1O7DC

The structure of the bovine lysosomal a-mannosidase suggests a novel mechanism for low ph activation
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
GDSAPLNEAMAVLQHHDAVSGTSRQHVANDYARQLSEGWRPCEVLMSNALAHLSGLKEDFAFCRKLNISICPLTQTAERFQVIVYNPLGRKVDWMVRLPVSKHVYLVKDPGGKIVPSDVVTIPSSDSQELLFSALVPAVGFSIYSVSQMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Lysosomal alpha-mannosidase
publication title The Structure of Bovine Lysosomal Alpha-Mannosidase Suggests a Novel Mechanism for Low-Ph Activation
pubmed doi rcsb
total genus 38
structure length 150
sequence length 150
ec nomenclature ec 3.2.1.24: Alpha-mannosidase.
pdb deposition date 2002-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.50 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Glycoside hydrolase family 38, central domain 1o7dC01
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1o7dC02
1NOFA 2DIEA 4AEFA 3LXBA 1EO7A 3EDKA 2WCSA 3GXNA 4AMXA 1KWGA 4CGTA 8CGTA 3VGDA 2EABA 4WSJA 1W9XA 4AIEA 1T0OA 1DEDA 1L0PA 5DO8A 1JL8A 3HG4A 5E0FA 3CZGA 3AMKA 4JFVA 1Y7VA 2C8NA 4U2YA 3BUPA 1XH1A 3KWXA 1U33A 4CKQA 2OW7A 1EHAA 4UNIA 3W37A 3WY4A 3WENA 1HTYA 2FHCA 3VSVA 3HG5A 3GXDA 3KE0A 1WE5A 2ZX5A 4GO8A 4JFUA 3EJTA 1OGSA 1KBBA 4J3UA 3ZOAA 5HPOA 1XCWA 1KXTA 3S2CA 4GIAA 6CGTA 2BY2A 1MWOA 1XGZA 1HL9A 1IV8A 4FNUA 3LPPA 2WNWA 3HJEA 1BSIA 3UCQA 5A6MA 3BLBA 3IJ9A 5E9AA 2G3MA 3L4YA 3L4XA 1KWKA 5EMYA 3CPUA 2BY1A 1UD3A 3DDFA 1UD5A 4B9YA 1XSIA 5CLTA 2ZE0A 1WPCA 2WKGA 1OT1A 1JI2A 3EJUA 3WMSA 1ZS2A 2QLYA 3FAWA 2F7PA 1HX0A 3LPOA 2VRKA 4J3WA 4KWUA 4DO5A 2CHNA 3L4VA 1UKSA 2D3LA 2FHBA 2ZX6A 3VGBA 1BG9A 5A2BA 1U2YA 2Y2WA 2OW6A 1J0HA 4U2ZA 3WNLA 2E8ZA 4GQQA 4CN6A 2PWDA 5CLWA 1CGYA 4FNQA 3BAJA 1GVIA 4WF7A 3CZEA 3DX0A 3KLLA 1MW1A 2E8YA 2NSXA 3BVVA 2XIIA 4PSPA 4U33A 1KXHA 1AQMA 2D3NA 3TTSA 2YA0A 4JCLA 4AYGA 3A4AA 3WDHA 3DX2A 2F61A 2WKLA 4B9ZA 1JIBA 6TAAA 1UASA 4CN4A 2BHYA 1XSJA 3IK2A 2OSXA 1HXKA 1J0IA 3H55A 4WSKA 4UOZA 3EDJA 1BVNP 2QV4A 3S5YA 3CZSA 3ZSSA 1E40A 2CXGA 3BUIA 2AAAA 2EEXA 1PPIA 2YOCA 3BAKA 4JFWA 2XVKA 4X0NA 2PWFA 1TQUA 3ZSTA 4HOXA 2QMKA 1XD0A 3KL3A 1HNYA 4NXSA 1JXKA 3VO0A 1R46A 1QPKA 2OYLA 3CZLA 3VMOA 4WLCA 1P6WA 1AQHA 3WEMA 4BZYA 2E9BA 1XV8A 3UG5A 5I24A 1R33A 3ECQA 3TV8A 7CGTA 4NZFA 1BVZA 1CXKA 2PWHA 4UQAA 1DTUA 4OGZA 5A2AA 1CDGA 1J0KA 4MB1A 1B2YA 1E3XA 3L2MA 3WNNA 3OLEA 5DFAA 2VNCA 3CV5A 3GXIA 2FH8A 4NXKA 3TONA 1MVYA 1JD7A 1QW9A 1WZKA 3BUDA 1VFOA 2WVTA 1MFUA 5I0DA 5HXMA 3WDIA 2CPUA 2Z1KA 3WNOA 2ZUVA 2QPUA 3BMVA 2BXZA 4FNSA 2XN0A 3WNMA 1PEZA 2G3NA 3D4YA 1VJSA 2WSPA 3DX1A 1OB0A 4JL2A 3WY3A 2XWDA 1KGUA 4JFSA 3GXTA 4UQDA 4LQ1A 4NX0A 3K8KA 3BSGA 2ZXAA 5HDRA 1CGTA 1HVXA 1KBKA 4JFTA 3DHUA 3KEHA 1V3JA 3A23A 3L4UA 3L2LA 3H53A 3VGHA 3D50A 3LXCA 3L4ZA 4TVUA 2D0GA 3DDGA 4FNTA 1QWNA 1BAGA 3ZT6A 1KGXA 1XH0A 3AXIA 1TQVA 1IZJA 4OKDA 2BHZA 3UEQA 1KXQA 3WNPA 2ZICA 3BUBA 3VU2A 1JGIA 5A2CA 4JCMA 1AMYA 3BMWA 3AJ7A 1JFHA 1EA9C 1CGXA 4GQRA 2D0HA 2YKKA 5I23A 3LVTA 3HZ3A 4UCFA 3WELA 1KTCA 3ZR5A 4UZUA 1XCXA 1R47A 4GO9A 1SMDA 2DH2A 4J28A 3BVXA 1VB9A 3D4ZA 2VR5A 2D0FA 3DC0A 4X9YA 3GXMA 1D7FA 1RPKA 4AMWA 3VM5A 1SMAA 3D51A 3GXFA 2DIJA 4M8UA 1QI3A 2PWEA 4FLRA 2ZIDA 3KLKA 3II1A 3HG2A 3VNYA 2WVUA 4NI3A 1RP8A 1HWWA 5CGMA 1DHKA 3EJSA 3CTTA 1CGUA 1A47A 3LXAA 1PIFA 2XIBA 4PEEA 1MXDA 3VNZA 2GJPA 3EDEA 1U30A 1QX1A 2V3DA 1QW8A 2VUYA 3HG3A 3VMNA 3WNKA 3M07A 1R75A 4GKLA 3EDDA 4M56A 3K8MA 3DX3A 1IZKA 1H3GA 2VT0A 2EQDA 9CGTA 1JF5A 1OSEA 1TQSA 4UQBA 2WC7A 1VFUA 4U3CA 1JI1A 1UKTA 1QI4A 4HOZA 4UQEA 2EACA 3FAXA 4KMQA 3AXHA 7TAAA 3VGFA 1NM9A 1EO5A 1M7XA 2ZX8A 4FNRA 2F7QA 3WY1A 2BY3A 5CXPA 4JL1A 1CXLA 1CGWA 4H7VA 1TMQA 3KL5A 2D73A 3LRKA 1WZAA 5A6LA 1BLIA 2VRQA 3BH4A 4FLQA 2WANA 1UD8A 2BY0A 2C7FA 3CZKA 4DO4A 1WP6A 1B0IA 2ZUUA 2F1BA 3CC1A 3MI6A 4U31A 1E3ZA 1Q4NX 1C8QA 2WVVA 1VIWA 4UOQA 3CGTA 3UERA 2F7OA 1ZJAA 3ZQ9A 2F7RA 1LWHA 2XVGA 2YA1A 3GBDA 2NT1A 2Y24A 3EDFA 2ZX9A 3FW6A 3RIKA 2ZX7A 3S5ZA 3BLKA 1UD4A 2V3EA 2XN2A 1EH9A 1UA3A 1VFMA 1RP9A 1CIUA 2Y4SA 1R34A 3VSTA 3WEOA 5KBPA 2WCGA 4PCTA 1CXEA 1E43A 4AIOA 5CGTA 1AVAA 1QHPA 1ODUA 5I5RA 2J25A 2ZXDA 3LRLA 1JD9A 3ZT5A 1Z32X 3RILA 2ZUWA 3L4WA 1KB3A 1QWUA 2ZXQA 4UZSA 3QGVA 3K1DA 4H8UA 2X2IA 2YA2A 2QMJA 4BA0A 2X2HA 4HP5A 3IJ8A 4CVWA 1JXJA 1KXVA 1TCMA 3WN6A 2NT0A 1O7DC 3AMLA 1G94A 1UOKA 5BRPA 2F1AA 2F2HA 2Y5EA 4J3SA 1M53A 1UH4A 3VGGA 2OSYA 3GBEA 1S46A 3ZO9A 1V3MA 2GUYA 1KCLA 2ZWYA 4AYSA 2GVYA 3IGUA 1GJUA 3BVTA 1JDCA 3DX4A 3BAIA 5E6YA 3A24A 4DO6A 2OYKA 3A22A 1CXFA 3BSHA 2XN1A 3VMPA 1XH2A 2XVLA 3TOPA 2YIHA 2FE0A 1BF2A 3GXPA 1UH2A 4HOWA 2EO7A 4J7RA 3VX0A 2YJQA 1QI5A 3VSUA 1G1YA 3WDJA 2YFNA 5KEZA 1UD6A 3VM7A 1WZMA 1BPLB 3BAXA 1CLVA 2WYIA 3W38A 1LWJA 2OYMA 1CXIA 3BVUA 3BAWA 4MAZA 5E6ZA 4QAWA 1UH3A 2QPSA 2TAAA 2IGTA 1CGVA 3EJRA 2E0PA 4GINA 1V3LA 4H8HA 1CPUA 4PCSA 4XB3A 4J27A 2EJ1A 2EAEA 2YFOA 1UA7A 2D2OA 2GJRA 3LRMA 4W93A 2ZUTA 4AEEA 3GTNA 1XSKA 1CYGA 3EJQA 1PJ9A 1MXGA 3L4TA 1MW2A 2BHUA 2AMGA 4AW7A 3OLDA 2WVVB 2ZWZA 1MFVA 3IJ7A 3A21A 1WZLA 1VAHA 4FMVA 1QHOA 3LX9A 4J3TA 3BCFA 1JG9A 4LXFA 3KL0A 4UQCA 3A6OA 2BXYA 3UG4A 2F18A 3UG3A 1JF6A 1V3KA 4FLOA 1JDAA 2ZUSA 5E70A 3EJPA 2FH6A 2ZXBA 1G9HA 4H2CA 2DH3A 1PIGA 2FYVA 1MW3A 3BAYA 3BVWA 2WYHA 1G5AA 3BUQA 1CXHA 5E1QA 4CN1A 2X2JA 3ZT7A 1TQTA 1KTBA 1SZNA 2WSKA 4J3VA 2FGZA 5F7UA 1GCYA 2E4TA 4GI6A 3WY2A 1KGWA 1WO2A 3BLPX 1D3CA 4E2OA 3H54A 1UKQA 4OIFA 2FHFA 3VGEA 1O7DB 4HPHA 2WPGA 1PZ3A 1XD1A 1GJWA 4HA1A 1JDDA 1KCKA 3DHPA 2ALWA 3OLGA 3OLIA 3TTYA 3BC9A 3VX1A 1TQWA 3CZNA 4NZJA 4FNPA 1J0JA 2WVSA 4OJYA 4FLSA 3WFZA 2PWGA 4GI8A 1OT2A 2V3FA 4PSRA 2OSWA 3D52A 1HL8A 1HT6A 5TD4A 2XWEA 5BRQA 3A47A 1MW0A 1PAMA 3CLWA 1I75A 3ZR6A 1ZJBA 1JAEA 2EADA 4H8VA 3BCDA 4J3XA 1PZ2A 3K8LA 4ATWA 4LPCA 1UD2A 3A5VA 1PS3A 4UQ9A 4GI9A
chains in the Genus database with same CATH superfamily
4KRPC 1AZZC 4U6VH 4ZTEA 2NY6D 3O3NB 3J07A 3THML 2FL5A 1EIBA 4OY9A 3E8UL 3E7JA 4C4UA 2CDEA 1DEDA 2GBTA 4PJXB 1ZVSB 3WLBA 5H37G 2ZOTA 2CHDA 2GJZB 4L4VE 1MIEH 2VL5A 3SJVB 1JZ7A 5I1DB 3BUPA 3KWXA 4QXWA 3CSGA 2RIKA 4S1RL 1FZMA 3CIQA 4GSRA 5AYUL 5I71B 1CJYA 3FO2B 4FQIL 1BQUA 4PJ8D 3C5SB 2JKXA 1YUHA 1KXTA 2HJLB 1X5AA 1PF3A 3K81A 3L3GA 1XH3A 5FM8A 2A6DB 3LEVH 2EIEA 4N87A 5I6PA 1Z9PA 3QWOA 3LPPA 3D18B 1AZVA 2EVGA 5IREA 3DGDA 4N2GA 2X2UA 2VC2B 1BSIA 1DBKL 2QVFB 4MVBC 4GAJH 4DVRH 2ZSVA 4LBEB 43C9A 4W81A 1E4XH 4GEIA 1MIMH 3CSFA 3V8OA 2G5RA 4PM1A 5ESVB 4NCC2 4OM0L 2VZ1A 4EZSA 3L4XA 3ZX1A 4ESKA 4ZFQA 2BIQA 3CPUA 4LNRB 3IMSA 4EIUA 4HIIB 4LPTA 5KWYC 4FN0A 4N2IA 3TBVB 3IFLL 4JM2F 1SGKA 3G6AA 2BJML 2YUXA 7PCYA 2CO6B 2D4CA 2NYYC 3RZCB 4I1QA 1KEGH 1G4RA 4XMPH 4N8VB 2XHNA 4FDWA 4KZEH 5IEHB 3VWJC 4G43A 3PS6A 4H1LB 1U2YA 4NC1E 1VEOA 5I5JA 1J9TA 4U2ZA 3RUGF 4P5MB 1JWMB 3WNLA 3JTTA 4QLWA 1PLCA 3V4PA 2WJ5A 4EQ3A 5ANME 2VO8A 2DWEA 4ATMA 5HGAB 1IFRA 5T5FL 2YA0A 1C5BL 2DICA 3BGMA 5FYKL 1GS7A 4AQ1A 4Y1AD 2FJUB 1GN9A 3R4DA 1BQSA 5KVDH 1L5GB 3H3PL 5DMJB 1DJXA 1S4IA 1A9BB 2JELL 2IPTH 5JOPD 2QHLA 1T5XA 2OMUB 4G8GB 1II4E 4J39A 5B1KA 3I9AA 4IIQA 4X5LA 1JZDC 1FNEA 3TBSB 4E9XA 1ZWIA 5LGHH 4ZMPA 4QHPA 4X99B 1TVHA 1U93A 1X9QA 2DYPB 4YZWA 4JKPL 1S7WA 3MVSA 4L1HA 3CJJA 5GS2D 2AMUA 4OVUA 4DAGH 3ARFC 3JV6B 4AZGA 3S34L 5E6UB 1AKJA 2AK1L 2H8PB 3J8F7 1XGTB 2Z7YA 4WV1C 3P77B 1R33A 2X4NB 3FQNB 4CILA 2OK0L 4OT1H 4QOKB 3GNML 5D7KD 3QNIA 2P44B 1BP3B 3CZJA 5GXBB 1KCUH 2DM3A 3BYTA 4G6JH 1RULL 3UTOA 3L8QA 4FFZH 4K3DH 3GI9L 4LRIA 4U1JB 3TVMB 2HKAA 4D0CB 5IKCB 3R4RA 1I1AB 3KNBA 3R0MA 4MNGB 2HA1A 1X5KA 4WW1B 3TONA 4DP0X 4TNVK 1A8ZA 3IGAB 1BZ8A 2ZCKH 1VFOA 3F7VA 2CIIB 2JNSA 3N44F 4XO8A 5I0DA 4HBQA 3L08A 2YL9A 4R5IA 1D9KD 1G1CA 2B77A 3K5SA 2BNRA 1INEL 4H0LC 3U7WL 2HT3D 4Q7DA 1XWVA 3L13A 3QFGA 3MFFB 1OA0A 1QAWA 3GLAA 5L88L 1J5OH 5K5YA 3GHEH 2CMRH 2JTYA 5DEFB 2CDGA 4CU8A 5I5MA 3BGAA 2QEJA 2D0GA 1PEWA 4A2GA 1A21A 4R5JA 4YFLI 1TYRA 2K3TA 2IDTA 1CLCA 1YUKB 3AT9A 4G6QA 1Z9MA 1DVSA 3QULB 3NEXA 1YYLH 3RB7A 4O2EB 3QNXA 2B1AL 2UZPA 3VU2A 4DK3A 2E74C 5DD0H 5A2CA 4AYFA 5AALA 2F08A 5BRZE 3FCUB 1HIML 3FT9A 3C12A 3UJIH 2ED7A 5KJ7E 4PW3A 3PWNB 4XMKH 3GTTA 3IJEA 4UQ3B 5D2NB 2ZG2A 5I75B 4DHLA 2BWDA 1UT9A 3PJSA 2A2QT 1P69B 4PRIE 5AAWC 5EO0B 3R1GL 4H0GA 5HYFA 4DKAA 5GS1C 4AGQA 5ITBH 3DURA 2UVFA 4MQXD 3BO8A 2WD0A 4M48H 3S4SA 3WD5L 4JMXA 2NR6A 3BN9C 2VLKA 3ML9A 3HG2A 5E8DH 3V5KA 1HXMB 4WWKA 1OPGL 3PDGA 4NNYA 35C8L 1HI6A 3C08L 4P59L 5I9QC 1SQMA 4UAOC 3AQXA 3O8XD 5D2LE 3CX5K 4BFNA 4Q52A 3SYVA 5LWYL 1SHXA 4J3OC 5IHBA 5A2LH 1ORQA 1QA9A 1RIHL 4FTVA 1SEBA 2GTZA 2KQNA 4HQQL 1IAKA 3RPMA 4UQ2A 1PSKH 4MB4A 9CGTA 2HMIC 4FG4A 5E7FA 2B5IC 2R15A 1GNTA 3B51X 1JNHA 5ID1A 2QT6A 2WQ8A 4UBDD 4GJTB 3W11C 4R96B 5E94A 5MEQA 1RSYA 1WFTA 5JORB 1Y1UA 1JGUL 2WOBA 1UD8A 4H25B 4YO0A 1IBYA 1UOLA 4BH8A 5HYSG 2WLJA 3DGGA 5CUSL 3FSZA 4XVJL 5I1JL 3VI3E 1YJDL 5HDBE 5B38A 1Q4NX 2MPAL 1Q9LA 3NJKA 4IOSD 4HD5A 3IS0X 5FDWB 3HI5L 3K6IA 1I31A 3ARPA 4KNSA 4LCIL 5E5MA 3P4OB 1TJMA 2IV9A 3APNA 4WFHE 5IB2A 5JLZA 4KVCH 4KY2A 4NC0B 2AQRA 1L0QA 1A6ZA 5ABZA 4D9LH 1QFPA 2LV4A 2NW2B 3GSOB 1NCGA 3DUSB 4GRLC 2VC2L 3TO4A 1J8SA 2Q86B 1JZ4A 3RNQA 3OX8B 4L4VD 2CG9X 5DC9B 2WNGA 1EV2E 4ZFOA 2B4CC 3OB0H 5JOFB 5DLML 4KKBC 1KBGH 4MFHA 4OCYH 4XVTL 4YGVB 1QFOA 1KB3A 1CK0L 4UZSA 2WM0A 4JHAL 1G6RA 2X3BA 1S6NA 1ADQH 4PTTA 1T4KB 3SY0A 3NDZE 3VFRA 1X7TA 2Y3NA 4JBSA 5GGUA 3L9EA 3MRDA 4YE0A 3C5ZC 5IW6A 3C8KA 1JP5A 3I85A 3H7LA 1V55B 4XBMA 1P5VB 1J5DA 2F1AA 3KHQA 3QJZA 5C7XH 4J3SA 2HFEB 4AZ7A 4N90D 4DEPC 2OSYA 1TQCC 1IC1A 3DIDA 4KOBA 4WK0B 1YNTA 4J3OH 5T5NF 4EDXB 5EOCH 5IR1B 2GUYA 1X9RA 2XV6B 5EOTB 3KPRA 1L4IA 4S1DC 1KCLA 5IVZB 1CE1H 1Z0MA 4RH4A 2X1QA 3HAHA 4LARL 5BQ7B 5CEXB 1CUOA 5SX4H 4K3GA 2R69L 3S3JA 4JWEA 1LHZA 2FYYA 2WTRB 1KBWA 3S36X 2XXFA 5FCUH 3VMPA 2DM4A 3MBWA 1Q0YL 4NHUA 4S11A 4ZXBA 5HHQB 2FE0A 4W1TA 3U6RA 1RU9L 2EE3A 1H6TA 3VSUA 2XYCA 3ZBMA 1E9OA 1RZJL 1UD6A 2VM4A 4WI4A 4RAUB 5IVXF 4QJ5B 3CNKA 3CUPB 4RFEA 3QQ4A 3TXAA 3L3OB 2QQLL 4XPGL 4X6EB 2OYMA 2IMNA 5C0DB 1D7CA 1HHHB 4TSAH 4E5XA 1CGVA 3EJRA 2D7NA 3HN3A 5LAPA 3TT3H 5JUEH 2JWYA 1NMBH 4NUJB 1NCCL 3MUZ1 3HE7B 2ESVA 1GZHC 2O6EA 2VISA 2IADB 3FB6B 3QUZC 3JVGA 4TQIA 2BS8A 4O02H 4XHJD 4F7TA 4KPHL 3WS6A 5CBAB 4LHUB 3GTNA 1BBDL 1VZIA 1BW8A 2PTTB 3PABB 1NGPH 2E86A 1U8QA 2F15A 2D7TL 3MXVL 1K4DA 2DEWX 3FQ2A 3QDJE 5J57B 2QV2A 4XCFL 3A21A 5FDYA 3JUYA 4M6OL 2D03H 4LCVA 3GLZA 3QXVA 4K9EL 1PFCA 2DQCH 2ROXA 3U79A 2HG5A 1KBPA 4WUUA 5ANMB 2DZEA 3MLWH 5D4IA 3TURA 3BFOA 3HZMA 4YUEH 4BZ2L 4EN3D 1BA9A 3VXQA 1S8DB 1ZYLA 4RFOL 2B4CH 2NY4D 4TUKH 5CP3H 3O9WD 4Y8DC 5GGSY 2WQSA 2GEQA 1G7LB 4IRSA 1KZQA 4IDJH 2IFGA 1LQ7A 2CALA 2AQNA 2FZ3A 3BISA 3ERXA 1EVUA 2X2JA 3SCMC 2PR4H 1GYUA 2ZAIA 3HFMH 2E4TA 4LU5H 3Q1SH 1BREA 3LZPA 2CO7A 1UKQA 3KVDD 2WUBL 4WTWA 5FYJU 1QEWB 3LN4B 5TH2B 2LM0A 4P57A 2WPGA 3P73A 3B2PA 4GPVA 1P53A 1CE6B 4E9WA 1JUFA 2WXNA 1T0MB 1NOLA 1UWFA 4LKCB 3TBTB 2VDNL 1N26A 2Q8AL 4XBPA 2GUOB 1CGSH 5E1GA 5FF6A 2K3HA 5DJXA 4JRXE 1PYWA 3X1FA 3BFQG 4WFEE 3OKLA 3KS0H 1K85A 3CSTA 1MF2L 2CKBH 2WZ5A 4ONHA 3EOBA 5EBLB 3APDA 5CFAA 4MD0A 4DGVH 4HCGA 5DJDB 3FO9A 4ORGA 1I75A 3NUKA 1K5NB 4AZ8A 1E90A 3OF6A 5GZNA 3MQIA 5FIEA 1PFOA 5DJYB 1SHWA 5GJTL 5EF3A 1PZ2A 3HLAB 1ITBB 3PAYA 4N8PA 4KKZA 5C3IA 4PRAA 5DEGA 1BVOA 1ROCA 3MRJA 5CJQH 4JG1L 2AAVA 1IGTB 5HJBA 3TU6A 3VVWA 4YZFF 3REVA 4ALAL 3RWDA 1KGIA 3L3KA 4F7CB 1SRDA 1DJZA 1YPZE 2NY1D 4HBCH 4KK9D 2YD5A 1EHLL 1UVQA 3ECWA 3U7YH 5KW9L 1R19A 3Q5TA 2VXTH 3QZWA 5AW1B 3LV3B 2HP4A 2C8NA 2AITA 3IRPX 2LFEA 3QFJE 4XNBA 5BRZD 3QIWD 3GMLA 4FADA 1F4XL 1MFCL 3GSVA 4AL8C 2D7PA 4UNIA 2A9MH 5CINH 1F1GA 1XF5A 2ERJC 4WUKL 4JQVC 5J06A 1RQ5A 4G8IB 4JQIL 3SE4C 3EYUH 5HDQL 5AAPA 1TZIA 1N5AA 3V95A 3T2NH 4U1LB 2ZKHH 1TJGH 4PRID 3TJHD 4UT9H 3DO7A 4NIKB 4YDIL 4QRTA 2VMCA 1BV8A 2DN7A 3FOLA 3IDYB 4FHJA 3WLWD 3PDDA 5BRZB 2ATKB 3LH2L 3RTLA 4X9FA 1FH2A 3GZPA 4L8BA 2V17H 3BW9A 5DJ0B 3K0YA 1SM3L 3ULVE 4IKJA 2AQSA 3OZ9L 4G5ZH 1TTBA 4UDUA 4YDVB 3QUYD 4Z78B 3K91A 2I9LA 4HF5H 3CU7A 1SJVA 1TG8A 2DYRB 2QQNH 4HGKC 4AVIA 1P7KA 3L1EA 4OIAA 4UT6L 1AANA 3FRUB 5JXAH 4PN6A 2IDQA 4PJ9C 4W9GC 4N8CH 3D3VA 4ZNEA 3WMSA 3KPQA 3FAWA 3APFA 4C47A 3CMOH 3PV6A 3LKOB 3CVCA 1A9EA 2B14A 5D2LB 4GQ9H 4IBLT 5LXGH 4PJCA 3UAJA 3Q3GB 4LEBA 5DJCA 1UB6A 2W9DL 4FKHA 4OZIF 4CN6A 3AS3A 5KN5B 1S5IH 4RA0C 1HZLA 2VMFA 2W91A 1R3KB 1WT5A 4PLOB 5GRXG 1ETA1 3SDCB 4A1RA 3FPXA 4AVMA 2V5YA 1NCBH 1C5DB 1S7QA 2MKLC 4OV6F 1OTSC 4KKAC 5ACLA 5EF1A 2R0ZH 4U33A 3RWGB 3CBJB 3EHBD 3NFPA 3TEWA 2ZD0A 5BW7C 1I4FA 1I9IH 4PJIE 5HGDB 5LVEA 2WKLA 1M9WA 1U91B 1BG1A 2W94A 2QSTA 2K78A 2MCMA 4LVOB 4ZPTB 5HI3D 4FXGC 4QHUA 4JN4A 1X9UA 4KRPB 3O3DB 5HHPB 4HV8A 5SX5K 4EZVA 2FO8A 5E99H 2VM9A 4P3DA 3HS8A 3TA3C 1A14H 1IAII 2C4FU 3UZQA 4P05A 2YIBA 1NPUA 3LIZA 3H9HA 4N2NA 3KPOA 3O41A 3VI3B 5I1IL 2P7TB 4TS6A 5HDBB 1B90A 4HU2A 3GXUB 1MJUL 1EXGA 5A2FA 1QPKA 3REWA 2OYLA 2GITA 3SO3B 4PFEA 1E4WL 5F7DA 5F9OL 4IJ3C 5BV7C 4XMWA 4MRCA 1H9VA 2N3KA 3VVVA 1XIWA 2QKIC 3TIEB 4C83A 1USQA 3BEVA 1WVZA 4PREA 2MWCA 4IMLA 5T1KA 5MEOA 2B59A 3VXPB 3QDGA 4HKJB 5ADOH 3MOAL 5IFAL 2IO5A 3PWJA 4M7LL 4OGAD 1LEKB 1KIUB 4LGRB 4NBZB 2F53E 1KMGA 2X89A 1A5FH 4Y2DC 5ID0A 1QW9A 3VWJD 1WZKA 3C60D 2ICEB 2EDQA 2OPCA 1FO0H 1KTLA 3N9GL 5KYWA 1SOKA 4X7SL 2PYFB 5GRJH 3FH5A 1Q90A 4HCRA 1J5CA 4YLBA 1ZXQA 2EEBA 2VDKB 4Q0XL 3V0VA 4K3JL 2ZNXA 5E00A 1DANT 3TFBA 4AK1A 1QSEE 2ZXAA 4JO4H 4ZS7L 4PWHA 3CFMA 3ABLB 3OKEB 4NKDA 3DX9B 3JYBA 3OWRA 4YAQB 3MRQA 1HZHL 1UYWL 3L4UA 2P3YA 3VWJB 4AEHL 1EANA 4JFPA 4ZBJA 1EO8H 2VR9A 3KAAA 4ODWA 1QWNA 5DU7A 4G7RB 2GJ6D 1RUQH 2JKWA 4LFHG 4C59B 1F1DA 2E6QA 5J1AB 3T0EA 4JFYA 3RRQA 3W39A 3UTSD 3BQUA 4HS6B 2KQMA 2IH1B 3K6OA 3FB5B 5D4HA 4KHTH 4ZSOA 3G6JE 1NINA 2Y6SC 4PRBB 2V2WB 2BP0A 5DK2B 1S7XA 3WEAA 2D7MA 4PJGE 3WXVH 4FHBD 1MSPA 3C5JB 4XVUC 2XSKA 3PL6C 2PXYC 3KM2A 4FQCL 3ALXA 4J28A 1XDTT 1AG6A 3QDJD 4FG2A 3SGDI 1ZPLA 3UGXA 1R9FA 1VEMA 4MA7H 1DJHA 4X9YA 3US9A 3WFHB 4BSWB 4AH2A 3S37X 5E8OA 4N5ED 3ZZLA 4JO2H 1JV2A 1SMAA 1XCTB 3T2LA 2PWEA 4FLRA 4PLKC 4XAWL 3T0AA 1GL4B 3HG0A 3QR0A 2DQHH 2DEXX 4N1HB 5ADPH 1AMXA 1F4WL 4J12A 4WU7A 1GOHA 1KTDA 4LF3B 5BV7H 1KCRH 2L7UA 3ARFB 5TE6L 3UZVB 2RCSL 2OX5A 5ENWB 5K1NA 3QDJB 3D09A 4PJ7A 1CO1A 1P1ZB 5T33L 4G3YL 3CDFA 3F7LA 4WV1B 2Y7NA 5GGRY 4M93C 4XTRC 4HIEA 4GP5B 2V9QA 3GS0A 3ARBD 4N9GB 3BIBX 4Z3IA 4JFHE 3RVWD 1X6NA 2CM5A 3PE9A 1IVTA 1WHPA 5HHNA 1SBSL 3U36A 1P4LB 1J1OH 3B3IB 3Q5YA 2AXFA 2V9UA 3RY4A 3Q7JA 5DUBB 5T1MB 1OP3K 3VFUB 4MMZC 3CQPA 4U6VL 5K9QG 2DYSB 5EZJA 3QR2A 4JRXD 4NN6C 4WFED 4NOBA 1YEIH 3OBAA 4XT1C 4ORZC 4M4RA 4H8SA 3F5WA 3NIFB 2PP7A 4FLQA 4OCSL 4D8JA 5EU7C 4EI6A 3VEBA 3QEHA 4JRYA 1B0IA 2F1BA 1MIEL 2E7DA 3NJJA 4XPBL 2NQDA 1PKQE 2JTDA 2GSGB 1VIWA 4GLRI 2EIKB 3IDUA 2DWDA 4LIQE 4HD9A 1D6EB 1T03H 3O45A 4ONOA 3TP4A 3I74A 4R5GA 3JT0A 5DO2D 5I1KL 3BRDA 5KVGE 1I4LA 1FIEA 4JRXB 2AGJH 4TLTA 5IEKB 1NKOA 1GY1A 3HZKA 1UJ3C 1JF1B 4XPAH 2JF1A 4J4PA 3LEVL 1XXDC 5CCJA 2GPZA 1DO6A 4IM2A 4NJAH 2AXGB 5FA3B 2MTAA 4ZFGL 1JGLH 5L8KB 1QHPA 5L2KE 1XMWA 3OQRA 4YFEA 3QFJD 5EUKA 4GAJL 4R83A 4S10A 4Y1SA 4WK2B 3L3JA 1KXQE 3ASOB 4MHHG 3HI6L 4OGXH 3OSVA 3UPAA 3WS3A 4CDGC 5A2KH 4QRSB 4K8RC 2R29A 5K9JL 4WW2A 2J5LB 3Q44A 4H8PA 3RDTD 1I1FB 1GW0A 2C3VA 4WPEA 1JN6A 1Z9OA 3KM1A 4OCXL 3I02A 1ZXKA 2GG1A 4XNXH 1KEGL 4NQEB 2JCCF 2EKJA 2EYTA 3K74B 5JA8B 1U95B 4ZMZA 5I9QB 5HY9B 5BQDA 2A99A 5LO7A 3STLB 4AYSA 4JNEA 3ULVD 4GKOA 4AJYV 4AQOA 5C0CA 1X6LA 3QHTC 1JVOA 1YYML 3PXLA 4JVUA 4ZQKB 4N2DA 4N4YB 2X40A 4XCNA 3HN5A 2IPKA 2XN1A 1XH2A 4IM3A 1U92B 1X7QB 3GLDA 1NFIB 4N25A 5ICYA 2WXJA 5HHME 2CGRH 1TEYA 5B7FA 3BQVA 4U05A 3V8CA 2EH8H 3VM7A 2B5IB 5CD5C 1WZMA 1BPLB 4UB0H 3B2VL 3MNVA 5LCVA 5JO5A 1LWJA 2I07A 2B1OA 1CXIA 2D7QA 2XXGA 2PLTA 2G4EA 3EBHA 1CL7I 4NT6A 4QAWA 4F5CA 3CPLB 3SDXB 1Z2KA 4MB5A 1LEGB 3WG7B 4LSPH 5DYOA 4IHOA 3ZU8A 2E0PA 4GINA 2ZONA 4HWEH 4OJFL 1V3LA 4C8XA 3UTPE 4AZUA 5MI0B 1JPSH 5DJ6B 5KUKA 4NQXB 4HAKA 3M88A 2A74C 2VAAA 4XB3A 3FH7A 2ZXEB 5IJVB 1LE9B 3VFPB 3NZ8A 4W6WB 5FOBA 1FDLH 4IWOA 4DAGL 2YXMA 5D6DC 3QQ3B 5KG9B 1UZ6F 4TUUA 3CVBA 3UYPA 5IMMA 1NICA 3D85A 2X5PA 4PJHF 3WUWA 4FXKA 4OT1L 1X5IA 1E2UA 1RFDL 4Z7WE 1HHKA 5K9KA 2VERN 5DJZA 4GRLB 3PQYE 3WHXB 4KIKA 2YXFA 5HD8D 4UDYX 2UY6A 4K3DL 1V3KA 3NJFA 1JDAA 1I9EA 4LRNH 4NNXB 2DTMH 4XC3L 2HKHL 3EXLA 5BOZG 1RJLA 3FTVA 1HKFA 3LKSB 2FYVA 4AVKA 2J43A 3JWNE 4K8RH 4WI0B 3QIBA 4S1DD 3VRJA 2ZCKL 4YS4A 4C56E 2VDKL 3VD1A 3HAEA 1KCSL 2YEZB 3BLPX 4P4KD 4CSSA 5EOQH 1RHHA 5KBNC 2ORBH 2UZYB 3C5ZB 4MKTA 2VXQA 3K3QA 2XTJC 4P5TD 2CUIA 3SKOA 3KJ6L 3P9MB 4PWKA 1UFGA 4DEPB 4H5SB 1J5OL 3RJQB 2OZ4L 3GHEL 2X6MA 3OKOA 3S5LA 2F53D 3Q05A 3UX9B 2J12B 4KQ3L 5IMOB 1YMMA 3WFZA 2OXGB 3S0PA 2QR0B 2YK1H 1MQKH 4YH6A 2OSWA 2WB1A 4P4KB 4H0HB 4HG4J 1MWAB 3K2MC 4ETQA 1OW0A 3CLWA 3ER9B 1WS8A 2CKBB 3GBML 2GJJA 4XCCH 3V9CA 4HVBA 3FBKA 4L37A 5E56A 3AS2A 3D4GA 5C0BA 1WDAA 2EADA 2QSQA 4FQLH 3UJIL 1QSED 3H7BB 4XMKL 5M94B 1SJHB 3WAKA 2F53B 4KJPC 4Z7UF 5I0WA 3MACH 1YEGH 3HZYA 4EO5A 4B3VA 2BVYA 4CGTA 3PWPA 1J88A 2X4TB 3D8MA 5H94B 2VLLB 3M3WA 3RVUC 5ITBL 2YAEA 1OIOA 1SOQA 3BPCB 3ATAA 4KJYB 4M48L 3HMWH 3Q0KA 5E1AB 1CD1B 4JKLA 5E8DL 2FBJH 1E6JL 3QUZB 1D6VL 4LK4A 1KC5L 3S8WA 1FZKA 1TVBB 4MB3A 3V0AC 5E8PA 1JZ5A 2H1PL 1A4CA 3HAJA 3ESOA 2NY2C 3KR3H 3KE0A 1WFNA 3E3QC 2W0FB 1OARH 4R0LC 3L7EB 3L5XH 4QRQB 3OKDB 5HHOB 5FUCC 1D2OA 3EZJB 5LGKA 1LEIB 1J5HA 4F57L 2JE8A 2W9EL 5CP7A 4FQQA 4FZPA 1KB9J 1MWOA 2BOBB 3JXAA 3V4VH 4E41E 5IHZA 2NNXA 4N6RA 5ACZA 3MJ9A 4M5YH 1I8UA 2XOTA 3BVNB 3V5DA 1HEJC 3DOIA 3HNTL 5JDSA 4PJGB 3VFSB 4GW1A 1JHTA 2LFGA 4KDVA 1L9RA 3WKYA 3LQZB 3X14A 3D2EA 1R6VA 3O4OC 4NLHA 3TEYA 4HUNB 5AVUB 3ELQA 3SCMB 2G3MA 1XCQA 2BRRL 4XCEB 4YHPB 1EXUA 1URZA 2QBWA 3V5HB 4HIHB 5DHVB 5I82A 3EYVB 3DDFA 1KV7A 2W9LA 4EUPG 1OT1A 5EU7E 5C0AA 3H9ZA 3KCPB 1NKRA 3IJSA 4XX1E 2ETWA 1WZ1H 4U1IB 2E46A 4ERSH 1FIGL 4UIKL 3O3OB 3MRPA 1XR8A 1MRDH 4OLEA 2WIIB 4DUVA 4KVCL 3PDOB 1KELH 4GQQA 1U4EA 2Q6WA 2PO6A 5EU5A 4D9LL 4LQFL 3D39E 3Q8EA 4EIZC 3CZEA 4FI7A 5KSBE 4HJGB 5FUZH 2OL3H 1SUFA 3ILEA 4NO0A 3TO4D 2G0LA 4P2OA 4PRHA 5IM7B 1AO7A 1DKZA 3ZL4H 1A6AA 1HH6A 1MCOH 1PY4A 2D8KA 5EUOA 2X09A 5A2JH 3VD5A 1W72H 4YSUA 2HVKA 2JJSC 4HX1A 4Q6IC 2J8UA 2OSXA 3EF7A 1KN2H 2BSCA 1N4XL 1SDDA 2Q2EB 2AKRA 4LO9A 3TIDA 3B53X 3DUUA 3CZSA 3NQKA 5HSFA 2WMPA 1LJMA 3GGWB 3OJ2C 3LB6C 1WBXB 2WLHA 4A7GA 4R6UA 2IAMC 3QS3A 1EMTL 4HOXA 4EE2A 3O3AA 2DBLH 2X28A 4GG6A 3F7YA 2H9GA 5C7XL 4YXLH 1J12A 1UXWA 4ACTA 4X4YA 4BQCA 1PKQB 2AK4A 4JQXC 2MCAA 3P9LA 4RMBA 1LQSR 3HI1A 3S96B 3WE6A 4H40A 3JV4A 2R0LL 2ROYA 5CILH 5EB9A 4XZ4A 2EX3B 2ERJB 1D5MB 1CFMA 3UG5A 2NTFB 2VTFA 4DKDC 2F5AL 3MLRL 3FCBA 5C0FB 3DX7A 4V2BA 1BVZA 3SN6N 5EO1A 1AR1D 4PJXF 2W65A 5D7IF 2WZ6A 1DFXA 5EBMA 3UEZA 3S8GB 1YN6A 1ETJA 5L2KB 3EADA 4M5ZH 2GIMA 3T09A 1SYSB 1U3NA 4HAFA 4JO8A 3Q8CA 4NXKA 4Z9KB 1MCKA 1LDPH 1N2RB 1P2CA 2XQ0A 4U3SA 5D7LE 5HPMA 2AJZB 1N64H 2YLHA 1EJ6A 3EO0A 4TSAL 5HHXL 2RB8A 2CPUA 5JUEL 3VG0H 2KKQA 3TT3L 3GMRB 3JV0A 2ZUVA 4GOSA 4O2CB 4LCUB 3UADA 4FQ2H 1FO0B 3D4YA 1VJSA 2ESVD 2OTUB 3O4LA 4N0FA 4X6FB 2LHAA 3IWVA 1EFXD 2JI1A 3FQXA 3CDGA 4FYQA 4KKAD 1PZAA 4UIMB 4PJ9B 3K8KA 1JZ8A 1KENL 4B9QA 4DVBA 1HVXA 1KBKA 2XETA 3QAQA 4LLVA 1K8IB 4QO1A 2R9HC 1FFNA 2UZXA 1KN4L 4LP5A 2Z92B 3BGFC 3CC5B 2X44D 4RBPH 4HKXB 1SN2A 4ADJA 4NZUH 1MZZA 3B43A 5CHNB 2J8OA 4JN2B 3FT4A 3J7HA 2XWBB 2D03L 5AG9A 5HBBA 3UEQA 2FX9L 3JZYA 1YEDB 1MFBH 2WBJA 4Y1TA 3TZVD 3MLWL 3UTPD 3BKJH 1GJIA 5B38G 1DBBH 4WEBL 5HHMB 5IROD 4MJ2A 2B4CL 1IGIL 3MRCB 4TUKL 4BV1A 5KYXB 5DVLA 4X2UA 2BP8B 3SPHA 2YKKA 4AW4A 3GMPB 3COOA 2B1HH 2PKDA 4P4RA 3B2UD 4FXGB 2B7DT 2FWUA 4X50A 4Y5YC 4JM4H 3KLHD 1FLRH 5J6GA 3VFGL 1CFNB 1C16B 3O0RH 4XMTA 4KKCD 3TA3B 2PCXA 1WTGT 1YNLH 3TZVB 4DCQA 4G6MH 5INDB 1XGUA 1QI3A 2UWEE 1QWHA 1FYHB 3MKKA 1A6UL 3MRFB 3UTZB 4HU8A 1AXSA 1KB5A 1MAML 4KK8D 4PJDA 4XP4H 5AW0B 3BUTA 2CLZA 4Q2ZB 1WF5A 4R3SB 4MCMA 4XMUA 3PNWB 1MWAL 5DJ2B 1OAXL 4AZ6A 2VR4A 1YN7B 5BV7B 4IBUA 4GMTL 2CKBL 3MJGX 3HZVA 3NAAH 1GZQA 3UIZA 3VMNA 3WNKA 2QKIB 3V0IA 2EZ0C 3P3YA 3MBEA 3DX3A 5AZ2L 1DSFL 1IZKA 2VT0A 1ETB1 5K39B 3RFZB 3PQYB 4I9WD 4DYLA 4Q74A 3MZTA 3RI5F 2AJVH 3QZLA 1VFAB 1TO4A 4UQBA 4JM0A 5C9JA 3WTYA 5B1CA 4IRJC 3CXHK 3N0PB 2R23A 4EIBA 3VEAA 1MN4A 1G0XA 3P0VH 5D1XC 5AEAA 2ZWNA 3KWVA 3U30B 2K8QA 5L6YL 2R1YA 4C56B 2DPKA 4NFCA 2Q76A 2EC9U 4DSYA 4RWHA 3BH4A 2OJEA 3U7YL 2VXTL 5AKRA 1CDCA 2EEFA 1DQDH 3AZUA 3VFWB 5SWSB 1ZE3C 5BJTB 1OTTD 1VA9A 3DVIA 3ZE0E 3HKZA 4XH2A 2YA1A 1IFHH 3E3QE 3OXSA 2AP2A 3ZW3A 1NDMB 3FDWA 5FUCE 2ZKHL 3BLKA 5T3ZD 1TJGL 2OMWA 1UT2A 1E2ZA 5TDOB 4S1QL 1CIUA 5K59F 4YSOA 3WEOA 3BZEA 3M6DA 3OXRA 5F89A 4JJ5B 3LZNA 2C9UA 4PLKD 5KVFE 5L7XH 1LTXA 5I5RA 4LVEA 2WBXA 4KK6D 2QTEA 5C08E 2YMXH 3ESUF 3WJMB 4G5ZL 4KGLA 3PL6B 2PXYB 3AADB 4NBXB 2D31A 2Y6TE 4HF5L 3VXSD 5F8RC 2F19L 1RZIA 3KYMA 1U8IA 2WYZA 2QQNL 5K1VA 1I9RH 4F8OA 2JVUA 2EUWA 3NH7H 2YSSB 2VW7A 3NN8B 4AIZB 4HOMA 4E41D 2AJYL 3NJLA 2A6JA 4UZGA 4P2RE 2BOCA 3RP1A 4DPCX 5IF0A 4R4ND 1D5XA 4N28A 5CIPB 3RURA 5C86A 1F13A 2WXPA 4JAMA 5DRXA 5FOJA 1AGDA 5HI5C 1D2PA 3FN0H 1HINH 3UAJD 3MV8A 3KGRA 2ZYSA 4GXUM 3ARDC 1T83A 4GG8B 5IT2H 1J8HA 3IU4H 2FUQA 1KV3A 3I3DA 3MDJA 3FONB 4LL1A 3GO1H 4CW1B 1FVDB 1L7TL 4P23A 4WNQB 1NCBL 4E41B 2CRMA 2W07A 4M93B 4RRPA 5IQ9A 4NJ9H 2EO7A 4J7RA 2CRZA 2XI9A 3BT2H 2FJFB 2O5NA 4NENB 4UF7C 5DJAA 3WJLC 5EHFA 1H6UA 2JKIS 2UXGA 1JK8B 3T8XB 2YR3A 3LN5A 3PLYA 4UOW1 1U8KB 3FO0H 4RX4D 4AJVA 3FQRA 3D0LA 3QWRD 2ND0A 3L95A 3QXDB 1HZKA 4MMZB 3SDDA 3BP7B 1FL5B 4KMTL 5I18H 2FDBP 5B39G 4NN6B 4ZZKA 1BFSA 1A14L 1BAFL 4N2EA 2EUZA 3VXMA 2BM3A 1ZE3H 4PJFE 4AL8L 4I0KA 2EYRA 3DETC 4LIQL 2R2HA 4Q9RH 5J6SA 4PJEA 3KDMA 3M45A 3HUJE 5DK0A 3UACA 2DQFB 2JJTC 2M83A 4C4KO 5IFJA 3T1FA 1NCAH 4TULH 5E6IC 1BZ9A 3T0VA 1AGCB 1JYVA 3QDME 1UPXA 4JPIA 4R5TA 3LLLA 5DHYB 2JKNA 2GEEA 3QUMH 1UJ3B 3D39B 5KSBB 1HFUA 4NKMB 3UP1A 5ADOL 4D7PA 2FEDC 1F41A 4QNPF 3ME0A 2IH9A 3GBNH 3IB4A 7FABH 2ZUSA 3QQDA 1FSKC 1EZSA 2QDVA 3EGXB 1RZGB 2R1XA 2X0UA 1U42A 4L2LA 4LSTH 4DCNC 3BSZA 5GGVH 4EDWL 1TTFA 3ARED 3IDNA 1RVFL 4I8DA 4EI0A 2NDGA 2TRYA 1FO0L 4GI6A 4B9FA 5GRJL 2NXYD 1RK0B 4FFWC 1LNUA 1S9YB 4FFYH 5HI4C 1OZUA 1RZ8A 1YY8A 2EDFA 3FZUD 2K0RA 3ZHNA 4BQ6A 3UBXI 1AQDA 4LLWB 4G6FB 4F8NA 3GZOA 3EFOB 4BZ1H 1XF4A 3LCYA 5AD0B 1A3RL 2DLHA 2VDLH 3KGUA 2NUPA 4PW4A 3RTQD 3GRWA 2RJMA 5DA0B 3CZNA 1I7UA 2RQEA 3CVHB 3L48A 4JM2A 4NZJA 4PP2A 1J0JA 5SWZA 4OJYA 4MAUL 1Z5HA 2J44A 5D7LD 4IRZA 4WY7H 2PTUA 2CGYA 5E4EB 1IX2A 3RVTC 4PG9A 5AVYB 2TSAA 4E9VA 3RUGA 1T1ZB 4OZGB 2IOOA 2E75C 1LD9A 4TXVB 5FA4B 2IOMA 3OD3A 3GC3A 4YHML 1O7VA 2R7EB 4H8VA 2JXMA 4J3XA 4U1NA 5JXED 4IU2B 1A6PA 4IOFD 1B2WH 1UD2A 4MCYB 4P8QA 5TE4H 3O6FA 3LS5L 2AEPH 1LM8V 3MRKB 1BZEA 1FP5A 1AHKA 5HYJE 3BEWA 4JVPA 2PN5A 2HVJA 5D1QE 1MCDA 1TU2B 1JPTL 1ACXA 5B7EA 2BVOB 2FJGB 3HC0B 3JWDC 4AWJC 3AMKA 1A25A 3U82B 4XX1G 2B2XL 4RA3A 3KPNA 3W37A 3ARTA 5BV7L 4P06A 4J8RB 2CUHA 4NQUA 3KYNB 4S2SB 3TC9A 2EDOA 4X9IA 2EH7H 4B60A 4KI5D 1GTNA 3E1ZA 4Y2OB 1WD9A 1ZV9A 4ANWA 1QKZL 4X8CA 4OF7A 1PX3A 5F9DC 1OM3L 4B27A 3QPQD 1XGPB 4XMLH 4LASL 3V4VB 4Q9CA 2Z8YA 5JHLA 2Q3ZA 2YL5A 2KERA 4HXBL 1J1OL 4P2QE 4OFVA 2VJ0A 5CGBA 5D1XE 5KSAD 1N18A 2VLJA 4PI0A 1NC4B 2NW3A 5JOEA 1MFMA 5DZOA 1SN5A 5G4MA 2H6UA 3F12B 3ZKNC 4XNUL 2NLJA 1YEIL 4AQ8A 3DV4A 4EVNA 3WMQA 3T0WA 3U1SH 3HG1A 3H85A 3H3BC 2VXUH 2ZSWA 5CJBA 5IIEA 2XTJB 4MMYB 3IAGC 4GUOA 4IKKA 3LPOA 1LMKA 5E5UB 4R4BA 4EKXA 1WFIA 1Q9OB 5EC1A 5F9AC 1T03L 2NY5H 1NC2D 3WTVA 1MFDH 2AGJL 2BNQE 5CLWA 4X6BA 1QRNE 2MFNA 3D07A 3O3MB 4XPAL 4J4PD 3FO1A 4HYTB 3PAVA 4N86A 4XNYH 3BVVA 4R2GD 3E6HA 2BFVH 2R4SL 4NJAL 4QRPE 1AQMA 3ULUL 5GGTA 2WK2A 1JGLL 2ZPKH 5D1ZI 4YSSA 3ERCC 4TQEL 3QH3A 5FYLH 1UASA 4HHAA 5F7EH 3B9KA 1NC2B 2YXWA 3GT6A 4I1RA 4NIYE 4AQ1C 3GJEB 4F7EA 1DQKA 1W72B 1UG9A 2WO3B 3ALPA 1U58B 2QV4A 1CU4H 1KOAA 3JWDH 5J0BA 4LDLB 1MJ8H 2HLFD 1QVOB 5KTEH 3BAKA 4R2GB 4ZO7A 4IIQC 4C58B 2CLRA 1YMHA 2NY0C 2OP4H 4ZMYA 2QHRL 4YNYA 4XNXL 3KGTA 5AAMA 4IBTA 4YHLH 1N6UA 3TESA 4XN9A 4NXSA 4OQ1A 2IG2H 3WFBL 1QR1A 1DEEA 1TF4A 2DKSA 5E2TH 2K9UA 3ZE0B 1MEXH 2CDFA 4RSYA 4ENEC 4R0LB 1FN4A 2WQVA 1G0YR 4LHJB 3TV8A 1CFBA 1IT9H 4G8EB 2PMZA 3RLSA 4ISVA 1IAMA 3GUFA 3QORA 4OLZH 3Q6GL 3DV6A 4XOCA 5T1JA 5F8QC 1ZV5A 1TJHH 2EH8L 4XNMB 4HS8H 4LEEA 5CM1A 4M61B 4UB0L 3UPCA 3QC5X 3CV5A 3PWUA 1HH9B 5C08B 1MCJA 3VXNB 3BAEH 2LOEA 2DQTH 1H15A 3AY2A 5I1LB 1JWSB 3O4OB 4A7UA 5F70A 5HXMA 2ZKMX 1S78C 2R2BB 5JMOC 4HWEL 4JZOB 2E59A 1WISA 5CLYA 1ZTXH 1JPSL 1C7SA 1OB0A 4BEIA 4P2RB 1TNMA 1LE5A 4BK5A 3WY3A 2ATAA 3RWEB 2G9KA 3W0WE 2YAOA 5DA4A 4I85A 4I18C 3IF1B 3KPMA 3AM8A 3P54A 4YPGA 2ZUQC 4JHWH 2C4FT 2EE0A 2ITCB 3H53A 1LO5A 2X53A 3FMGH 4NPHA 3DDGA 2AV7B 3GYRA 4FFVC 3BHBB 4IK6A 2ODIA 5C2BH 2VAJA 1KGXA 4XN4A 3V4PH 3RB5A 3LEYH 5FYKU 4F80A 4E9RA 1O7SA 1JGIA 1G7HA 5AW4B 3L81A 2IBZY 2IAMD 1ZOXA 5KYNA 4Z7QE 3CAZA 1RI8A 4LRNL 1C7TA 1NFDE 3BVDB 4GIOA 2HRPH 2FSEA 3B8YA 3MYJA 2X1WL 5EU3A 3FB7B 3ZTJG 4RDQG 4Q6IB 1KTCA 5D2LF 3LRGA 5FS5A 3ZR5A 2PCYA 3SB3A 43CAA 1JGDA 3DX6B 2XKNB 3QDMD 3TNNB 2D0FA 5F1OB 3UYOD 4L3ED 1D7FA 2V8LA 4TLKA 3VRIA 4P5SA 1QSVA 3V4LA 5FKAA 2K70A 4ZFFA 2ORBL 4HR1B 4NQDB 3VXOB 2Z0NA 5LAXA 2IAMB 2X12A 5DUPL 3CVHL 1T1XA 1NEZA 4NI3A 3IE4A 4PJFB 4X9BA 4BKTC 1E5UI 2NR6C 5IHHA 3OSKA 1J9QA 2FJSA 3V0JA 1YHPA 3D30A 4WWKC 4CVZA 3AS0A 2XLLA 3IKKA 4PEEA 1U8LB 1YMMD 1DDHA 3I6KA 3RWFA 4P07A 5IBLC 4EZMA 2XN9A 1MQKL 2OSLB 3IFPB 4I48B 1FZOA 5FCSH 3RGVA 5BS0E 4GQZA 4F7KA 1R75A 1PZSA 3EDDA 4M56A 3IDIB 4EZKA 3DBSA 5EEWA 4AZHA 4D9QD 4XNQB 2MMXA 1WC7A 3KXFE 2EQDA 2FK9A 2ITDB 1RJZB 3O2VL 4NSKB 1RUPH 1TQSA 1YEKH 1EZVX 1EDQA 1LMIA 2VN6A 4Y4HD 4K4KA 5IHUL 4KRMB 5I26A 3VI3F 5HDBF 1HEHC 2ZOKB 4KKPA 5E51A 4HUWA 2EACA 3K6SB 3AXHA 4F01A 2VLRA 3MACL 3DYTA 1VENA 2ZX8A 2GSIA 4DUXA 5FYLE 3L3HB 5IVXA 2FSDA 1RAMA 2V7NA 2H6PB 2X4PA 2ADGA 3KL5A 4M62L 3CN3A 3UTQB 1BLIA 4X6DA 1YAIA 4L9LC 4U6XB 4G6AC 4IGBA 4FJYA 2X0VA 1Y18A 2FBJL 5AWNH 4E9YA 2XQYK 1DVFC 5AUMB 3VG9C 3HPLA 3UBXA 4HUKB 4PHXA 4EXKA 3UTTB 1DVTA 4LCWE 2WINA 3MGOB 4RMTA 4XMXA 3LS4L 3UERA 2F7OA 3BGFB 3MUGA 3KR3L 3ULAB 2XVGA 3DUHA 5IQLA 3HCVB 4YSPA 1Z3GL 3VWKD 4DP8X 3ALWA 1B0RA 5HYJD 1QUPA 1OY3B 5D93C 3NZSA 4Q9BA 1T1WA 1KJ2A 3R0NA 3V4VL 5D1QD 1CTOA 3QPXH 2WXOA 4DTGL 2YPLE 2JSFA 3MRRB 1BVLA 4ZPVA 1P4IL 1E43A 5HJGA 1RD6A 3IXAB 2X3AA 3US1A 4A68A 1T66D 1QTSA 4ZO6A 25C8L 3N1MC 1R5WB 1YEWA 5E4IA 1HCZA 1MKFA 2EIJB 4LL9A 4OQTA 2CPCA 4YHNA 3TYGH 3ZLQC 2X2IA 4X0KA 5KYUA 1WQVT 2XFXA 1E9PB 2A73A 5D9SB 4Z95H 4Z7AA 1TYEB 1WRFA 1DN0A 1HL4A 3SOBL 4Y5YB 5CR1A 5HYJB 5E8NB 4AM0Q 2BFGA 1KJMA 4WJKB 5D1QB 1U8PA 1K72A 3K72A 5BPPA 1NAKH 1X4ZA 3PFUA 5E2WH 5C0AD 5FC9A 2FRGP 4G7VH 3HHSA 3DNKA 1F8TH 4G80B 2OYPA 1F3DJ 4Z76B 4OF6A 2NUTB 1JYWA 4Y16A 1LLAA 5DMIH 1NGQL 1WZ1L 3ZO9A 4ZD3H 1RZ7H 3BXNA 4I87A 4ERSL 1A3LH 3CIAA 5I16B 3C9NB 3KEDA 3QJSB 1MRDL 1MLCA 3VJ6A 2I9TA 2LT9A 1F97A 1UM5L 5D1XD 3HAEG 3QJHB 1KELL 5J13C 3LKRA 5E24E 4X98A 1XGYH 5AOZA 4ODXA 1VFBA 3BSHA 4W4NA 1PZ5A 2YIHA 3MUHL 4OZ4A 4LSVL 4XO5A 3RKDC 1OCRB 4ZXBC 1MCOL 3MLTA 5F7FA 2AJUL 3U0PB 5KEZA 4YHZH 5KYYA 3EBIA 3CFCH 5TGBA 3OB0K 4P2QB 3GHBH 2SEBB 3GSQB 1HHGB 3O2DL 4QHNB 5D1XB 3RWCA 1AZBA 4Y9FA 1QSFE 3SKMA 3CFJA 4FM3A 5HDLA 3K71B 1BVKB 3KAVA 2EE6A 4PPTA 2DQDH 5D70H 2KZ1B 4Y7MA 5DI8A 5FYJD 2P24A 3FCSA 1GGCL 2XPZA 4OBRA 1I1RA 2DBLL 3LAFA 2OMBA 1VPOL 4KKNA 1QPXA 2O5YH 4BFIB 4KNQA 4RQQA 2O5ZH 4G9DB 4BH7A 4YL4A 1UQSA 3O6KH 5DRZB 1CYGA 3EJQA 2P48B 4K9JA 2BWQA 4ZOBA 5CEZE 3WS6C 4OFIA 4PU2A 4AW7A 1KYOJ 5CILL 1W0YT 4AVHA 1VGEH 3SYAA 2KLTA 3U4EB 4HJUA 3KYKL 4PR5A 3PGFH 1PVHA 2BNQB 1QRNB 1VAHA 4Q6YA 5IW3A 1AS6A 1DQLH 3D08A 3LX9A 4DN3H 1KYFA 2GW5A 1AGBB 3CDCA 5CMAA 1A1NB 1AGFB 2QGBA 1XBDA 3NIFF 3L5HA 3QUMB 4JG5A 3T49A 2W5PA 4JFDA 4QRPB 2NDFA 4Y19A 3P0YL 3SGKA 3L7FA 2VITA 1VZHA 2X05A 3MCKA 3MRMA 1CTNA 3MV7E 3S98A 1IARB 1RJYA 2A9BA 5D1ZA 3S35L 4JFEB 4IRSC 5GRUL 1G6RH 1N64L 1SZNA 3GBLA 4AE1A 3JQOB 3VG0L 1R5IA 3RL2B 2BVPB 4M5TA 1NPJA 2QSCH 3MV9A 2DJUA 2ICWB 4LSSL 2H2SC 5MEPB 3WIHA 1JDDA 1IO4C 2IH3A 3D2UA 1QHQA 4H4NA 5GIRA 1MFNA 2O61B 3B9DA 3B6SA 2J2ZA 4WWPA 1NGZA 4HEPA 5JPNA 1NBCA 2VDLB 4WTZG 4YBLC 2DLTA 2YAMA 3ARDB 4NZUL 5FAAA 1IAIM 3SDAD 2B0SL 1I85C 4HWZB 2E7BA 2CAKA 2O4EA 3OG4B 4HWBA 2HN7B 1PAMA 1YPZF 1OP5H 2VKXA 3BKJL 4OV5B 3DYOA 3ZR6A 1DBBL 1M7DB 5E6SB 4D0BB 4QRUA 4QY8A 3WFCL 5HVHC 4Y4FA 4YX2H 5GZNC 4YE4H 4WNSA 2OQJB 2G0KA 3KWWA 1A4JB 3ER8C 3T77A 4CVXB 5GSRA 1KEMH 3S88H 3QNYA 3SDAB 2JIXA 5EZIH 4PY7A 1KWGA 1XZ0A 3OV6A 3QUXA 4AM0B 3IFOB 5KS9A 5BVPH 1I8MA 4JM4L 1FLRL 4HZLB 3UCRA 3O0RL 1V7NH 5IZ7A 4H44C 3RA7L 1A1OB 3CN4A 4G6ML 1FL3A 3RPIB 3HG4A 1SJMA 1T20B 3FQTA 2GB2A 2FEDD 4JFVA 2FNBA 3W0WB 4C54A 1NGYB 4JFZH 4FCHA 1ZT4A 2VIRB 3OK8A 2CBPA 2VLKE 1T21B 1C08B 1CR9L 3QXUA 5JW3L 3DPPA 4PBVC 4WEUD 1F58H 1FVCB 3GXDA 5IVOA 2V37A 1WE5A 4EPSA 3ULVF 3EO1A 5E6IB 3ZIYA 2JKRM 5MHSE 1FC1A 5IMLB 3FT3A 1AIFA 3QG6A 3D34A 3NAAL 3QIUA 5HPOA 2R39A 1SY6A 2CBQA 5BMFH 3MYZA 1IV8A 2Q3XA 3ILPA 1KNOB 5F96H 2B9BA 1F42A 3LHPL 4XPHL 4L8SA 3TFKD 3N42B 4HPOH 4M6AA 1LO2L 4HJTA 3DIFB 3OHXA 3X13A 3NQIA 5CSZB 5F3BB 2ELBA 5EG6C 4XI5D 4UM9A 2G75A 3L1OL 1C1EH 1QFUL 4Z0BH 3E6FB 3FFCE 4QGTA 4CKVX 1J1PH 3VSQA 1HYSD 1HNFA 4X5XB 4G9FA 3SKUD 3INOA 3L4YA 3O3BB 1EGJA 3I75B 5BS0D 1QLRA 1KPVA 2ADIA 5DHMC 2EXWD 3IMWA 5F88A 2CU9A 4BK4A 3A6BL 1M05A 2HT4C 4IEFB 1T2QL 2VRKA 4FP8H 2I26N 2D3LA 4NYLB 3TYFB 4JPSA 5A2BA 5T1DH 4PAZA 2R0KH 1IFHL 3K46A 3NZHH 4L8DA 4RWYL 4RMSA 4RISH 3ZKMC 4KUZL 3ECBA 3V4UH 1MFEH 3SYOA 4HC1L 2CNYA 4L4TA 5LXVA 1E67A 1SJEA 1Q9KA 3L4CA 5DMGC 2Y9RT 3KXFB 3CFDA 1MI5B 3RX5A 3FUMA 3ETBF 1CG9A 3BIKA 5L7XL 2CJUH 1U2CA 2F61A 4FI6A 3CFBB 4RMRA 1CBVH 4ZI8A 4F93B 5EPMB 2YMXL 4B53A 1XSJA 3IK2A 1HXYB 2FO4A 4LCWD 4P9HC 2IWKA 2NX5E 3HMXL 1OP9A 1G7QB 4GAAA 4WSKA 5EZPA 3WFEL 4F27A 3UC0H 1I9RL 4V1DA 1Y6KR 1H9DA 4PP1D 1SDAB 1PPIA 3QT2A 2FL5B 4AZCA 2XVKA 1I1YB 4MXQC 3OL2A 4U1MB 3TA4D 2CDEB 2YPLD 4TLSA 2P5WA 3IKCA 1YECH 4ILDA 2EDKA 2UXTA 3F3HA 4JLCA 3WLBB 1XEUA 3MROA 5ALBH 1G6VK 1KPRA 2CE6A 2H0JA 2NZ9C 2XWRA 3BP5B 5K1JA 1Q1JL 4L1DA 1J8HD 1GMEA 5I17B 4U6YB 1PKOA 4ZK8A 2E9JA 3MRGA 1FZMB 5T3ZH 2H3NA 2XQBL 5HHVH 4PGBA 1XIWC 1I3VA 5C3TA 4AC4A 4GY4A 4BQBA 5B3JE 4NJ9L 4UQAA 2YPLB 4GKZB 2TSBA 4ZJ9A 3BT2L 2V5SA 1XH3B 1IEBA 2KZKA 1DO5A 3QXAB 2C7UA 3QZOA 3DJ9A 3G5XB 3HBPA 3PGDB 4DGIL 3KBHE 1MVYA 5CJXA 2BZ7A 4YVUA 4WO4A 1FI8C 4LEOA 2ZSVB 1ILUA 2AV1A 3GSUA 4PWEA 4DWHA 5I18L 3T6QC 1M9SA 3NCWA 4MCZA 3T04D 3C8HA 5C1MB 1OOAA 4OSUH 3PIQB 3Q84A 3T8VA 1BX2A 2WN2A 1X5JA 1L9OA 1LK3L 1QBLH 1XL4A 4YWGL 4UT7H 4JFSA 1TLKA 2YMTA 5BZWB 2OMNA 3GZQA 3MLUL 1I7ZB 3ATFA 5HDRA 3NRQA 4D9RE 4Q9RL 3G6JF 4ABQA 4QHMA 4OI9A 5DEJA 3G6AB 2FQDA 3DHUA 4ELME 4Z77A 4PJGF 2UUDH 2XACC 4F2MA 1NCAL 1WDZA 1F2QA 1Z9NA 3D50A 3MRNA 3P69A 1WEJH 1OAYH 3WHE1 3LDBC 2AZUA 2KL6A 1ZSHA 3QUML 3TF4A 3AXIA 4QRBA 3M7FB 3JTTB 2ZICA 3TGXA 1FYTA 3T0EC 2EDMA 2BSDA 4NN7C 3GBNL 1ZHBB 2XWCA 3MMEB 7FABL 4MSWA 3WE1A 4FMKA 1I3RA 2DWEB 3BQUC 3T3MB 1S9VB 4P9HH 5EH1A 1Q94B 3OKKB 1UACL 4I77L 4GQRA 4LSTL 4YSCA 3ES6A 5CEZD 5GGVL 4JY6B 1D5ZA 1OSPH 4Q8BA 4AQ1B 3X1EA 3D9AL 5E8EA 4CC4C 4OW6A 5IQOA 1L3WA 3QCVH 1QSFB 2DH2A 2FB4H 3G5YA 3D69A 2J8HA 3DC0A 1AACA 4FFYL 3F85A 5IK3A 1KPUB 1NZRA 1T5XB 2ZUYA 4UTAA 3X11A 3TNMB 4IIQB 1TXKA 1ZA6B 4M0MA 3LIZH 4BZ1L 1H8LA 4GRWH 1R0AL 2W0LA 1ZWIB 3LYRA 1I82A 1CICA 2VDLL 4A66A 4N20A 3VQLA 4FZOA 4FQXD 3W2DH 4JS7A 1TVHB 5KOMC 1HEZA 1T80A 1S7WB 5F0MB 3I9PA 1MXDA 1OOWA 4FYRA 3VNZA 4UOJA 1U30A 2OTPA 4CNIA 4HXAH 4WY7L 4NSWA 1NLBH 1TEGA 2IMMA 5LGYA 5JR1L 5AOKA 4LNVA 4KH9A 2Y7LA 5ISZD 3H56A 2C9VA 5DRNB 3FT2A 1ML0A 4I3RH 1SU8A 1WIPA 1ZEAH 4P46A 5DFVC 4MS6A 5EEUA 1FNFA 4BM7A 1E28A 1FV1A 1QI4A 3GQFA 4LMQI 4CSTA 1ZV2A 32C2A 3MV7B 1DKYA 1PMYA 3CN0A 5IWLA 3FK3A 4GQPH 2F7QA 4PB0H 2LE9A 4XO3A 5J11C 3IN0A 2CUMA 4HCRH 3PP4H 3LRKA 3ARUA 4MZ3A 4JNXA 1X44A 2XPYA 2Z4QA 2BNRB 1N0LB 2X3VA 2ENSA 2HKFH 4O51B 2E56A 4G1MA 1U8NA 3MI6A 1UEYA 1E3ZA 4XVOA 1OAZL 5GZOD 4U7SA 5CR8A 4I18B 2UYLA 2ZUQB 3DOHA 3CGTA 1UGNA 4FNLH 4GIPD 1ZJAA 4YSEA 4F8PA 3QSKB 3EH4B 2Y24A 1FG2B 5CZRA 2ZX7A 1FNHA 2BH0A 1AD9B 3CH1A 1KDIA 4FTDA 3UH8A 2EVIA 5JHDA 1TZOA 4MZ2A 5KBPA 4TQ8A 3B83A 4PJHA 3ZTDC 3BWZA 3CWGA 4CSZA 4MJIA 2IDSA 1SDYA 1XO8A 5IOKA 4HUVB 3QNXB 4KDTA 2OM5A 3T2OA 1T7WA 2AI0L 2CCVA 3F83A 2VQ4A 3OB8A 3V10A 1ACZA 4MAYC 1CF1A 2KDGA 2FR4A 4DFIA 2HFFA 1GSMA 3HE6A 3IJEB 2X2HA 4POYA 5MHSD 4MNQE 2LAAA 4PRPA 3CFKA 5C09A 2O0I1 12E8H 2NNAB 3IPBA 4O9HL 5BCAA 4WW2C 3U1SL 5DMYA 2CLVA 1LWRA 1URLA 5FHAL 4XRCB 4TL5A 5BRPA 1X5FA 1TTCA 3B8SA 4ZUSA 5L9DH 3BO8B 2C1PA 4PS4L 1DLHA 1IGJA 2EC9T 3B5HA 3S4SB 5IB1A 3HS9A 2VLKB 2X4SB 5A1AA 4WWKB 3E38A 1HI6B 1S3KH 5C71A 4L9DA 1MCCA 2ZTBA 3FFCD 3WSQH 3BVTA 3T4AC 4E9TA 1JDCA 3BPLC 4XNDA 5J1TC 1GW6A 1RURH 1U3HA 3TBWA 2KI6A 4OLXL 3CCHA 5T5FA 4ETYA 1ORQB 1JWUA 4I0PA 1QA9B 3DJRA 3BH8B 4XNYL 4ODSH 4QRRE 1KJVA 1SEBB 2BFVL 2J4WH 5I6LA 4I3SL 5LDUA 1FC2D 3UZEA 3VCLA 3QRBA 1E27A 3TWYA 1HOCA 3MX0B 4BRJA 1ZT7A 1DVFD 3BAXA 1F90H 5FYLL 5H2BA 5F7EL 4RRPM 5CKAA 1JNHB 5E6ZA 3FFCB 5EWIH 3QCTL 5ID1B 3TJEL 4ZAKA 2EVHA 3SOGA 2HLAA 2PPAA 1PNDA 4Z7UA 3JWDL 3KPSD 4M8RA 2NY3C 3CX5J 4FKEA 3KGSA 1GXEA 1MJ8L 4HWUA 3FQ1A 4JZJA 3GKWH 3K2UL 4Y5XA 2GIYA 3M17B 4GXFA 4L9LB 2OP4L 2XZQL 4HETA 4BGDA 3QI9D 4PIBA 1P7QA 1I3GH 4YO0B 1DVFB 5BUGA 3S7GA 2IG2L 4GRWE 1FE8L 4LDOB 2CHXA 1IQWL 1Q9LB 1S9XA 2AJSH 4EZPA 4X4XB 4DOHB 1D5IH 3PHQA 2NX5D 4YC2C 3R18A 2X70A 4HLJA 5JQIB 2YD6A 1A0QH 5E5MB 1GKOA 2JH2A 5IB2B 2H3KA 4OCRL 3PY9A 5KUMA 4JG0H 5D93B 1A6ZB 4LXFA 4OLZL 3A6OA 2YIAA 3FT1A 4AYDC 1INDH 3QEQD 4B9JA 2VWEE 3TN0A 1NTDA 1W0VA 1IFGA 3D06A 1T3FA 3A4EA 3RNQB 2ND1A 1IBDA 3FN3A 5H37A 1Q0EA 4X7FC 1HCFX 5K9OA 1NEPA 5M7QA 3MCYA 3VH8A 2WSKA 5F7UA 2AXWA 5T1LD 2R51A 2R29H 3BZFB 3QIBC 4FF9A 1W15A 3LNFA 2Q12A 1JSYA 2IFFH 5TPWH 4OKVA 1XD1A 3EOAA 1G87A 4EN2A 2ALWA 3MRDB 5CD3B 3TTYA 3C8KB 4BRVA 1WA2X 1MCHA 4JHWL 1FBIL 2DB8A 4A2MA 1TJXA 2WVSA 4YHIB 1FORH 1GYCA 3H3KA 3FMGL 2YKTA 1XEDA 2Y06H 1OAOA 2V3FA 3AITA 3D52A 3KPRB 2EIDA 3UJTH 5J13B 1B0WA 2Z91A 1NA8A 2Q13A 4B6ZA 3LEYL 2BCKA 4GUPA 2FX8H 2FYYB 2WXHA 1OW0C 2J1KA 1AFVL 4ZXBB 4AITA 4QLRA 3ZO0A 3U6RB 2PW2A 1F2XK 3BH9A 4D9RD 1MPAL 2HRPL 3AB0C 5LN4A 5KVMC 1ZY9A 2HUEA 2WKOA 1ZVHA 1E9OB 4ZSOE 5LCVH 3IJYB 3RVVD 2GTWA 3GUTB 2AABL 5CBEA 2Z0BA 4RFEB 4PJ5A 2WCSA 1OEZW 1DUZA 3C2SA 2ZWLT 3EF4A 3NCFB 4MD4A 1FF5A 4TRPH 3MAWA 1SXZA 3Q5OA 2QVKA 4JDVB 4E5XB 4G7SB 5D8JH 2OMZA 3RPBA 3BWUF 1BD2A 4LAJH 1T7ZA 3W5NA 1ERNA 5CEZL 4I1PA 1ZGLP 1M6UA 4ZMWA 2F74B 2G5BA 2VISB 5I1GH 1UB5A 4ELMB 2WXLA 1EJFA 2Z7ZA 4F7TB 3QUGA 1U8HB 1RCYA 2FIRT 2XN9D 1JFQH 4NBYB 2OCCB 1YEEH 1KBBA 1KCVH 1MOEA 1U8QB 2K6ZA 4OTXH 3H6AA 1A7OH 4QHLA 3VI4A 1AQ8A 4GIAA 2IF7A 1WWCA 4GW5B 4PJ7E 5FFOA 1KYDA 1CLOH 2IWGA 1DQMH 3S3CB 2WNWA 3MNDA 1RUPL 1MRCL 1YEKL 4JGUA 3UCQA 2BSTA 3HZMB 4TF4A 1HJCA 4OJAA 1NM4A 2BOLA 5E03A 5D7IA 3UROR 3VDAA 1KCWA 4NWUH 5GGSB 4ADGA 1ACYH 5E0QA 4IRSB 3IFNH 5FV2A 3GHPA 2HXAA 3SJVA 2EIZB 3HAEH 2EEAA 2FZ3B 2W60A 1YEJL 3LRSB 1KTKE 4GRMA 1IGCL 5G55A 3OAWA 5C3LD 4B9YA 3NFSH 5KSBF 1WPCA 3LZRA 2VXQH 1X4XA 1IAIH 2HJLA 4P57B 2VDPH 2G60H 4AYBA 3TV3H 4A6YL 2FHBA 3PXJA 2ZX6A 4WKZA 2AFNA 5TFSH 4DIXA 2HRLA 2ZYHA 4Q56A 1OPOA 2YSTA 4YBLB 3SQOH 5JW5B 3NSXA 2E8ZA 1KTRL 3IT8D 3L3PA 4GUCA 4IS6A 2DMHA 1NUFA 4EXPX 1GVIA 1PYWB 2QL1A 2JB5H 3EJJX 3OKLB 3NJXA 5B4MD 2PO6C 3QPXL 5G5DA 2XIIA 4ONHB 4AXWB 2X3CA 2DLFH 4W9HC 3EOBB 5ESVA 4MJ4A 4MD0B 1EZLA 3UIYA 4P2OC 1QNZL 3FO9B 5HVHB 1JZ6A 1U8OA 4LNRA 1AI1H 4AZ8B 5DQ9B 6TAAA 3OAYH 1EDHA 3G5VA 1SN0A 3FTGB 1TFPA 2CO6A 3LEXA 4U1SA 3RZCA 3EDJA 4PRAB 5DEGB 3FU0A 4MS8D 4N8VA 4HHWA 4Z95L 4CMHC 5IEHA 3LKNB 3WFDH 4GMSH 1IQDB 3BUIA 1ZWWA 3TH2T 2YOCA 1NAKL 4PG2C 3REVB 3RWDB 3L3KB 4OZGF 4P5MA 1JWMA 3U83A 3T71A 1UWEH 3I2CL 5KAQF 1F8TL 1UVQB 4URTB 5C0JA 1PZUB 4M03A 4ZD3L 3QZWB 3VO0A 2EILB 4MA3A 2R69A 2PTVA 3AQYA 5JZ7C 3ATBA 5HGAA 3GMLB 4OD2B 3OAUH 3OZKA 4BKLA 3GSVB 4KKLC 4N0YL 1ZAGA 2F1EA 5C6PB 4IBWA 4OZFH 5C0NC 1XGYL 1E5YA 1I53A 4PCKA 4V2CB 3IVKB 1L5GA 1ZLSH 1TZIB 1N5AB 1M57B 4H88L 1NEZG 1XL6A 1DTUA 3EIFA 1CDGA 1N68A 4KK5C 2OMUA 3MJ9H 3DO7B 3OMAB 4FZ8L 4QRTB 4ZFZB 4E9QA 3CHSA 2HT4D 4L3FA 4ZRGA 3FOLB 3TBSA 3C6SB 1F6LL 4PIRF 2BS9A 2P5PA 5AOIA 4L8BB 3BW9B 2VE6A 5T5NG 4CSPA 4KTDH 5BZXA 4FGMA 5KJRH 1I1CA 4Y1AA 4GFXA 2XZAH 2WSDA 1NANI 4MNQB 5E95B 4UDUB 1CD9B 3BMVA 3JV6A 2DQDL 5D70L 1H3PL 4L1BA 2H8PA 5DRWB 4A67A 1GNLA 3ABKB 3MREA 5DMGD 3SGDH 4BSJA 3LPWA 4EZZA 3ZIMA 3P77A 3ZGHA 2O5ZL 2HSIA 4GBXD 4F00A 2AQ3A 2DD8H 3KPQB 1MAKA 2X38A 3L4ZA 3PV6B 5BUAA 1RIUH 4D0CA 5FO8A 5IKCA 5BXFB 2WZPD 3PGFL 3SE8L 1T7VA 4ICXA 2FGWH 4BZ2A 3BE1H 3TPUA 3KWTA 3QJRB 4OKDA 5DJCB 1PLAA 1OF2A 3ZVVA 1UB6B 1U8MB 2B3RA 4QRRB 3ARYA 1E7VA 1S7QB 2WBJC 3FKUS 4P9MH 1ZLVH 3D48R 2V33A 2UWEF 1UENA 3QZPA 5AVSB 2Y1AA 2DQIL 2ADFH 5I15H 4Y8AA 4G70B 2JCCE 5D1ZD 4MA1C 1EFQA 3HZ3A 3V6ZB 5ILTH 2R4RH 3WELA 3MFFA 3O6LL 2GCYB 4JRWA 1U41A 1FFPA 2F54E 4A7QA 3IU3B 4QHUB 3QO0B 2ADJA 3U48A 5DEFA 1EBPA 3U0TB 3ABMB 4FXTA 2HAZA 5J3HC 3VM5A 2QSCL 3IEAA 4DEWA 1HILA 1LXMA 5DZAA 5FO9A 3UZQB 2AJXL 3S3SA 2QKSA 1CYXA 1D9KA 3EZ8A 2IQ9L 4JPKL 4UNTA 5FX3A 4NNPL 2DQGL 2A0LC 3H9HB 2J7LA 3KPOB 1FPTL 4GRWB 4UI2A 1B3IA 1DR9A 4IHBA 1ND0B 4RBPK 5TF0A 3VB8A 2KBGA 3AXLB 4GLRH 1J0YA 3PWNA 3M07A 5D5ME 2GITB 4AGOA 1EJOL 4GKLA 1BOGB 2BW4A 4OLYL 3NCJH 4EOWH 5AL8A 4XP1H 1XIWB 4AKOA 3VGAC 1OKEA 3MBEC 3IS1X 4IMLB 5T1KB 2A4ZA 2B59B 2EDDA 5CJOH 4W9FC 1SU7A 4N2BA 1O5PA 4YX2L 1OP4A 1ZIBA 2NQCA 4WAFA 5AFAA 1RUAH 4K7FA 2IAAC 4PWIA 3ZE0F 4MWFA 5EZIL 1HXMA 1W80A 3LZFH 4JB9H 1DBML 1OANA 4S0SD 4JGNA 5BVPL 1UZ6E 4HFWA 5ESAB 5A6LA 2X2YA 1KTLB 4RSVA 2WANA 2A9NH 3PWPE 4KAQH 3DMMD 4UILH 2F5BL 2WVVA 1QACA 4JQIA 4QWWC 1C9SA 3SPGA 4DP9X 4D0DA 1F3DH 1F58L 1GPOL 2F7RA 1V7ML 1L3NA 1N0XH 1CI3M 3MRQB 4PD4K 2PYEE 3QIUD 3LDBB 3O8XA 3MRLB 3MV01 2WINM 4TVPH 2Y5TA 4JFPB 5BMFL 4X8GA 4ODWB 3N3EA 3ZKQD 4NPKA 1D7BA 1UC6A 3HW7A 2WCGA 3T0EB 2A4EA 4NN7B 4KJWD 1CC3A 1CB4A 4JFYB 5H4ZA 1JHLH 1B3JA 3IDGA 3W39B 5PAZA 3TBYB 1WUNT 3BQUB 2J25A 4KZDH 4H8WL 4UM9D 5I8CB 4BNEA 3LRLA 4KROD 3F04A 4H25A 4ZSOB 1C1EL 4Z0BL 3RILA 2BP0B 4EBQL 1Y1DA 1QWUA 2ZXQA 1S7XB 4J5VA 3K1DA 5CF3A 1J1PL 1JNNH 4HMCA 5AOMA 5I19L 4LSQH 4YSRA 5D71H 4XHQA 4GYBA 1HCYA 5FYKE 1A4BA 1CL7H 3VACA 4DK6A 5ACMA 3P4OA 1UOKA 4FRWA 4D8OA 5I28A 5E8OB 2N4IA 4K7PH 2YARA 4XE5B 1JV2B 1W9MA 2NW2A 1KB5H 4KROB 5GRWA 4R5VA 2LXYA 2YL6A 2Z0VA 1V3MA 1P9MC 4YFDB 2Q86A 5T1DL 2ENJA 1O6VA 2R0KL 2Z8RA 1TQBC 3NZHL 3ZMRA 3T0BA 3AQDA 3WXWH 4RISL 5SWQA 5E08L 5K9QI 3MN8A 1T83C 3QG7L 1MFEL 3EJZD 2OX5B 1OWRM 3CXDH 3T6XA 1DVQA 2X42A 4KV5F 4PJ7B 3VRLE 4P23C 3R7RA 1KG0A 4HOWA 4PGCA 5GGRB 4DNLA 4IKNA 3SPCA 1SUJA 5IESH 4PJFF 4PRHE 3P11L 1CBVL 5B3NA 5DWUH 4CBZA 3HUJF 1KGCE 4HT1H 3ILQD 1N8ZA 4GS7C 5EUOE 1E4KA 5HHNB 1P5VA 5DF0A 1PY9A 1P6FA 3NMEA 3U36B 3VDCA 3IAQA 4L4VA 1BIIA 3WKPA 1MHPL 4O58H 2AXFB 2IGTA 4TSBH 3UC0L 1UWGL 1VF5C 4OM1H 3TEXA 1J1XH 1HSBA 2R27A 5J11B 1W2KT 3SDDC 4BINA 4EDXA 4O00A 4XZUB 5EZJB 4XOBA 5EIVA 1BHGA 1DQTA 3KHOA 5CEXA 3KW7A 4M4RB 2WTRA 1UA7A 1YECL 3B1UA 3F5WB 3H9SE 4EI6B 1WGVA 4YDNA 3IBOA 1PJ9A 2NZIA 3L4TA 1E6OL 2QELA 2AK4E 3LZOA 5ICXA 4MAYD 4GXVH 1ZLUH 3UP6A 3LNGA 2DWDB 5C6TH 1R24B 4MHHI 4RAUA 1UOVA 4A63A 2IGFL 3O45B 5FPIA 1KYAA 1OGTB 1E9QB 4X6EA 1BEYL 4NRXB 2X3XA 3PGCB 4PGJA 4M00A 3HZKB 5F3HB 2CHZA 3KL0A 1HHHA 2F18A 4BXSV 1BXUA 2FH6A 3DROA 4JRLA 4NUJA 1BGXL 4LVHC 1QFWL 3GDBA 3HE7A 3GMNB 1IGYB 4L1LA 3G04B 2WYHA 4MAYB 2Q7NA 1QYGH 1E8WA 5EUKB 1NAML 2BZCA 2GY5A 2ZP9A 1KTBA 3NGBC 3J27A 2MOQA 3L3JB 4LHUA 3FRPB 1A7RH 3WY2A 5DT1H 3I50L 3PABA 4KUCD 3H54A 3IDMB 5DZPA 5GPRA 5FGRA 3AY4A 2AEQH 3GMOB 1QBLL 4UDXX 5EFIB 4UT7L 3VFOA 4X6CA 4OIIL 1IC5H 2X4RB 3I02B 4N2FA 4YK4C 4NKOA 5ANMA 5I0ZA 4WI2A 2ENYA 1CFVL 4XXWA 4HHGA 2Q3AA 3FH8A 3GM8A 3CDZB 1JOIA 1HSAB 3N1GC 4UTCA 2EXTA 2PWGA 4JM2C 4X7TB 3T4AB 4CDHA 4HK0A 2VMDA 4JCWA 2EECA 5I1HH 1N67A 3HB3D 3X3GH 3KG5A 4DEUA 5GJSH 4BBWA 1NCDL 5J4MA 1FA4A 2IALA 1GGYA 4FLHA 2IPKB 4XCNB 1HK6A 4MDJB 1MHEB 2HT2C 4WCYH 5A3ID 3GMMA 3O11A 2DQUH 4LCYA 2CO1A 4YHOH 4P9HL 5L4JA 1QEWA 4N9OB 1ZTMA 3Q43A 4WSGA 1OSPL 1CE6A 3HNVL 3EDKA 3O9WA 3GXNA 3O6FC 2FB4L 1T0MA 5JO5B 2I07B 1XB3A 4PS3A 1A7PH 2IQAA 4JVWA 1DJIA 4OFYD 4NT6B 2CHWA 1L0PA 2APWA 1OTUD 5DO8A 1JL8A 4FG6C 2EFKA 3CVIH 3SO5A 3BYYA 3CN2A 5D96C 2JFCA 2C4XA 4BUGA 2VL4A 4LPUA 5EBLA 4U2YA 5CO1A 4POZC 3W2DL 3NZ8B 3IE9A 2RR3A 5FOBB 1BM7A 1K5NA 1BQHB 3V0HA 4CL7A 2K4AA 2ZG1A 5CZXD 4PJDE 2L0DA 2W95A 4HXAL 4YC2B 1MAJA 2C9RA 4I13B 4WI6A 1NLBL 1XCWA 3HLAA 3U46A 3UYPB 1GC1H 4YXHL 3D85B 3RY6A 1F86A 3MLYH 3WUWB 2WGXA 4TNEA 3KZ8A 4AZBA 4TN9A 3GIVB 1FNSL 4XWGH 4I3RL 4OAWB 1AY1L 1HHKB 1ZEAL 2GYSA 5HJ3A 3HNSH 5D6CB 4DP2X 4F7CA 2P26A 2LU4A 1BLNB 5DJZB 3ZDYE 1NDGA 4KIKB 5AVXB 5DURB 5KVEH 2UY6B 1RLBA 1MHHA 2FX7H 3BSZH 3II3A 1VRSA 4PB0L 1NCIA 3PWLB 1Z9SA 4NO5B 3OHXM 3V9EA 2F54B 3LNHA 3GLEA 5LKNA 4FL4C 3PP4L 2OJZH 2AEIT 2E6PA 5AQ0A 1RH8A 2C3GA 5CLTA 5J89A 2D4DA 2ZE0A 4AQ8C 4PI2A 3EJUA 3K1KC 5AZEL 3K6FA 2QLYA 3HC2A 4U1LA 5E1IA 2CK0H 5G2NA 1HJBC 3GRWH 2E27L 3GI8H 4KWUA 3EH1A 4FNLL 1BG9A 2VH5H 3L54A 4R90H 2VDPB 4D7BA 5BRZA 4TNGA 5IBUB 3BKYH 2YD4A 4IRZH 3OKOB 4RFNC 3S5LB 8FABA 3S35X 2GT9B 5D5MB 5DVMA 5I30L 3VFMB 2KLSA 2JQAA 5IB4A 2BSED 3MUJA 2V6HA 2CJTA 2HH0L 3WUZA 4HUUB 5CS7A 4ETQB