3QNIA

Crystal structure of human pacsin 1 f-bar domain
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
293
structure length
273
Chain Sequence
TTDSFWEVGNYKRTVKRIDDGHRLCNDLMNCVQERAKIEKAYGQQLTDWAKRWRQLIEKGPQYGSLERAWGAIMTEADKVSELHQEVKNNLLNEDLEKVKNWQKDAYHKQIMGGFKETKEAEDGFRKAQKPWAKKMKELEAAKKAYHLACKEEKLAMQDKVDKCKQDVQKTQEKYEKVLEDVGKTTPQYMENMEQVFEQCQQFEEKRLVFLKEVLLDIKRHLNLAENSSYIHVYRELEQAIRGADAQEDLRWFRSTSGPGMPMNWPQFEEWNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis
molecule keywords Protein kinase C and casein kinase substrate in neurons prot
publication title Crystal structure of human PACSIN 1 F-BAR domain
rcsb
source organism Homo sapiens
total genus 110
structure length 273
sequence length 293
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00611 FCH Fes/CIP4, and EFC/F-BAR homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 3qniA01
3HAJA 3OK8A 4AKVA 4NQIA 4NSWA 1Y2OA 2D1LA 2RAJA 2Z0NA 2ELBA 2Z0VA 3QWEA 4FZSA 4I1QA 1I4DA 3HAIA 3PLTA 4DYLA 2Q13A 2C08A 3SOGA 4WPEA 2EFLA 4BNEA 1I49A 3Q0KA 3CAZA 3ABHA 4DCNC 1WDZA 2EFKA 5C5BB 2RAIA 4WPCA 1ZWWA 1I4LA 3Q84A 1URUA 5C5BA 1X03A 2FICA 3QNIA 3ACOA 3HAHA 3QE6A 3G9GA 1I4TA 2Z0OA 3I2WA 2YKTA 3M3WA 2Q12A 2X3VA 4H8SA 3SYVA 3LLLA 1X04A 4ATMA 4AVMA 2RAKA 2D4CA 2X3XA 2V0OA 2X3WA 3DYTA
chains in the Genus database with same CATH superfamily
2ELBA 2QFFA 3D52A 4I1QA 3CAZA 1GN9A 5C5BB 3D2FA 2OW6A 3DPQA 4R5LA 4EZZA 2Z8YA 1O7DC 3D2EA 4IM2A 3BUIA 4IM3A 2V0OA 2QKWA 2NCZA 2D1LA 3CVRA 3DPPA 2N3KA 4R5GA 1QX1A 1HWWA 4WPCA 4EZVA 1JQKA 3I01A 2JNKA 2OO2A 4E3CA 4JWCA 3D4ZA 2F18A 3QNJA 3ZEDA 4H8SA 3I04A 3LLLA 4NPHA 2YIAA 3CKDA 2YLLA 4D8JA 1TQWA 3ERCC 3I39X 4KIKA 3T48A 4JWIA 2WINM 3FD9A 1W9MA 3DDGA 5KBPA 4AZHA 4EZYA 3OK8A 1U00A 3RPMA 3BUQA 2Z0VA 4FZPA 3A98A 3EJSA 2C08A 4R5IA 3BVXA 1DKZA 2GF4A 3B53X 4AZ7A 4B9QA 3QE6A 1R34A 2YIVX 2X3VA 3KAVA 1TQTA 2F7QA 4JLCA 3QWEA 1TQUA 1I4DA 1GNTA 4WPEA 3DX4A 4BNEA 3Q0KA 2ND0A 2OZNB 3BUDA 4G6QA 3T47A 3CV5A 2RAIA 3D4YA 4E81A 3DX2A 4IWOA 5C5BA 3BUBA 2OBMA 3QNIA 2EWFA 3VKHA 4AZBA 2OBLA 3SYVA 2F7RA 3KAWA 2RAKA 3EJTA 1SU6A 4AKVA 1MJGA 1LQ7A 2YLAA 3VEAA 4DYLA 2F1AA 4HR1B 1GNLA 3ER9B 4PO2A 4HR1A 4EZRA 3L3PA 1SUFA 3LVTA 1SU7A 3LMFA 2FICA 3O3OB 3CZNA 2YIBA 1TQSA 2Z0OA 3DX0A 1R33A 2ALWA 3L3OM 5FIGA 4HY9A 2FYVA 3OHXM 3O3NB 4EZSA 1HTYA 1WDZA 2YL6A 2YI9A 4R5JA 3I2WA 5TKYA 2X3XA 3C7NA 3HAJA 4NSWA 1ZYLA 2X5CA 2JNSA 2EX3B 3D50A 1OA0A 3DX3A 3ACOA 3UITA 4IW0A 4NQIA 4F00A 2RAJA 2Z0NA 2OW7A 3RV0A 3T49A 4AZCB 3ABHA 3EJPA 1QWUA 1ZWWA 1I4LA 1PS3A 1R5EA 2WYHA 1HXKA 2WYIA 2PMRA 2F1BA 4AZGA 3BUPA 4H6HA 1YWMA 4F01A 1O7DB 1OAOA 1Y2OA 2ND1A 4M0MA 3BVTA 2PY6A 3VEBA 1OA1A 2YKTA 3BVWA 2ZXQA 4R5KA 3D51A 4FZSA 2YI8A 3OWGA 2Q13A 2GAFD 3Q84A 1URUA 4AZ5A 2LM0A 4IM0A 4IWPA 4FM3A 4FZOA 2KHOA 3CZSA 4EZNA 2RT6A 1E1DA 2YL5A 4IWQA 4DCNC 4JWEA 3B51X 2YL9A 4UDXX 3ER8C 3EJQA 3HAHA 4AZ6A 1X04A 1E9VA 4AVMA 2D4CA 2YL8A 1TQVA 2F7PA 2O0I1 3HAIA 1SU8A 3PLTA 4KIKB 3SOGA 4JL9A 1I49A 3B52X 3T46A 4EZOA 3G9GA 3M3WA 3KDRA 3EJUA 2MI7A 2X3WA 4JN4A 4EZTA 3BVVA 2LXYA 4JNFA 4EZUA 3EJRA 3QA8A 3DPOA 3DX1A 2EFLA 3F7WA 2EFKA 4AZCA 4H6IA 1UPXA 5E84A 2Q12A 3DDFA 1E2UA 3BVUA 4EZXA 3GI7A 2GA9D 4EZQA 4EZWA 3BLBA 1DKXA 2QXLA 4JWDA 4AZIA 4UDYX 1QWNA 1DKYA 4HYBA 5FLEX 1X03A 4EZPA 1I4TA 2F7OA 4JNEA 3T4AG 4ATMA 3RV1A 3O3MB 3DYTA
chains in the Genus database with same CATH topology
3HAJA 3OK8A 4AKVA 4NQIA 4NSWA 1Y2OA 2D1LA 2RAJA 2Z0NA 2ELBA 2Z0VA 3QWEA 4FZSA 4I1QA 1I4DA 3HAIA 3PLTA 4DYLA 2Q13A 2C08A 3SOGA 4WPEA 2EFLA 4BNEA 1I49A 3Q0KA 3CAZA 3ABHA 4DCNC 1WDZA 2EFKA 5C5BB 2RAIA 4WPCA 1ZWWA 1I4LA 3Q84A 1URUA 5C5BA 1X03A 2FICA 3QNIA 3ACOA 3HAHA 3QE6A 3G9GA 1I4TA 2Z0OA 3I2WA 2YKTA 3M3WA 2Q12A 2X3VA 4H8SA 3SYVA 3LLLA 1X04A 4ATMA 4AVMA 2RAKA 2D4CA 2X3XA 2V0OA 2X3WA 3DYTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HAJ A;  3OK8 A;  4AKV A;  4NQI A;  4NSW A;  1Y2O A;  2D1L A;  2RAJ A;  2Z0N A;  2ELB A;  2Z0V A;  3QWE A;  4FZS A;  4I1Q A;  1I4D A;  3HAI A;  3PLT A;  4DYL A;  2Q13 A;  2C08 A;  3SOG A;  4WPE A;  2EFL A;  4BNE A;  1I49 A;  3Q0K A;  3CAZ A;  3ABH A;  4DCN C;  1WDZ A;  2EFK A;  5C5B B;  2RAI A;  4WPC A;  1ZWW A;  1I4L A;  3Q84 A;  1URU A;  5C5B A;  1X03 A;  2FIC A;  3QNI A;  3ACO A;  3HAH A;  3QE6 A;  3G9G A;  1I4T A;  2Z0O A;  3I2W A;  2YKT A;  3M3W A;  2Q12 A;  2X3V A;  4H8S A;  3SYV A;  3LLL A;  1X04 A;  4ATM A;  4AVM A;  2RAK A;  2D4C A;  2X3X A;  2V0O A;  2X3W A;  3DYT A; 
#chains in the Genus database with same CATH topology
 2ELB A;  2QFF A;  3D52 A;  4I1Q A;  3CAZ A;  1GN9 A;  5C5B B;  3D2F A;  2OW6 A;  3DPQ A;  4R5L A;  4EZZ A;  2Z8Y A;  1O7D C;  3D2E A;  4IM2 A;  3BUI A;  4IM3 A;  2V0O A;  2QKW A;  2NCZ A;  2D1L A;  3CVR A;  3DPP A;  2N3K A;  4R5G A;  1QX1 A;  1HWW A;  4WPC A;  4EZV A;  1JQK A;  3I01 A;  2JNK A;  2OO2 A;  4E3C A;  4JWC A;  3D4Z A;  2F18 A;  3QNJ A;  3ZED A;  4H8S A;  3I04 A;  3LLL A;  4NPH A;  2YIA A;  3CKD A;  2YLL A;  4D8J A;  1TQW A;  3ERC C;  3I39 X;  4KIK A;  3T48 A;  4JWI A;  2WIN M;  3FD9 A;  1W9M A;  3DDG A;  5KBP A;  4AZH A;  4EZY A;  3OK8 A;  1U00 A;  3RPM A;  3BUQ A;  2Z0V A;  4FZP A;  3A98 A;  3EJS A;  2C08 A;  4R5I A;  3BVX A;  1DKZ A;  2GF4 A;  3B53 X;  4AZ7 A;  4B9Q A;  3QE6 A;  1R34 A;  2YIV X;  2X3V A;  3KAV A;  1TQT A;  2F7Q A;  4JLC A;  3QWE A;  1TQU A;  1I4D A;  1GNT A;  4WPE A;  3DX4 A;  4BNE A;  3Q0K A;  2ND0 A;  2OZN B;  3BUD A;  4G6Q A;  3T47 A;  3CV5 A;  2RAI A;  3D4Y A;  4E81 A;  3DX2 A;  4IWO A;  5C5B A;  3BUB A;  2OBM A;  3QNI A;  2EWF A;  3VKH A;  4AZB A;  2OBL A;  3SYV A;  2F7R A;  3KAW A;  2RAK A;  3EJT A;  1SU6 A;  4AKV A;  1MJG A;  1LQ7 A;  2YLA A;  3VEA A;  4DYL A;  2F1A A;  4HR1 B;  1GNL A;  3ER9 B;  4PO2 A;  4HR1 A;  4EZR A;  3L3P A;  1SUF A;  3LVT A;  1SU7 A;  3LMF A;  2FIC A;  3O3O B;  3CZN A;  2YIB A;  1TQS A;  2Z0O A;  3DX0 A;  1R33 A;  2ALW A;  3L3O M;  5FIG A;  4HY9 A;  2FYV A;  3OHX M;  3O3N B;  4EZS A;  1HTY A;  1WDZ A;  2YL6 A;  2YI9 A;  4R5J A;  3I2W A;  5TKY A;  2X3X A;  3C7N A;  3HAJ A;  4NSW A;  1ZYL A;  2X5C A;  2JNS A;  2EX3 B;  3D50 A;  1OA0 A;  3DX3 A;  3ACO A;  3UIT A;  4IW0 A;  4NQI A;  4F00 A;  2RAJ A;  2Z0N A;  2OW7 A;  3RV0 A;  3T49 A;  4AZC B;  3ABH A;  3EJP A;  1QWU A;  1ZWW A;  1I4L A;  1PS3 A;  1R5E A;  2WYH A;  1HXK A;  2WYI A;  2PMR A;  2F1B A;  4AZG A;  3BUP A;  4H6H A;  1YWM A;  4F01 A;  1O7D B;  1OAO A;  1Y2O A;  2ND1 A;  4M0M A;  3BVT A;  2PY6 A;  3VEB A;  1OA1 A;  2YKT A;  3BVW A;  2ZXQ A;  4R5K A;  3D51 A;  4FZS A;  2YI8 A;  3OWG A;  2Q13 A;  2GAF D;  3Q84 A;  1URU A;  4AZ5 A;  2LM0 A;  4IM0 A;  4IWP A;  4FM3 A;  4FZO A;  2KHO A;  3CZS A;  4EZN A;  2RT6 A;  1E1D A;  2YL5 A;  4IWQ A;  4DCN C;  4JWE A;  3B51 X;  2YL9 A;  4UDX X;  3ER8 C;  3EJQ A;  3HAH A;  4AZ6 A;  1X04 A;  1E9V A;  4AVM A;  2D4C A;  2YL8 A;  1TQV A;  2F7P A;  2O0I 1;  3HAI A;  1SU8 A;  3PLT A;  4KIK B;  3SOG A;  4JL9 A;  1I49 A;  3B52 X;  3T46 A;  4EZO A;  3G9G A;  3M3W A;  3KDR A;  3EJU A;  2MI7 A;  2X3W A;  4JN4 A;  4EZT A;  3BVV A;  2LXY A;  4JNF A;  4EZU A;  3EJR A;  3QA8 A;  3DPO A;  3DX1 A;  2EFL A;  3F7W A;  2EFK A;  4AZC A;  4H6I A;  1UPX A;  5E84 A;  2Q12 A;  3DDF A;  1E2U A;  3BVU A;  4EZX A;  3GI7 A;  2GA9 D;  4EZQ A;  4EZW A;  3BLB A;  1DKX A;  2QXL A;  4JWD A;  4AZI A;  4UDY X;  1QWN A;  1DKY A;  4HYB A;  5FLE X;  1X03 A;  4EZP A;  1I4T A;  2F7O A;  4JNE A;  3T4A G;  4ATM A;  3RV1 A;  3O3M B;  3DYT A; 
#chains in the Genus database with same CATH homology
 3HAJ A;  3OK8 A;  4AKV A;  4NQI A;  4NSW A;  1Y2O A;  2D1L A;  2RAJ A;  2Z0N A;  2ELB A;  2Z0V A;  3QWE A;  4FZS A;  4I1Q A;  1I4D A;  3HAI A;  3PLT A;  4DYL A;  2Q13 A;  2C08 A;  3SOG A;  4WPE A;  2EFL A;  4BNE A;  1I49 A;  3Q0K A;  3CAZ A;  3ABH A;  4DCN C;  1WDZ A;  2EFK A;  5C5B B;  2RAI A;  4WPC A;  1ZWW A;  1I4L A;  3Q84 A;  1URU A;  5C5B A;  1X03 A;  2FIC A;  3QNI A;  3ACO A;  3HAH A;  3QE6 A;  3G9G A;  1I4T A;  2Z0O A;  3I2W A;  2YKT A;  3M3W A;  2Q12 A;  2X3V A;  4H8S A;  3SYV A;  3LLL A;  1X04 A;  4ATM A;  4AVM A;  2RAK A;  2D4C A;  2X3X A;  2V0O A;  2X3W A;  3DYT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...