3QNIA

Crystal structure of human pacsin 1 f-bar domain
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
293
structure length
273
Chain Sequence
TTDSFWEVGNYKRTVKRIDDGHRLCNDLMNCVQERAKIEKAYGQQLTDWAKRWRQLIEKGPQYGSLERAWGAIMTEADKVSELHQEVKNNLLNEDLEKVKNWQKDAYHKQIMGGFKETKEAEDGFRKAQKPWAKKMKELEAAKKAYHLACKEEKLAMQDKVDKCKQDVQKTQEKYEKVLEDVGKTTPQYMENMEQVFEQCQQFEEKRLVFLKEVLLDIKRHLNLAENSSYIHVYRELEQAIRGADAQEDLRWFRSTSGPGMPMNWPQFEEWNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein kinase C and casein kinase substrate in neurons prot
publication title Crystal structure of human PACSIN 1 F-BAR domain
rcsb
source organism Homo sapiens
molecule tags Endocytosis
total genus 110
structure length 273
sequence length 293
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00611 FCH Fes/CIP4, and EFC/F-BAR homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 3qniA01
1WDZA 4I1QA 4AKVA 1I4TA 3DYTA 2RAJA 1I4LA 4FZSA 2RAIA 3SYVA 2Q12A 5C5BA 3Q84A 2D1LA 2Z0OA 3HAHA 3M3WA 1Y2OA 4DCNC 4H8SA 2EFLA 3ABHA 4DYLA 2D4CA 3CAZA 3LLLA 3Q0KA 3QWEA 4WPEA 3PLTA 3QE6A 1I49A 1X04A 4NSWA 2EFKA 3HAIA 3OK8A 2X3VA 2C08A 3ACOA 3I2WA 4NQIA 2RAKA 2Q13A 2Z0VA 2V0OA 1URUA 2X3WA 2FICA 3QNIA 4WPCA 1X03A 3HAJA 3SOGA 2ELBA 2X3XA 5C5BB 4BNEA 1ZWWA 2YKTA 3G9GA 1I4DA 4ATMA 2Z0NA 4AVMA
chains in the Genus database with same CATH superfamily
3O3MB 2RAIA 2YI9A 2F18A 1U00A 4DCNC 3QWEA 4JWCA 3B53X 4EZVA 2EFKA 1HWWA 3T47A 2YL9A 3I04A 4WPCA 4EZWA 4H6IA 4AZ7A 4AZ5A 3RV1A 2F7QA 3CKDA 2ND0A 1DKYA 2OBMA 2JNSA 3KAWA 2QXLA 3BUIA 2Z0OA 3DPQA 1YWMA 4EZQA 3ACOA 4HR1B 3EJTA 2YL5A 3LVTA 4EZSA 4EZNA 2RT6A 4B9QA 3CVRA 2WINM 4AZBA 1OAOA 3DDGA 5FLEX 1X04A 1OA1A 4JWIA 3T46A 1HTYA 2X3XA 3CV5A 4EZRA 2WYIA 4AZ6A 2RAJA 3M3WA 3LLLA 3D51A 4FZPA 3QE6A 3D4YA 3BVUA 2ND1A 4JNEA 3VEBA 3QNIA 3HAJA 4AZGA 2LXYA 1DKZA 2F7OA 1OA0A 1ZWWA 5TKYA 3BVWA 4JWDA 1SU8A 2YI8A 1I4LA 1SUFA 3BVTA 1JQKA 3I39X 3DPPA 1R34A 1LQ7A 2YLAA 4NQIA 2RAKA 3EJQA 1URUA 1TQWA 5C5BB 3EJUA 2YL8A 2F1BA 4AVMA 4EZYA 3ERCC 1TQUA 4AZIA 3Q84A 2QFFA 3B51X 2EFLA 3CZNA 3T48A 3HAIA 3OK8A 2C08A 4EZPA 3T4AG 1E1DA 2ELBA 3BUPA 3OHXM 4H6HA 3KAVA 3ER9B 2GA9D 1UPXA 3OWGA 3GI7A 3HAHA 3BLBA 2EX3B 3DX0A 1R33A 4D8JA 4AZHA 3FD9A 2FICA 2F1AA 4JLCA 3G9GA 2Z0NA 4HR1A 3B52X 1WDZA 2GF4A 4IWQA 3VEAA 2QKWA 2O0I1 4M0MA 3T49A 3O3NB 4R5JA 2Q13A 2ALWA 4EZOA 4E3CA 4IW0A 3BUDA 3QA8A 3DPOA 4KIKB 3DYTA 4AZCB 5KBPA 2D4CA 3BUBA 3PLTA 2Z0VA 4FZOA 3ZEDA 1GNTA 2WYHA 2YKTA 1GN9A 1TQTA 3DX1A 3EJRA 3LMFA 2OW7A 3CZSA 3A98A 2D1LA 4IWOA 3BUQA 4IM3A 2MI7A 2X3VA 2Z8YA 2EWFA 3D2EA 4HYBA 1I4DA 2F7PA 4IM0A 4E81A 1TQSA 4FZSA 5C5BA 4H8SA 3CAZA 3BVXA 3I2WA 2NCZA 5E84A 2PY6A 3O3OB 1DKXA 2F7RA 4IWPA 2YLLA 1W9MA 4DYLA 3RV0A 2PMRA 1I49A 4F00A 1PS3A 3D2FA 4JL9A 3RPMA 2FYVA 4EZUA 4R5IA 2ZXQA 2OW6A 4JNFA 1QWUA 1O7DB 4PO2A 3KDRA 4IM2A 1GNLA 2YL6A 2OO2A 4UDYX 3I01A 4JWEA 2LM0A 4UDXX 2GAFD 3D52A 4R5KA 3ER8C 1E9VA 1QX1A 4JN4A 1SU6A 5FIGA 4G6QA 4I1QA 4AKVA 4EZTA 2OBLA 2X5CA 4HY9A 3D50A 3F7WA 1QWNA 1MJGA 4NSWA 3DX2A 4KIKA 4AZCA 1HXKA 1X03A 3D4ZA 3L3PA 3DX4A 2KHOA 4BNEA 1TQVA 1R5EA 3DDFA 2JNKA 4ATMA 4NPHA 4R5GA 4EZXA 1I4TA 4EZZA 2Q12A 1Y2OA 3EJPA 3ABHA 3BVVA 3Q0KA 4F01A 4WPEA 3VKHA 4R5LA 2YIAA 2N3KA 2V0OA 2X3WA 3EJSA 1E2UA 4FM3A 2OZNB 1O7DC 3QNJA 3SYVA 2YIVX 1ZYLA 3L3OM 3DX3A 3UITA 3SOGA 1SU7A 2YIBA 3C7NA
chains in the Genus database with same CATH topology
1WDZA 4I1QA 4AKVA 1I4TA 3DYTA 2RAJA 1I4LA 4FZSA 2RAIA 3SYVA 2Q12A 5C5BA 3Q84A 2D1LA 2Z0OA 3HAHA 3M3WA 1Y2OA 4DCNC 4H8SA 2EFLA 3ABHA 4DYLA 2D4CA 3CAZA 3LLLA 3Q0KA 3QWEA 4WPEA 3PLTA 3QE6A 1I49A 1X04A 4NSWA 2EFKA 3HAIA 3OK8A 2X3VA 2C08A 3ACOA 3I2WA 4NQIA 2RAKA 2Q13A 2Z0VA 2V0OA 1URUA 2X3WA 2FICA 3QNIA 4WPCA 1X03A 3HAJA 3SOGA 2ELBA 2X3XA 5C5BB 4BNEA 1ZWWA 2YKTA 3G9GA 1I4DA 4ATMA 2Z0NA 4AVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WDZ A;  4I1Q A;  4AKV A;  1I4T A;  3DYT A;  2RAJ A;  1I4L A;  4FZS A;  2RAI A;  3SYV A;  2Q12 A;  5C5B A;  3Q84 A;  2D1L A;  2Z0O A;  3HAH A;  3M3W A;  1Y2O A;  4DCN C;  4H8S A;  2EFL A;  3ABH A;  4DYL A;  2D4C A;  3CAZ A;  3LLL A;  3Q0K A;  3QWE A;  4WPE A;  3PLT A;  3QE6 A;  1I49 A;  1X04 A;  4NSW A;  2EFK A;  3HAI A;  3OK8 A;  2X3V A;  2C08 A;  3ACO A;  3I2W A;  4NQI A;  2RAK A;  2Q13 A;  2Z0V A;  2V0O A;  1URU A;  2X3W A;  2FIC A;  3QNI A;  4WPC A;  1X03 A;  3HAJ A;  3SOG A;  2ELB A;  2X3X A;  5C5B B;  4BNE A;  1ZWW A;  2YKT A;  3G9G A;  1I4D A;  4ATM A;  2Z0N A;  4AVM A; 
#chains in the Genus database with same CATH topology
 3O3M B;  2RAI A;  2YI9 A;  2F18 A;  1U00 A;  4DCN C;  3QWE A;  4JWC A;  3B53 X;  4EZV A;  2EFK A;  1HWW A;  3T47 A;  2YL9 A;  3I04 A;  4WPC A;  4EZW A;  4H6I A;  4AZ7 A;  4AZ5 A;  3RV1 A;  2F7Q A;  3CKD A;  2ND0 A;  1DKY A;  2OBM A;  2JNS A;  3KAW A;  2QXL A;  3BUI A;  2Z0O A;  3DPQ A;  1YWM A;  4EZQ A;  3ACO A;  4HR1 B;  3EJT A;  2YL5 A;  3LVT A;  4EZS A;  4EZN A;  2RT6 A;  4B9Q A;  3CVR A;  2WIN M;  4AZB A;  1OAO A;  3DDG A;  5FLE X;  1X04 A;  1OA1 A;  4JWI A;  3T46 A;  1HTY A;  2X3X A;  3CV5 A;  4EZR A;  2WYI A;  4AZ6 A;  2RAJ A;  3M3W A;  3LLL A;  3D51 A;  4FZP A;  3QE6 A;  3D4Y A;  3BVU A;  2ND1 A;  4JNE A;  3VEB A;  3QNI A;  3HAJ A;  4AZG A;  2LXY A;  1DKZ A;  2F7O A;  1OA0 A;  1ZWW A;  5TKY A;  3BVW A;  4JWD A;  1SU8 A;  2YI8 A;  1I4L A;  1SUF A;  3BVT A;  1JQK A;  3I39 X;  3DPP A;  1R34 A;  1LQ7 A;  2YLA A;  4NQI A;  2RAK A;  3EJQ A;  1URU A;  1TQW A;  5C5B B;  3EJU A;  2YL8 A;  2F1B A;  4AVM A;  4EZY A;  3ERC C;  1TQU A;  4AZI A;  3Q84 A;  2QFF A;  3B51 X;  2EFL A;  3CZN A;  3T48 A;  3HAI A;  3OK8 A;  2C08 A;  4EZP A;  3T4A G;  1E1D A;  2ELB A;  3BUP A;  3OHX M;  4H6H A;  3KAV A;  3ER9 B;  2GA9 D;  1UPX A;  3OWG A;  3GI7 A;  3HAH A;  3BLB A;  2EX3 B;  3DX0 A;  1R33 A;  4D8J A;  4AZH A;  3FD9 A;  2FIC A;  2F1A A;  4JLC A;  3G9G A;  2Z0N A;  4HR1 A;  3B52 X;  1WDZ A;  2GF4 A;  4IWQ A;  3VEA A;  2QKW A;  2O0I 1;  4M0M A;  3T49 A;  3O3N B;  4R5J A;  2Q13 A;  2ALW A;  4EZO A;  4E3C A;  4IW0 A;  3BUD A;  3QA8 A;  3DPO A;  4KIK B;  3DYT A;  4AZC B;  5KBP A;  2D4C A;  3BUB A;  3PLT A;  2Z0V A;  4FZO A;  3ZED A;  1GNT A;  2WYH A;  2YKT A;  1GN9 A;  1TQT A;  3DX1 A;  3EJR A;  3LMF A;  2OW7 A;  3CZS A;  3A98 A;  2D1L A;  4IWO A;  3BUQ A;  4IM3 A;  2MI7 A;  2X3V A;  2Z8Y A;  2EWF A;  3D2E A;  4HYB A;  1I4D A;  2F7P A;  4IM0 A;  4E81 A;  1TQS A;  4FZS A;  5C5B A;  4H8S A;  3CAZ A;  3BVX A;  3I2W A;  2NCZ A;  5E84 A;  2PY6 A;  3O3O B;  1DKX A;  2F7R A;  4IWP A;  2YLL A;  1W9M A;  4DYL A;  3RV0 A;  2PMR A;  1I49 A;  4F00 A;  1PS3 A;  3D2F A;  4JL9 A;  3RPM A;  2FYV A;  4EZU A;  4R5I A;  2ZXQ A;  2OW6 A;  4JNF A;  1QWU A;  1O7D B;  4PO2 A;  3KDR A;  4IM2 A;  1GNL A;  2YL6 A;  2OO2 A;  4UDY X;  3I01 A;  4JWE A;  2LM0 A;  4UDX X;  2GAF D;  3D52 A;  4R5K A;  3ER8 C;  1E9V A;  1QX1 A;  4JN4 A;  1SU6 A;  5FIG A;  4G6Q A;  4I1Q A;  4AKV A;  4EZT A;  2OBL A;  2X5C A;  4HY9 A;  3D50 A;  3F7W A;  1QWN A;  1MJG A;  4NSW A;  3DX2 A;  4KIK A;  4AZC A;  1HXK A;  1X03 A;  3D4Z A;  3L3P A;  3DX4 A;  2KHO A;  4BNE A;  1TQV A;  1R5E A;  3DDF A;  2JNK A;  4ATM A;  4NPH A;  4R5G A;  4EZX A;  1I4T A;  4EZZ A;  2Q12 A;  1Y2O A;  3EJP A;  3ABH A;  3BVV A;  3Q0K A;  4F01 A;  4WPE A;  3VKH A;  4R5L A;  2YIA A;  2N3K A;  2V0O A;  2X3W A;  3EJS A;  1E2U A;  4FM3 A;  2OZN B;  1O7D C;  3QNJ A;  3SYV A;  2YIV X;  1ZYL A;  3L3O M;  3DX3 A;  3UIT A;  3SOG A;  1SU7 A;  2YIB A;  3C7N A; 
#chains in the Genus database with same CATH homology
 1WDZ A;  4I1Q A;  4AKV A;  1I4T A;  3DYT A;  2RAJ A;  1I4L A;  4FZS A;  2RAI A;  3SYV A;  2Q12 A;  5C5B A;  3Q84 A;  2D1L A;  2Z0O A;  3HAH A;  3M3W A;  1Y2O A;  4DCN C;  4H8S A;  2EFL A;  3ABH A;  4DYL A;  2D4C A;  3CAZ A;  3LLL A;  3Q0K A;  3QWE A;  4WPE A;  3PLT A;  3QE6 A;  1I49 A;  1X04 A;  4NSW A;  2EFK A;  3HAI A;  3OK8 A;  2X3V A;  2C08 A;  3ACO A;  3I2W A;  4NQI A;  2RAK A;  2Q13 A;  2Z0V A;  2V0O A;  1URU A;  2X3W A;  2FIC A;  3QNI A;  4WPC A;  1X03 A;  3HAJ A;  3SOG A;  2ELB A;  2X3X A;  5C5B B;  4BNE A;  1ZWW A;  2YKT A;  3G9G A;  1I4D A;  4ATM A;  2Z0N A;  4AVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...