA 5B3NA 4WJKB 5C0FA 2FX7H 5BRZB 5E70A 2OP4H 2UXGA 3P1VA 4E9YA 3HNSH 2VLKA 3MRLB 5KVDH 3VI3F 5F1SA 3ULVH 3T8MA 4Y4HD 4XNQB 3AACA 2GYSA 1GY1A 4WV1B 3NMEA 4M1GH 5IQ7H 1BEYL 5FOJA 4J2QA 5E4OA 5FKAA 3UP1A 1QKZL 4AXWA 4L4VA 5JIDA 2K3HA 4GMSH 2CKBL 3O8XA 1PYWB 5IVNA 2E4FA 4RRPG 5TGBA 1ACYH 2X4NB 2DY2A 4UAOC 1WTLA 3VFRA 5EO0B 3HCVB 4ZOEA 3U1SL 4ABQA 2PWGA 1R1CA 3U9WA 1BV8A 2Q0ZX 1RPKA 4LF3B 3H9SB 3GS4A 5E1IA 4KTEH 3VGDA 4OLVL 4NQEB 4BQCA 4J1UA 3QUGA 4G80B 5I76B 4R97B 3AGWA 3ARZA 4R0LB 4FJZA 1A02N 4AZ6A 5I9QB 2E74C 2VAJA 3GSOA 2HWZH 5DJDA 3CZSA 5CSZA 4PS4L 5PCYA 3TA3C 4B9FA 3MN8A 3MLSL 1N12A 3GRWA 1QSEA 4I8DA 1UA6H 2V7NA 2WQUA 3A6BL 3U0TB 2P5EB 4JFOB 1D2PA 1K6QH 2F0CA 4LHQB 3U9UB 5TE4H 2JIXD 4A2DA 1ZT4A 3LNGA 3RKDC 3RILA 1NCDH 4XP1H 4IBZA 3VI4A 2CZNA 4PLKC 3TT1H 3VFPA 3V5HB 4RMUA 2PMZA 2R56L 2ZE0A 3H42L 2H9GA 3NZ8A 2FDBP 1IU1A 2X4TB 4HWBH 4Y5VA 3QEGL 3MUGB 3PLTA 1Q9OA 4XXCC 3H0TB 1AZZC 3AXLB 2XV6B 4E9SA 4YMPA 1MFUA 1OQOA 1HH9A 2HN7A 3LH9A 4U1LA 3U6XA 2DZEA 5CEZD 4U1IB 2EIZA 5F1OB 5ETUB 1YNTB 3ZDYB 1DDHB 3MJWA 4MTMA 5K9QI 2BVUA 4BFIB 2DYSB 4JRXA 3NQIA 5J57B 2ATKB 4UB0H 1LJMA 2QMJA 3GI9H 1OP3H 1CXFA 1SU8A 4C56B 1OAQL 5GHWL 1U8OA 3WLWC 4X83A 3D25A 4PMFA 2ALAA 1GGBL 3IB4A 3L45A 4LDLB 4F2ME 3IGLA 2C8NA 2E27L 4UWQB 3S4SB 1G7PA 4YWGL 3N1FC 2X1WL 1EJ8A 5I8CA 1S7UB 3NQKA 2Z7UA 5AW8B 3WMQA 2YWZA 3KAAA 3DROA 4X0KB 1TZOA 1U2YA 4KK5D 2R7EB 2J44A 5L88L 4I1QA 1C16A 1JI1A 1R5IB 1U6AH 2Z91B 5E4EB 2FCBA 4HKBB 2YA2A 2FEJA 1WBXA 1DJGA 5D1ZA 4PRID 4M4RB 5F8QC 2EUXA 3U6RB 4PUBL 1A9EB 4RFOH 3R4RA 1Q0YL 3Q3GB 2JKXA 1M7IA 5JHDB 2EEXA 3GBML 4H26A 2VWEE 1FVEA 1T3FA 3L4WA 3WS6C 4XPTH 1BQLL 1J48A 2GSIB 2UY7A 3HB3B 4GINA 5GZNA 4DWHA 5IB2A 2WQWA 2AJUH 1Y6NR 5D2LF 3SCMB 2VR3A 5L2JA 2G75B 4HWEL 5E6UB 2CD0A 1UEMA 1P7BA 3KPQA 4TULL 3GMMB 2WLNA 1F4AA 1K3ZA 2DQDH 2P1YA 2P5WE 5CCKH 3EBGA 3N42B 2EVFA 1A1NB 3LEYH 4YHKL 1EZUA 1RZ8A 4QXVA 3Q1SL 1QSFE 5IFHL 1E27B 5HGBA 3UYOD 3JTTA 3ESPA 1DKYA 2IDSA 4Y1AA 1HINH 4OCNC 2ZYRA 4UDUA 3EADA 3V0VB 5DJCB 4X7SL 3CIAA 3VVWA 5F0LB 5CEYA 5T3XE 4MQSB 4FM3A 4MWFB 2ESVD 4JRYB 4XI5D 4JZOB 2E7BA 2YD2A 5DEJA 4W4OC 3IGAA 1AI1L 1QTPA 2RGSA 3GDBA 3K6DA 1VFAA 3MRBA 1MKFA 3GFUA 3GSUB 3WIIL 3UJTL 2VB5A 3U2SA 1KXQA 4LP8A 2DV6A 1ROWA 2XG4B 3OG6B 3US0A 1A7QH 4AZGA 4BJLA 1G6RA 1NGZA 5MENA 1GJIA 2AQPA 1EBAA 4XVJH 1C7TA 5H94A 4DQOL 1JE6A 1JOIA 1G7IA 2FJHA 4L4VD 4X9FA 3SY6A 1IM3A 3GB7A 3LAFA 3DJSA 4YFLF 4X2UA 5L0QC 5I1JL 4V2CB 2QSQA 3ARBA 3NIFB 3K8MA 5BMFH 4PGDA 2QPDB 4QGTA 2CMRH 2X89D 3JWDH 3MBEB 3OXRB 4M7ZB 4XPBL 1YPZA 3G6JA 3CZNA 4LOVA 1OQXA 1Q0XL 5DJ2A 4KO5A 2IQAB 2BNRA 2DMBA 1UH4A 4ZUWA 3WFHB 3NABH 1JGDA 2ARWA 2Q86A 1U8LB 3IKCA 4KQ4H 3O0LA 5EU4B 1CBVH 2WWMC 1E42A 1J1PH 2DQTL 3HG1E 4NUGL 3WLBA 5CEZL 1QNIA 2C9QA 3HS0A 3S34L 5DEZA 5ECJE 4OVUA 4IU2A 1CFQA 2BS8A 2XQBL 3VSUA 1FVCB 3LEXA 3D3VE 1KT2A 4IM8A 5F9JB 4UINL 5EF1A 4Y19E 2ADYA 1H5BC 1MJJA 3FONB 1OGAB 1MCBA 1QACA 4R3SB 1WCBB 5AOZA 3GNML 1S7XA 1FFNA 1HHKB 3BVVA 3MUHL 2NZIA 5I6LA 3C5ZB 3QS3A 3TPKA 2OFQA 2O1AA 2WVSA 4NPYB 3NH7H 3ZPDA 3FFCE 1Q1JH 1UM5H 2NXZC 5EZJA 3WO4C 4PRPB 5HVGB 2A6DA 3Q8CA 5BW7C 4J3OF 1I3GH 3MKKA 4M8RA 1JWSA 3TCTA 3UMTA 5CSBA 3HVDA 5LWYL 2VXTH 3PL6C 4WQOA 4LCIL 4KDVA 3QJOA 1ZRUA 4PJEB 4K0OA 2ITDA 3VCLA 4OKDA 1H8NA 2R2BB 5EZLB 3OPZL 3AG1B 4MXWL 1BWMA 5CINL 4QXTA 2HG5B 2V9UA 3BDXA 1TITA 5DUMH 1QUNA 2VXVH 2X1QA 4OCXH 4I4WB 4G11A 5B1BB 1CL7L 1XFPA 5DS2A 1MJ7H 3QG7L 4KMQA 3TBBA 3RIAK 3H6AA 3EHBC 2X3VA 4NLHA 3QCVH 3O11A 2ED8A 2DQCH 3D07A 4EZLA 4G7SB 5T1MB 4PJAE 1LDPH 1M4KA 2YFNA 4WI5A 3DPDA 5EU6E 4Y7MA 4TUJA 4MSWB 4WW2C 4MD0A 1KC5L 1XGPA 2X4UB 2EKJA 5IJVA 3ARGB 4NJAL 2MWCA 4LFHD 4QLWA 1TTAA 1ZT1B 5J13B 3BZ4A 1BFOA 4R5VA 3GMRA 4N9OB 1LEGB 4NN7C 2CK0H 2A99A 5HY9A 1C7SA 4HDIA 4N0CD 1P9MC 1ZS8B 2ADFL 2FYYA 4HH9B 4ICWA 4W93A 3RUGB 5B22A 4E9QA 2R69H 2Z7WA 1EEYA 4PJHE 2NY5C 1FZKB 1JGUL 2VERA 3ZT7A 4HWNA 4MMXB 4Z7QB 1TU2B 5AOJA 3UMNA 4XCEA 1JNNH 3V10A 1YEKH 4M5YH 5AVXB 3B2VL 1GGTA 4UM8A 4BNEA 5H4ZA 1PU0A 4XVUD 3AABA 1QBLH 1YEDA 3A4EA 2B0SL 5GZND 3FOMB 2LM0A 5BVPH 3L2MA 4QRPD 3GLZA 2NY0B 4N2HA 2DLEA 1SJHA 2V2XB 2W9EH 4M00A 1I1FA 4OLEA 2P5PA 4U2YA 1WS7A 2EH8H 5EOTA 5C08A 4PHXA 5HGDB 2WXNA 5CJ5A 3WELA 3JWOH 1TFPA 4JO4H 3KR3H 5C3TA 1EFQA 1IM9B 1DBKL 3I50L 4TOYL 3KPRD 4LBEA 5DD5H 3VWJB 3GMPB 4BK5C 1JZEA 1JZ2A 3BP5A 4LSTL 1S9YB 2YXFA 1RJYA 3CVHB 2F61A 4HLZH 2KERA 1HAWA 1M05A 2AK1L 2NLJB 1N59A 1KTLB 5FCUL 3BKYH 4EUPA 3FQWA 2ICWI 4GUPB 3RNKA 5C0JA 2EWFA 4F7EB 3V0AC 2VM9A 2GSGA 4FNTA 1F18A 1NEZA 1DVQA 3KJ6L 1S78D 3OZKA 5GRUH 1MI5B 5HI5C 3N1GC 5CP3A 3NJVA 3ESNA 2N0MA 2FECI 1F8TH 4JFTA 3ZO0A 1I3VA 4XRCB 3SPCA 1MCIA 3GRWL 1WFMA 1SQMA 5I1LB 3HJ0A 5HGHA 1J1XH 3W5MA 3II1A 5MEND 4JHUA 1G5AA 4P49A 3EYVB 3WUWB 4BSWA 2EEDA 3T0WA 3EBIA 3MNZB 3M7OA 4PBDA 1AG6A 3X1BA 3D52A 2EEAA 1T2XA 2YD3A 2X4NA 5A6MA 3G5WA 2GI7A 1JPFB 1U8PB 4OM1L 1M7UA 2PCPB 5KS9E 2OMVA 3V4PB 5T1LB 2A7BA 1VCBC 2P9RA 3I3EA 1WHPA 3EG9B 3O6ML 4U4IA 2BVPB 2X4OA 1J8RA 3G5VB 3QNYB 1BPVA 1ZVHA 3QE5A 3GTTA 5B1JC 5ILTL 1MFBH 2ZONA 3P69A 1YN7B 2X4QA 3GM0A 4Q9CA 1FNLA 4JGJA 1DP0A 3QWQB 5ADPH 3HAEB 1LE9A 1DVSA 3GD1C 3ALPA 2R59A 4G7VH 3ULUE 4XNUH 1EHXA 2YMOA 3RURA 2QKIB 4GRWF 1TZAA 2HXAA 3U0TA 2PXYB 2P5EA 2A2QT 3UZQA 2AEOA 3AU0A 3UITA 4L8BA 4ZJ9A 5I8OH 3IAGC 4OSUH 3BT2L 1HKLH 4ZFOA 3P30L 4OKVB 4F3FB 1GC1C 4R4BA 4EI6A 4MQXD 1KBGL 3HI1B 3UAJA 5IGXL 1KV3A 1PTZA 4R90H 1IC5L 3L9YA 5KVEE 3QIUC 2VDQL 3D85B 2HZHA 3SOGA 4OW6A 43C9A 3MV8B 3S4SG 3JZ7A 3U6XS 3I6GA 1RERA 4I85A 3R1GL 5IFAH 4TVUA 4JO5A 1EJOL 2BIIA 3WFZA 4HHWA 2XY1A 5AAMA 1NJ9A 2NTFB 2X44D 1O7DC 4J3OH 4P9HL 4UT9H 4BFOA 3P77A 1L5GB 1NCBL 5J89A 2LLNA 3FSWA 2QGDA 4JFWA 1DDHA 3GMQA 4U3SB 3QJSB 4EMZA 4XN7A 1S6NA 1B0RB 2XICA 2ATKA 2VLJB 1AJ7L 4NJ9L 4RWYL 4M8QB 2EICA 2WXRA 3QNJA 5FA3B 3NEEA 2EDDA 2F7PA 3IFLH 5D2NB 1ZVNA 4E9VA 3CLFL 3HRZC 3PAYA 1BMWA 1S7RB 1XH1A 4WCYH 3GIZL 1NANH 4PJGE 4X8JB 1EEQA 2Y2WA 3ISRA 1U91A 4HC1H 1VJSA 3FFOA 2HX8A 1O6VA 4FX5A 3U4AA 2R7EA 4S1SL 4HALA 2ZUUA 4XWOC 2YWYA 1XCTB 2V2TB 3JV4B 3S3JA 2N7SA 4OT1L 5DYOB 2CIIB 4MRCA 5EMYA 2EVJA 4DP5X 1EV2E 4RGMC 5JW5B 3H9HB 3LEVL 4PJDB 3SEPA 5AWNL 3KDPB 2X53A 5DA4A 1T7YA 1P7HL 4X50A 5HHPB 2P49B 4I48B 1AXIB 1C1EL 2OSYA 3O6KH 4HJ0D 3SCMA 5FYKE 1DQJB 2AC0A 4K2UH 5AW5B 4UDXX 4PWIA 1XT5A 4EI5A 4ODVL 1EIBA 4F9PC 5I15H 3BWUC 4G1EA 3IJYA 1AO7E 3MRFB 5I71C 3O3AA 4M6AA 3C8DA 2I24N 4Z0BH 3ZN6A 4B9JA 4J3WA 3QDGD 3SQOH 2KDYA 3GGWB 1QOKA 2G2PA 4PBWD 4XOBA 2AJZA 3IXAB 3GI8H 4AZIA 1DSFH 5GGSB 2B77A 1SMOA 3L7FA 2VDLH 3AS3A 4FA6A 3MV7B 4WI0B 3ZHFA 4DSYA 4POYA 1T7ZA 3LZNA 1O9WA 4HA1A 1EQWA 4J3TA 3W82A 5FECB 4ZQTA 4MHHG 5BO1L 4R5JA 1JV5B 3N85L 1BOYA 3L4CA 2ZX7A 1XZWA 2J7LA 3K74B 5H8DA 2WVTA 4KI1A 3A6CL 4U6HB 4JMNA 4KJQD 4XBMA 5D7KD 4HCRA 5SV3A 5ADOL 1MCWW 2XKNB 3MQIA 5E56A 3P0VL 1ND0B 1HOEA 2ZCLL 1DTUA 1W16A 4XMXA 1VDGA 3BUTA 1UB6A 2JNZA 3NN8B 4IHBA 5JMRA 1YQVH 4JR9H 1F6FB 3VA6A 3QQ9D 2LU7A 2VSMB 3QUMA 4TPRL 1AGDB 4OJEH 4N8PA 1OY3B 4TN9A 4LCWE 4Z7OF 4XC1H 3GHBL 1ZIBA 3QUYC 3JVGA 2H0FA 3L3DB 4P5KA 4DVBA 2F19L 3K0YA 1ULVA 3RDTB 1E5AA 3T2PA 2JXMB 1XO8A 5IVZB 5HBBA 4OJFL 3KD4A 4E9RA 2YSTA 3HTLX 4FKEA 4TYUA 4Q58C 4KUCD 4DW2H 3JV5A 1ZWIA 2KZBA 3QZWA 2LV4A 2XTJC 4R7NA 5FYLE 1KGIA 1WUZA 4X4MA 1X44A 1X5JA 5FHBL 4AGMA 1IFRA 1KG0A 2IH8A 1OF0A 5EUOB 5AG8A 3EJYC 2IQAA 2B20A 2MQCA 3IMRA 4TVSa 3UTQB 3B9KC 2D4CA 3AM8C 3TO4B 5EU4A 2O72A 3AQYA 1ZLUH 3WJLC 5AVZB 4RQQA 4MJ4A 1WWBX 2VLMD 3DX7B 5FDWA 4NT6B 1QKZH 4RAUB 3W81A 3OLGA 4DP0X 2CKBH 2IGLA 3D18A 2NYYC 4F92B 4N6RA 3OL2A 5FO9A 1WCBA 4LLQA 4GIAA 4EZOA 3U1SH 1KCVL 1ORSB 4DTGL 5LN8A 4OV5A 5GSVA 1CE6A 3FRUB 2BNQA 1F11B 4OLVH 4BDVB 5KVDE 1TZHA 1W8EA 1JQKA 4ZTOL 3UAJD 3MJGX 4HJGB 3Q2NA 3S2CA 3F65A 4F01A 3NSJA 2X9XA 4H25A 4MJIA 4XBPB 3UPAA 4PS4H 2DQ6A 4BCZA 1OTUC 1NMCC 3NJFA 3C5SB 5EULV 5MERA 5D4QA 3MLSH 2COQA 1YYML 2HPOA 5F7MC 2XV2A 3A6BH 1AYRA 2WZ6A 3GXTA 3TA3A 4I2XB 1IIIA 3FT3A 4QNPE 4ZW5A 5KVGL 3LPFA 4W6WB 1KPRA 3AWFA 2P8MB 5T1MA 3RPMA 1CR9L 3MRCB 1YEHL 5L2KB 2ZXEB 1NGXA 3KJ4B 5JZ7C 4MSWA 2YRPA 4FTVB 1SUHA 3H42H 2R56H 3PREA 4ANUA 5I2IA 3D0VA 1MFAH 5CZRA 3UTTE 4RFNB 5LUMA 3AY2A 4FYQA 5JYMA 1H8OA 2ROYA 3QEGH 2JKTM 4J27A 3U4EB 3TEXA 4XXCA 4Y4HB 5F7YC 5JR1L 2UWEB 2WYZA 1AR2A 4MJ5A 3WO3B 3ZL1A 2XV3A 3MBWB 4B3VA 3LNIA 3M17A 2V2WB 5I16B 4ELMB 5TTRA 5T3ZD 1OAQH 3ECBB 1Z9SB 5GHWH 1FL3B 4A04A 1HC1A 1PEWA 2ZOUA 5CWSB 5KYXA 1GGBH 1PZSA 2YD4A 1BOGA 2E27H 4HMCA 4YXHL 1L0PA 3ZTDC 4JFPA 3DGGA 4YWGH 2H45A 3RVVD 3QIWB 1TTUA 4LSDA 2HUHA 3T77A 4L8SB 4EI5D 4GQ9L 2UZYA 5DC9B 5L88H 2JI3A 4PGZA 4N0FB 5DI8A 1JL8A 4PJ8C 1BVZA 5KBPA 2Z8WC 5D1XC 4Z18A 1Y0LA 4ZYKA 3JTSA 2BDNL 3M45A 4DGUA 2DQFA 4PUBH 3VWJA 4PJCE 5DQJA 3CVHA 4ENZA 1Q0YH 2K9UA 5SWQA 1KLGA 1QWHA 4PB0H 1KULA 3BGFC 1ASQA 3T65B 3QH3A 3GBMH 4XHJC 1FNSL 3OKLB 4KRPD 4Z76B 3D2EA 3OB0K 4HZAA 5E6SB 1SM3L 3MR9B 1V3JA 3IM1A 3N2JA 4J3OG 1BQLH 3T6VA 4A2MA 3GBDA 3G6AB 4HWEH 4U49A 1LP9B 1MI5A 3V0IA 3WS6A 5K39B 3ZTCC 1XF4A 5JTWA 2AQTA 3DUUA 2XFXA 4TULH 1WBZA 2X4RA 2YIBA 3IS1X 4WHTB 5HI4D 3SKUD 3KGTA 3NJNA 3QXDB 3UX9B 5I19L 4FYTA 3VGFA 3VSQA 1H3PL 3RFZC 4IOSA 4NKDB 3UPCA 5DJAB 4I88A 2GTWA 4YHKH 1UGNA 2X4SA 2C9VA 2K7PA 3NRQA 4JY5L 4KY1L 4ONOA 4AG4L 4AQ1C 4HUXB 4AW4A 3Q1SH 3QDMA 4HCIA 5IFHH 3FU8A 3PWJB 1Z2KA 2WXPA 1OAZL 3IBEA 3HE6B 3MNZA 4H2CA 4OFQA 2WHVA 1OE3A 1X7QB 1INEL 2WJ7A 4X7SH 3L3OC 4AOFA 4HOZA 1JZ5A 3V4PA 1VGKB 3PHOA 5DQ9A 2WINM 1AI1H 3HZMB 2VKWA 3S36X 3DSFL 1EVTC 3UJTH 3WIIH 4LL4A 4C56E 4W4OA 1I1AB 2C1PB 3OKKA 5B7MA 1F6AB 3VI4F 5BNXD 3BKML 2WNKA 5IT2L 1XTLA 1COBA 2HLAA 5FOBA 5JPNC 2ITCB 4PRDB 4DQOH 1FZMA 5JXED 4ZK8A 2R23A 4G71B 3IS0X 2VDOL 1CIDA 1MHHB 1TNNA 2XZZA 4YDZA 3P3SA 5I1JH 1GXEA 2WXQA 4O00A 3ULAB 1NBQA 1CB4A 3QXUA 1QFPA 3FCSB 1B0WA 2F7IA 2FWOA 3VFNA 2BNQD 3GSVA 4XPBH 3FTYA 3EFOA 3RYMA 1AD0A 4UU9A 1Q0XH 2GFBB 2CDGB 2MFNA 5AB9A 4YL4A 5K9JL 5DHMC 4GEJA 4AGNA 4L9LB 4PJFB 2MHAB 1TR7A 5FWQA 2BFVL 4MJID 3TH4T 2DQTH 1A9VA 4NUGH 1NOLA 3U2IA 5CEZH 4HD9A 4TTDD 1UOLA 3S34H 1FNHA 4B41A 5D7JB 1FFQA 2Q7NA 3LN5B 1ZLWH 4H0IA 2XQBH 1CPUA 4ZMNA 3GKZA 5CR1A 1JVLA 3TA3D 1U8NB 2JCCB 4UINH 5KSBA 2C5DC 4OAWB 4M93B 5GGQH 3FT4A 3GNMH 4HIPA 2G0LA 5E6IB 5HHXL 2JLLA 1J9CT 1A6WL 4HAFA 2YLKA 2PTTB 5CM1A 1CGXA 1H5BA 3ZMNA 1XSOA 3MV9D 3A24A 4UNTA 2BSSB 3A3YB 1DL7L 5E9AA 3FRPG 5KYYB 3R18A 4M6NL 1S7VA 3P4OB 4KK8C 4H88L 4YXLL 5LWYH 1B9ZA 2J8UB 1GYAA 2WINA 3R06B 4LCIH 5BW7A 4IYKA 5B39B 3O3OB 1A6VL 1CGUA 4X8JA 3M1CA 3OPZH 3VFVB 4MXWH 3MLTA 4YHML 1HH6B 3PL6A 5J6GB 1THAA 1KCBA 5CINH 4XNBA 3QI9C 1MLCA 4ZMZA 2FQGA 3HOGA 2AABL 1CL7H 3RVTC 2A3TA 2ZX8A 1KJ3L 1WDAA 3O2WL 3BQUA 3DOSB 4KKBC 4PWJA 3WJJC 4BZ1L 1IQWL 4UIMB 4J3UA 2MEJB 4N26A 1S2EA 5HVFB 5EF0A 1HZKA 3TONA 3NK4A 1W0VB 4HCRL 4JREB 1GGIL 4ZDHA 1KC5H 2CNZA 4I48A 4K71C 3Q01A 4P4KC 5AALA 3L4ZA 3CLWA 4NJAH 3BE1L 4NN6C 3REVA 1E28A 1QFHA 4CBPA 2BHFA 3D69B 1M6UA 1T2QL 3S97C 5C2BL 1GZPB 3D4YA 1R24B 1YY8B 2O5NA 5BZZA 4NZ8A 1FFRA 5C9JA 1SVCP 1T04A 1X4YA 2ADFH 1CFTA 3MGOA 4JMXA 4PWEA 2C1OB 1U92B 1FZJB 1J0ZA 4M5TA 3Q0HA 4ZUVA 1JGUH 2ZX5A 4IM0A