4AZ6A

Differential inhibition of the tandem gh20 catalytic modules in the pneumococcal exo-beta-d-n-acetylglucosaminidase, strh
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
435
structure length
435
Chain Sequence
SHNEKLAKKKIVSIDAGRKYFSPEQLKEIIDKAKHYGYTDLHLLVGNDGLRFMLDDMSITANGKTYASDDVKRAIEKGTNDYYNDPNGNHLTESQMTDLINYAKDKGIGLIPTVNSPGHMDAILNAMKELGIQNPNFSYFGKKSARTVDLDNEQAVAFTKALIDKYAAYFAKKTEIFNIGLDEYANDATDAKGWSVLQADKYYPNEGYPVKGYEKFIAYANDLARIVKSHGLKPMAFNDGIYYNSDTSFGSFDKDIIVSMWTGGWGGYDVASSKLLAEKGHQILNTNDAWYYVLGRNADGQGWYNLDQGLNGIKNTPITSVPKTEGADIPIIGGMVAAWADTPSARYSPSRLFKLMRHFANANAEYFAADYESAEQALNEVPKDLNRYTAESVTAVKEAEKAIRSLDSNLSRAQQDTIDQAIAKLQETVNNLTLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-N-ACETYLHEXOSAMINIDASE
publication title Inhibition of the Family 20 Glycoside Hydrolase Catalytic Modules in the Streptococcus Pneumoniae Exo-Beta-D-N-Acetylglucosaminidase, Strh.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
total genus 175
structure length 435
sequence length 435
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2012-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.90 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 AF1782-like 4az6A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4az6A01
1EQPA 3B9EA 4HZ8A 1VENA 2VO5A 5BCAA 1CDGA 3WD0A 2XG9A 3THDA 1JZ4A 1I75A 3NSXA 1JAEA 2NT1A 2YDSA 1DP0A 3CHCA 3POHA 4AIEA 3VTRA 1S46A 3AHTA 2QPUA 4AD0A 4GI6A 3A4WA 4AZCB 4LYPA 2BY2A 1PX4A 2D2OA 2DPEA 2G4FA 4AXNA 4BF7A 2OSXA 1BAGA 1H41A 4EANA 2VX6A 3FAXA 3TP4A 2DSKA 2A3BA 2CXGA 2WZHA 5M17A 3PZQA 2HISA 4PUEA 4DM2A 4UNIA 1UD6A 1IV8A 5GPRA 1J0JA 1FHLA 1VBUA 2YA2A 2EBNA 3GNOA 3ZIZA 2WHKA 4ZEPA 4PMDA 3K46A 2YA0A 1UWQA 2RGMA 1KQZA 2BS9A 4JHOA 1JD7A 4CN1A 2WM0A 3CUFA 3VM5A 1W3LA 5AYIA 1B0IA 3T0DA 4TTGA 3N11A 1B90A 3VGHA 2EPNA 1F4HA 1XSJA 2FDMA 2W4XA 3ZM8A 3M6DA 2OO2A 4F66A 2VZOA 1HJSA 1CTNA 2FHCA 2VRQA 3HJEA 1XV8A 2Q8XA 3T2PA 1VFFA 4MNMA 4LYRA 4QAWA 2WC3A 4AY1A 1XYFA 3SCPA 3CZJA 1D7FA 1CXHA 4HU8A 4MB1A 2VOTA 4ACZA 4R27A 4HP5A 5AYBA 3WH9A 5JBFA 4ATWA 1JFHA 5CXPA 4JKKA 1JGIA 2ZICA 4QP0A 5JUVA 3BGAA 1ISWA 2J74A 3WUBA 1SR0A 1KXQA 3WD3A 4PCTA 1TZ7A 4UQEA 1MVYA 3T2OA 1ECEA 2ZXAA 1W9XA 3WQWA 1C8XA 1A3HA 2J47A 2WWCA 3AFBA 3K8KA 1XYZA 4AIOA 3WDHA 5A6BD 1VFMA 5IFTA 2GJXB 1HP5A 5BWFA 4AD1A 3WQ4A 4D6JA 3ARPA 2WCGA 1B3XA 3MV01 4IM4A 1UH2A 2NT0A 1FA2A 3UCQA 4F79A 1ISXA 3WBAA 4E8CA 3CZGA 2WCAA 3W26A 4TX8A 4GPNA 5CLWA 1BLIA 4IPNB 1FH9A 1HKJA 3FXYA 3SIMA 1V6YA 1FFQA 1JZ5A 4E4PA 1E6SM 1H1NA 4PEEA 3WNOA 5A2AA 3FY1A 2JF7A 2CITA 5HDRA 2ZE0A 4F9DA 4CU8A 3VM7A 7CGTA 5IXEA 1ODZA 1LQ0A 4KH2A 3RM4A 4M82A 1GJWA 4HTYA 4TVUA 1VAHA 5M5DA 3CZKA 4AD5A 2E4TA 2JFEX 2PI6A 5E09A 4H8UA 4ZE4A 1V6WA 3L4XA 3WF0A 1DWIM 1JDAA 1X6LA 4ZXLA 4H8VA 2WLZA 4HPGA 1BPLB 4HOWA 4W87A 3VDBA 1V3JA 3CUIA 3W6MA 4JFUA 2UY4A 4UFLA 4HMEA 5E0CA 1UR8A 1BGGA 4GQRA 1PAMA 4UQDA 1VJZA 3LPOA 4JFVA 1B31A 2VQUA 5CGMA 1HJVA 4MADA 3IAQA 3VIHA 1EDQA 1GNXA 5ECUA 1H2JA 2BHZA 4AD2A 1B3WA 1CGUA 2DEPA 2OLHA 3WDRA 1WKYA 1OSEA 4UFKA 2W66A 2W63A 2BVYA 4U3AA 3OGSA 1VFOA 2IXVA 4W7UA 2GSJA 4AZ5A 3PTKA 4DWSA 5A2BA 3ARYA 3G6LA 2FHBA 1HNYA 2OSWA 4W88A 5BXRA 1HJUA 1R87A 2WBGA 1CZ1A 2AMGA 1IT0A 1GOOA 5I6SA 5ABFB 2XWEA 1QNQA 4GI9A 1HF6A 1H11A 1U30A 3PTQA 1KGWA 2GDVA 5D8ZA 3TONA 3ZT5A 3VKKA 4FZOA 1E71M 3TTQA 5HPCA 3QOKA 4D71A 1XC6A 3RJYA 3O2LA 2XVGA 5I78A 2VCCA 2QMJA 3VX0A 1J11A 1Q6EA 1Q4NX 1H5VA 1V3HA 4PMVA 4TTUA 4ACYA 3VIMA 1I1XA 2XVNA 1Q6DA 2FH8A 3WKZA 1ISVA 3I3BA 2QPSA 3ZOAA 4JL1A 1GOMA 1CXKA 1UR9A 3VDCA 4XUYA 1XHGA 1XCXA 4GKLA 1GZJA 3ARQA 3A4XA 3NDYA 3EYPA 1V6VA 2E3ZA 1BG9A 5I79A 1AVAA 4JL2A 1UZ4A 4KGJA 5DT5A 4TVCA 1B3VA 4Y7EA 5D8WA 2G3IA 1UD4A 3VU2A 4OBRA 2WNWA 3KWXA 1V08A 4Q22A 3SURA 2CYGA 3VGEA 5D9MA 1E6NA 1BYDA 4AMCA 4J27A 4PBGA 1TVNA 1ITXA 1JYWA 2YBUA 2VTFA 4XZWA 3CZLA 3TA9A 3VGFA 1CWYA 9CGTA 2ZUNA 3BAXA 1LWHA 5FL0A 2XGBA 1EHNA 2W91A 4H41A 1M01A 5KZ6A 1LL6A 1XD0A 2EPLX 1HKKA 1V02A 1UKPA 1C91A 1QI0A 4DWSC 4LYQA 5CPTA 3VDAA 3TTSA 1HN1A 1R7OA 2O92A 3QR3A 3CIVA 4PMOA 1KCKA 1MFVA 1LL7A 3AS2A 4JZ5A 3WL0A 3ZR5A 3VMOA 4AD3A 4AZBA 3ARZA 2ZUWA 3NJ3A 1L0PA 1MWOA 2YDRA 1NWTA 3WEMA 1J18A 1E4IA 1MW2A 2BXZA 4KWUA 3OLIA 1XCWA 4X9YA 5EFFA 1ZS2A 1H3GA 3VD9A 2B31A 3F5JA 4FK9A 5FKYA 4HMCA 3SCUA 3VINA 2ZXDA 2ZXQA 2D3NA 3AIWA 4A3HA 5I0DA 4NSBA 5A3HA 3AZTA 3AXXA 1E56A 2V5CA 5CSYA 1SYTA 1EO5A 1NP2A 1JZ6A 3ZJ6A 4P7LA 2X2YA 1HP4A 4JAWA 4MPKA 2WKLA 1WNOA 4XX6A 2WVVB 3GM8A 1VEOA 4B9YA 4FZPA 3B9DA 2DH2A 4PMYA 1GHRA 2G3NA 1JF6A 1ISYA 4PMRA 5IDIA 3DECA 3WDQA 1W1PA 4HPHA 2Z1KA 1EQCA 3WF2A 3PZ9A 3NSNA 3PZIA 2ZUMA 2D0FA 1XH2A 3ZJ7A 2XFYA 1WZKA 3D5HA 3N15A 4XV0A 4D6FA 3MMUA 4M29A 3T2QA 1OCQA 2J7BA 2J8FA 2J7CA 3BCFA 4CN4A 2X0YA 4AZHA 1XGZA 2JALA 3LPFA 2EPOA 1XSIA 1H0IA 4UZSA 2VZTA 5BRPA 2D3LA 2J7EA 1KQYA 3I3EA 2WK2A 1RH9A 3DC0A 1NOFA 3PZGA 4DUXA 4MAZA 4AC1X 2ZUSA 4CVUA 4D6HA 1JZ8A 3II1A 1K9TA 4A3YA 2VRKA 4YPJA 4QLLA 2XTKA 4UZUA 5M03A 1UHVA 2A3HA 2BHUA 3VVGA 2ZX9A 3QHOA 1ZBVA 3ARTA 3GXIA 5A8QA 2WPGA 1SFSA 3ALGA 1JFXA 3GH5A 4QLJA 1EDGA 1BYBA 3EMZA 1BVNP 2XFRA 4PRWA 3WUFA 3NDZA 5A94A 1UZ1A 3WDIA 1LLOA 1DWFM 1PEZA 2VL4A 2GJPA 3ZJ8A 3NYDA 2O9PA 2J79A 3UR8A 2EJ1A 3WD1A 4YHGA 3M7SA 4DUVA 4CU7A 1DWHM 1B3ZA 1MXDA 4J3WA 4QFUA 3WELA 1RP8A 2O9TA 3WDPP 1GOWA 2F8QA 3MKKA 1UR4A 4U2ZA 3GXDA 3W0KA 2WSPA 3W82A 4JCLA 1E0WA 1JNEA 1FFRA 4BZYA 3AZSA 1OT1A 2VURA 3OLGA 1W91A 3ZQ9A 3WFZA 3WH5A 3S2CA 4RE4A 4CVWA 3VD5A 2A3EA 2MANA 4PMZA 1SMAA 1XD1A 4WIWA 1B9ZA 2OWXA 4UTFA 3MUAA 1UH4A 1OIFA 3N1AA 3RM8A 3N18A 1CNVA 2DT0A 2V3EA 4LQ1A 2BVDA 1QI3A 3VO0A 1W9BM 3RIKA 1GW1A 1RD6A 3EDKA 2PBGA 4MJ2A 1W9UA 3AI0A 3WNMA 1GHSA 2GK1A 3VMPA 2NSXA 1E4LA 4L4OA 2JE8A 1JZ3A 4E8DA 4D6IA 1J12A 5I77A 1GORA 3MSGA 1C7SA 2V3GA 2VC9A 2W62A 1QHOA 1E1FA 2V5DA 4B16A 2Y8KA 2YA1A 1KGXA 2X1IA 3OG2A 3AISA 3SUTA 3MU7A 3PTMA 3VOCA 2JEPA 4OBSA 3UG4A 1KCLA 2WAGA 2GJRA 2J77A 3W37A 2PC8A 3AS1A 1KFWA 4HU0A 4JFSA 5F7UA 1AQHA 1GVYA 3A3HA 2CBVA 1PBGA 4UOZA 1FH7A 1CXIA 1BF2A 3NUKA 3L4WA 2ZX7A 2YLLA 4P8VA 5BXPA 1OD0A 2CBUA 5GNZA 3IAPA 8A3HA 2VZUA 2XWDA 4F8XA 1DTUA 4W93A 5HNNA 4TXEA 4B15A 3PHAA 5A6MA 2YLAA 1W32A 5EB8A 4N0RA 3IJ7A 1Y7VA 2CPUA 2BVTA 3WNKA 3NCOA 4EK7A 5A8PA 5AY7A 2ZUUA 3OLEA 3MUY1 4GZIA 3OGRA 5CZKA 1G5AA 1DHKA 1W9PA 3MS8A 2CNCA 4N42A 1UA7A 2WANA 4GIAA 4DWSB 2D23A 4UFMA 3WSUA 3CMJA 4BQ2A 3SUUA 2JNKA 4W85A 1C90A 1JNDA 4HZ7A 4AZCA 1E4NA 4FLQA 4TOQA 3B9AA 3EBVA 1WDPA 2DSUA 4GQQA 4YN5A 4JKLA 1CXFA 2J7FA 3O9NA 1O7AA 1UKTA 2X05A 1K9FA 2CESA 1W3JA 4KGLA 1HJWA 2PB1A 2OWCA 3T08A 2CBJA 3SCWA 4D72A 3LMYA 2EPKX 2YDQA 2WHLA 3CZ8A 1JXJA 1VBRA 2D0HA 4BQ5A 1BYCA 2CEQA 4GI8A 4JCMA 4PMXA 2ZWYA 3T09A 2D22A 1VEMA 5IFPA 2A3AA 3BMWA 2CETA 5JBDA 3QHNA 1UD2A 4ATLA 4RL3A 5DO8A 5KEZA 4DWSD 3W38A 2WLYA 2DIJA 2WW5A 1GOKA 3BH4A 2WZIA 4UFJA 4M1RA 4PMQA 4M81A 4D1JA 1GQIA 4PMUA 3F5LA 2O9RA 1WO2A 3OLDA 2VQTA 2DGAA 4QDMA 3AHXA 3SCVA 5C71A 1MW3A 1KBBA 1WP6A 4Z2KA 1G1YA 4D6CA 1OGSA 3VMNA 2XFFA 4QCFA 3QHMA 1HVXA 1CBGA 4X0VA 2C8NA 3SCQA 2ZIDA 1HKIA 2E0PA 4JKMA 2CIPA 1I1WA 5JBEA 1TUXA 3VILA 1RP9A 2UY5A 4W5ZA 3L4ZA 2XVKA 5LA2A 5BRQA 2QV4A 4OUEA 3ARUA 1FOBA 1V03A 1VB9A 4UFHA 4UQAA 1L8NA 1QNSA 3W24A 3ZT7A 1JYVA 1EH9A 1NH6A 3GZAA 4U5KA 2VX5A 2WMFA 3MUZ1 4RE2A 1BTCA 1U2YA 3F5KA 2OYLA 2UY3A 2GFTA 3EMQA 2DT2A 5HPOA 2CBIA 3IANA 4M8UA 5EMYA 1WAWA 4AIUA 4M80A 2J7HA 3RDKA 4KRTA 1WZLA 4XZBA 1HJQA 5D4YA 3PZUA 2E40A 2ESCA 4X0NA 3VD7A 1D2KA 4GXPA 3BSGA 2W67A 3IK2A 3E1F1 3MO4A 4R5EA 1VIWA 3PZTA 3AIQA 1HKMA 2BFGA 4PYSA 1EOMA 4PSRA 1C7TA 4PTWA 4MNKA 3OB8A 1WB0A 1UKQA 4E2OA 1J9YA 4J3TA 4GZEA 5CSUA 3CH9A 3CHDA 3KE0A 2RGLA 1R7AA 5A69A 2DSWA 1GOIA 3WMCA 2XGIA 1EGZA 2WC4A 1JL8A 3DYPA 1ZBKA 2DT1A 1VJSA 2E9MA 3T0BA 1J10A 2WCSA 1V0NA 4GO9A 4C7FA 3BLKA 1ODUA 3VPLA 3RJXA 3AMDA 3UEQA 1KXHA 2GVYA 1ISZA 5FOOA 5ABEA 2WMIA 3BSHA 3L4UA 2YL5A 1WPCA 4NRRA 1FP9A 4MTVA 1H49A 4W7WA 4DM1A 5A8OA 3M07A 3VIPA 1E55A 2Z1SA 3PN8A 1KXVA 4M24A 4EE9A 2QLYA 3EDEA 1OWQA 2XIIA 1LL4A 1V0LA 1VRXA 1OGGA 2UY2A 3BAIA 2CERA 3VIIA 1OGBA 3AHZA 5CJ5A 5EFDA 4UCFA 1ZBWA 4AD4A 1XH0A 4U2YA 2XM1A 5CPSA 1UWTA 2XVLA 1AMYA 2X0HA 5BYWA 3GDBA 3WNNA 4ML4A 2JIWA 4PTVA 1GQKA 4J3SA 3KL3A 4Z2JA 2A3CA 1E4MM 3FHAA 5E9AA 3ZSTA 1M04A 3WUEA 1E6XM 4HMDA 4LGXA 3UG5A 8CGTA 3M46A 3RILA 3VIGA 4CCDA 3N12A 1GONA 4IPLA 3DYOA 4TX6A 4J28A 3MMDA 1E6PA 2WKGA 1DWJM 3AMCA 5D9PA 1J0HA 1NWSA 4NF7A 1C8YA 1TA3B 3GYCA 4H7VA 1B1YA 7TAAA 4H8HA 1UWUA 3CZEA 1ZJBA 4PCSA 4PTMA 4AZ7A 3MANA 3RO8A 3VNYA 2E8ZA 3VD3A 1UWSA 5GQBA 4W7VA 4K68A 4J3XA 1JYNA 1PIFA 4PUDA 2IXUA 3EMCA 1LG1A 3AIVA 4S3JA 2EPMX 5CQ1A 1PZ3A 5EBAA 4F9JA 4J3VA 1V3LA 3K8MA 1CGTA 4HA4A 4IISA 1W2VA 1DEDA 4MJ4A 2J4GA 3WQ6A 1HJXA 3QOMA 1Q6CA 4NI3A 2XUCA 5LA1A 1NWUA 5CPQA 2ZOXA 2VJXA 2WSKA 5I2UA 1E73M 3UERA 3W81A 1NWRA 1QI2A 3BAKA 3MMWA 1SMDA 5A8NA 1E72M 4AW7A 2EEXA 5FCZA 3UR7A 1KWGA 3PBGA 5E6ZA 4AZ6A 3KZSA 4RE3A 4GZJA 3NIYA 1W1YA 1B2YA 1GJUA 1E0VA 2JIEA 3A47A 4CD7A 5DFAA 5I5RA 4FLRA 1X6NA 4ZE5A 3THCA 1QVBA 1QOXA 6TAAA 2WMKA 4OKDA 2J8GA 2GK1B 4CCCA 5D9NA 3K4AA 5AC5A 2VRJA 3VGGA 4B9ZA 2VI0A 2WVUA 3KL5A 3ARSA 2WC7A 4B3KA 2XVPA 5I24A 1ZU8A 2D1ZA 2XHYA 1BQCA 1WCGA 3OGVA 2WMHA 1EDTA 4PMNA 1CIUA 2HVMA 1E1EA 1GUVA 2CCRA 5A1AA 1MQRA 3CUHA 2VX7A 2J25A 4FF5A 3WQ5A 3AIUA 3BCDA 3MUIA 1UD3A 2E9LA 1V3IA 4GO8A 1MQQA 2WYSA 1G9HA 2WBKA 1DWGM 1GOQA 4U33A 1OT2A 1UKSA 1UWIA 2VCBA 4U31A 4LPCA 1US3A 2DSVA 3WY1A 1J01A 1IZJA 5HXMA 4ACZB 2W61A 1JZ2A 1KB3A 3OIHA 1UD8A 4V2XA 1CPUA 4CCEA 4EAMA 1JDCA 2XIBA 5FIPA 1M7XA 4ZFMA 4AEEA 3WENA 3WD4A 1NQ6A 2WMGA 2XPKA 3WMSA 4XB3A 4FLOA 3OZPA 3A6OA 2BY3A 4C7DA 5BROA 3GBEA 4WLCA 3OA5A 1CECA 1CYGA 2VX4A 5IHRA 1QI5A 2FH6A 1UKOA 2WXDM 3ZO9A 3AMGA 2DSZA 4JFWA 3WL1A 4WJXA 5A2CA 5A6JA 1OM0A 3K4DA 3CHFA 2PWFA 1FH8A 4M56A 1ZL1A 4CD8A 4D6DA 4IUGA 3WIJA 5LYRA 1GCYA 1W9DM 3WF3A 4HA1A 2YBTA 3SCNA 1LWJA 1E70M 2CHNA 3N04A 4UFIA 4UQCA 2OZNB 2XM2A 1N82A 1ESWA 1CGVA 2CKSA 2VUYA 1QNRA 5E6YA 1Q6GA 1GQLA 3GTNA 4P7OA 1P6WA 4V28A 3T0AA 4AEFA 2G3JA 4D1IA 2XSBA 4NZCA 3ZT6A 2G8ZA 3GNRA 1K6AA 3SUSA 1PX8A 1W3KA 4BS0A 3KEHA 1AQ0A 4WKAA 4OOUA 4P8XA 1JF5A 2W92A 4U5IA 2J7DA 1KWKA 4OIFA 2VCAA 2VR5A 4ATDA 2YIHA 3FAWA 1UQZA 1CEOA 3CGTA 1E5JA 2YKKA 5JIWA 3BLPX 1Q6FA 1EHAA 1W2PA 4KMQA 4YHEA 3UESA 4BQ4A 2YL6A 2PF0A 1EO7A 2Y8VA 4Z2LA 1JG9A 3AMLA 1O6IA 1D3CA 3RM9A 3EDJA 4AWEA 3WEOA 1M53A 3ARVA 4TUFA 5ABHA 1HXJA 3GXFA 3CLWA 3WH6A 4U3CA 1UR0A 3L2MA 2XJ7A 3MV11 1E6ZA 4JIEA 2VR4A 1QNOA 4J7RA 4FLSA 3VDHA 1UYQA 4QLKA 3WF4A 2JEQA 4CD4A 2FGLA 3CO4A 2V3DA 3W6LA 2C7FA 3WH7A 1CGWA 1HVQA 3U5UA 1H0GA 3O6AA 4D6GA 4BCEA 4V27A 4W89A 1W3HA 1QHPA 2C0HA 2VMFA 1XSKA 1OBAA 5A6AA 2OSYA 3SUVA 1H4PA 2BY1A 4HOXA 1BVZA 1CXEA 1QBBA 3AICA 1VF8A 5JIPA 2GDUA 4UOQA 1G01A 1EA9C 1FHDA 2Y24A 3L4VA 1E3XA 3CBWA 2VVNA 3AYRA 2WHMA 1U33A 4PTXA 3BAJA 1BG4A 1YQ2A 2WVSA 2G3MA 1YHTA 5M3WA 1UH3A 3WFLA 3N9KA 3VD4A 3IJ8A 5E0FA 1WDQA 4S3KA 2GUYA 2PMRA 4OJYA 1J0YA 2FGZA 4W8LA 1H09A 2D20A 2D0GA 1MYRA 3AOFA 3AXHA 3FN9A 3FW6A 5TD4A 1NM9A 5D9OA 3A4AA 5A6BA 1V3KA 1F4AA 1GQJA 3U5YA 3CUGA 3DYMA 3HU7A 1DWAM 2J7GA 3W28A 1CLVA 3BAWA 1LJYA 3GNPA 3IJ9A 4L4PA 1JDDA 3ALFA 3L4TA 5DMYA 3SCSA 1V0KA 3WBEA 1TMQA 3U7VA 3UG3A 2BHYA 2EO7A 2AOSA 1KBKA 2WVTA 3AIRA 2BV9A 3NSMA 2WMIB 2X09A 3BMVA 5FL1A 4P7RA 1WDRA 2BY0A 2WMJA 3GH4A 2ZXBA 4GINA 1C8QA 4KRUA 1E3ZA 1CLXA 1QPKA 1QNPA 5GNXA 3ZSSA 5BXSA 2DH3A 4Z2IA 1MQPA 1ZB5A 3SCTA 1GVIA 4CKQA 5CGTA 2OWWA 1UUQA 3CHEA 1C3FA 1E6RA 2GJXA 3DHUA 4WKHA 4P8UA 1QHZA 3AHVA 1OINA 3L4YA 3B8SA 1BFNA 3S6TA 2TAAA 3VIJA 1M03A 3AIBA 1G94A 3ARWA 5HOSA 4BA0A 3I3DA 3SEPA 4CGTA 3WN6A 1V3MA 3WDJA 1TFVA 4P8WA 3AS0A 2DIEA 6A3HA 4MB4A 3W27A 1QW8A 3ECQA 3WNLA 2ZX5A 3WEZA 3ARRA 3W29A 1US2A 1PZ2A 1RPKA 4P7NA 4B3LA 4A4AA 5LA0A 1NP0A 3AIEA 2ZUTA 2DDXA 3AXIA 1OB0A 4TVDA 5IHSA 1W1TA 1CGYA 2WB5A 3AYSA 4WSKA 4WKFA 3VIFA 4Z2HA 1JI1A 3SCRA 1R85A 3OZOA 4LXFA 4MNLA 1NOUA 5DEZA 2QMKA 4CU6A 4HOZA 4MDOA 4CN6A 1WZMA 1V02E 1UG6A 2IUZA 2NW0A 2CKRA 3VGBA 3PZVA 4AYSA 2PWDA 1ZJAA 1UQYA 3OBAA 2VZVA 1KR0A 2EQDA 2YL8A 3WH8A 1G0CA 1HT6A 1UOKA 2J75A 1FP8A 3PZMA 1JAKA 1B3YA 1LF1A 2J62A 4W84A 1V6UA 3ARXA 1E9LA 1XRVA 1CXLA 3GXMA 1CENA 1CGXA 2O9OA 4P7QA 3SUWA 3HN3A 1MXGA 4D6EA 4PN2A 3TTYA 5DT7A 2VT0A 3AZRA 4UOJA 4EKJA 1QW9A 4QCEA 1OIMA 3N17A 3PZOA 1BSIA 2ZWZA 1WZAA 3DHPA 3AMKA 2UWFA 1LG2A 3VIKA 5HBFA 1J0IA 4NRSA 4CD6A 1JXKA 2AAAA 4FMVA 5A6SA 1MFUA 1PIGA 2DT3A 2VVSA 1TR1A 1PPIA 2YL9A 3LPGA 3K8LA 3W53A 1K9DA 2BNJA 1HL8A 4HA3A 1E15A 1W9VA 5ABFA 1JYXA 3AS3A 2PBOA 5I23A 1KGUA 2CHOA 1V6XA 1J0ZA 4H2CA 3ZJKA 1EXPA 4C7GA 2XSAA 6CGTA 2OYMA 3CPUA 5A6LA 1R8LA 7A3HA 3AHYA 3WNPA 3L2LA 3RPMA 4URIA 2PWEA 3VX1A 2Y2WA 3LPPA 2PWGA 1Z32X 4LX4A 3EDFA 5I3DA 1QBAA 1TCMA 2W5FA 3JUGA 3PZNA 2F2HA 2XYLA 2F61A 2WZEA 4ZENA 5CG0A 4CUCA 2FHFA 2JF6A 5C70A 1C92A 4Q7NA 2D24A 4MB3A 3VNZA 1WE5A 3WQVA 3GBDA 4JHZA 2VZSA 3EDDA 3WF1A 4MAVA 4AZIA 2QHAA 4W5UA 3AQUA 1W1VA 2ZX8A 1GPFA 3VGDA 2VNCA 3HMCA 2Y5EA 2YOCA 3N13A 4MDPA 3GH7A 1UD5A 2PWHA 5FD0A 4J3UA 1QI4A 4W8AA 3WD2A 3TOPA 2EXOA 3POCA 4MNJA 5A6KA 2QF8A 4BQ3A 1VEPA 3QGVA 1JIBA 3TTOA 4W86A 4H04A 5C8BB 1E40A 2WWDA 5ABGA 4JFTA 4MB5A 1R86A 2BXYA 1TE1A 1KR1A 2X8RA 1NARA 2YJQA 1C93A 2E9BA 1JD9A 2ZUVA 2E8YA 1JI2A 4ZXOA 3ZR6A 4OZOA 3CUJA 2V3FA 5A8MA 1BYAA 5BXTA 1AQMA 4AZGA 3FHQA 4UR9A 1HIZA 3BXWA 3WMBA 1HL9A 1UR1A 4PSPA 3BC9A 3UETA 1EIBA 1UWRA 3ZMRA 1KXTA 2G41A 4Z2GA 5DF0A 5CLTA 2WHJA 1EOKA 4AISA 4CD5A 1HX0A 5E70A 1PJ9A 3CTTA 1BHGA 3K1DA 3RMEA 3FNDA 1NOWA 4HZ6A 1OD8A 1JZ7A 3F4VA 3G6MA 1MW1A 3D3AA 5GNYA 4W8BA 3VIOA 2J78A 1MW0A 3MSDA 1E5NA 3WQ8A 5A95A 3BAYA 4DUWA 1VFUA 1BGAA 3AROA 1E0XA 1J0KA 3APGA 4UQ9A 1E43A 1ZBCA 4UQBA 5AC4A 1V0MA 3SCOA 3VUPA 3KL0A 1TA3A 3RCNA 1X1NA 2ZX6A 3U57A 4OOZA 1A47A 1E6QM 1ITCA 4WSJA 1XH1A 3W25A 3AJ7A 1UR2A 2Y4SA 1PX3A 1IZKA 3U7BA 3WUGA 1WDSA 2DQXA 2V38A 4WK9A 1K9EA 2OYKA 4WF7A 1UA3A 2WVVA 1TVPA 1TG7A 3CMGA 3J7HA 1B30A 3W4RA
chains in the Genus database with same CATH superfamily
3B4YA 4H9ZA 3B9EA 2NZLA 2VO5A 2XZ9A 2OJPA 3FEMA 4H83A 5TIMA 3ANUA 1S5TA 4M6VA 2OT0A 2BDQA 3CHCA 1OFQA 3POHA 2HK1A 3U48A 4AD0A 4GI6A 4AZCB 2BY2A 2R94A 1PX4A 4LV4A 2V9DA 4AXNA 2OSXA 2WM1A 3PUOA 4X9SA 4EANA 1VS1A 2VX6A 3H2NA 1F7BA 1AK5A 1VHNA 3PZQA 2ZZ1A 1DQXA 5EKYA 4JICA 1IV8A 1URUA 1DL3A 1VBUA 2WHKA 3M43A 2G50A 3H54A 1A5NC 2BS9A 1OFAA 4JHOA 1JD7A 1EF3A 4RR4A 4CN1A 4BI5A 4E4UA 3CUFA 1EC8A 1I4TA 2FIQA 1GG1A 1TQWA 1B90A 2EPNA 3HFYA 4L1XA 1F4HA 1XSJA 4KW2A 3M6DA 2OO2A 2VZOA 3D2FA 4K39A 3V18A 2Q8XA 2JKAA 1VFFA 2PGFA 1OYBA 4NJGA 1SUXA 4WDXA 2BX7A 3JW7A 3LNPA 2J24A 4AY1A 2BGQA 3A4JA 4JX6A 1CXHA 4HU8A 4MB1A 3ABSA 4R27A 3MW7A 5AYBA 3WH9A 3H12A 3RAOA 3M0LA 5CXPA 1JGIA 1A5AA 1BVWA 2ZICA 4LRTA 4QP0A 5JUVA 3BGAA 3WUBA 4XSMA 1JUBA 1SR0A 3IJ6A 1ECEA 3OZYA 4MSSA 4ERAA 3WQFA 3AFBA 4QJ3B 4LAMA 3UT0A 1XYZA 1JCXA 5IFTA 1AJZA 4QDWA 1E9ZB 3C2RA 3WQ4A 2BSLA 7PTDA 4D6JA 3ARPA 4S38A 3MV01 4IT1A 4IWPA 2GVGA 4YMZA 4E8CA 4DPPA 3NZRA 4HD5A 3GX9A 3I7RA 4O13A 3RPDA 3FK4A 5CLWA 2V0OA 1XM3A 4E4PA 4MWAA 2NQHA 4KWOA 1IR2A 2ZE0A 4QITA 3PF3A 1O1ZA 3G5EA 4GGBA 3ITOA 4KH2A 4KQNA 2AGKA 4TVUA 4KS0A 3IUHA 3KLLA 4A05A 3EPOA 1XFBA 1DIDA 4ICMA 5BU9A 5E09A 4ZE4A 2P0OA 4UTUA 1JDAA 3DX3A 1NDWA 2WLZA 4HOWA 4W87A 3VDBA 3COTA 4OWGA 3Q84A 1R38A 5XINA 3UGRA 3RPTA 1L9WA 2F6KA 2C15A 1I4LA 2UY4A 1MUCA 4B90A 1ICSA 4MPQA 1IT7A 4F0MA 1UR8A 4R33A 4AY7A 4I9TA 2VQUA 3ONBA 2VGGA 4MF4A 5CGMA 3M6YA 4DYJA 1KA9F 4ZVJA 3MKVA 5ECUA 1UPMB 1YDNA 4GJ1A 3SQLA 2DEPA 3USBA 1TQJA 3KBMA 3WDRA 4UFKA 1PTGA 2W66A 4RZ5A 2BVYA 3OGSA 1JR1A 2GSJA 3MZ2A 3NEHA 4AVNA 4ADUA 3PK7A 4W88A 2XGZA 5BXRA 3RF9A 2A7RA 3FOKA 4MYAA 4GISA 1R87A 3W1TA 1CZ1A 4FR6A 1KTNA 3VKDA 1YXYA 2OQHA 2FZDA 5CBIA 1SFTA 3O6DA 5KMYA 1OC6A 3W22A 1JPKA 1XWYA 1KGWA 5D8ZA 3ZT5A 2ZRYA 2F84A 1AJ2A 2Z7GA 5I78A 3ITTA 3QV8A 3SRHA 3T46A 3DHFA 3L5LA 5F4WA 1V3HA 1W5MA 4MZ8A 2KHOA 1TPFA 4TTUA 2FZNA 3V1HA 1Q6DA 3KHJA 2EKGA 3ZOAA 4M0MA 1GOMA 3TXVA 1ZQ5A 4MUPA 5HR7A 4QG8A 3UJ2A 3NDYA 4GNJA 2E3ZA 1EEXA 3FJ4A 2PLCA 5BOFA 1PTDA 4FO4A 1UZ4A 2CLKA 1K8ZA 4IIGA 3JS3A 1TELA 5I3JA 3LGGA 3SURA 1EXBA 3M7WA 2Y7EA 5G1YA 5LIXX 4HCHA 3R43A 4PBGA 1TVNA 1ITXA 2OR2A 2QVNA 1IGSA 4XZWA 3VGFA 1CWYA 4PCPA 3W01A 5C6MA 4IM2A 1LWHA 2NLYA 1KV8A 4HHLA 1GVOA 2XGBA 1EHNA 2W91A 4H41A 1M01A 2OODA 5KZ6A 3N6JA 1V02A 1UKPA 2HPMA 3CC1A 3WLQA 1KRCC 3NYZA 3D47A 2PDIA 3ABZA 3AS2A 1GN9A 3WL0A 1RA0A 2ISFA 3NR0A 1ADOA 2ZUWA 2XN2A 3PAJA 1A5LC 4GYKA 3KBWA 4ZQCA 4B5SA 2ZZ6A 4HPXA 2H6RA 3WEMA 1P0EA 2Y7FA 1MW2A 2C14A 3QKEA 3NGFA 2QJIA 4KPLA 3OLIA 3VCNA 4X9YA 3PUDA 5EFFA 1ITQA 4GYPC 3GFYA 3PBWA 4RW3A 1LYXA 1E9IA 2B31A 5JMUA 1S2UA 4UIOA 3AXKA 4JTCA 3VINA 5D30A 2ZXQA 2NXIA 1R6WA 3I7SA 1SYTA 3FYYA 1S2CA 1Z48A 3ZJ6A 1OC7A 4XZHA 2Z0OA 7REQA 1HXKA 4CQCA 4NZ5A 3S9YA 4MPKA 3TW6A 1A50A 4XX6A 2FMNA 3PB2A 4PMRA 5C0QA 2F7QA 3PZ9A 4X2PA 4YIWA 5G2IA 2VR2A 3T2QA 2J7CA 4M6PA 3VC6A 3TOYA 3MBFA 4AZHA 2ZZ5A 1G4TA 3S46A 3JR2A 3TKFA 1XQKA 3FS2A 3T55A 1N55A 3QN3A 4PR4A 1BXNA 1UPXA 1LM1A 2D3LA 1KQYA 5LIKX 1NOFA 3PZGA 3ABQA 4GIEA 3S4TA 1K9TA 1PHWA 3WJYA 3PC0A 3B97A 4LUTA 4QLLA 3UYCA 3KX6A 1UHVA 3BARA 2A3HA 3LCIA 1PTAA 1TR9A 3KWSA 3GXIA 3KAOA 1W1B1 5HWMA 5H6HA 1FQ0A 1PZ0A 2G95A 3W87A 3EMZA 4ZO9A 5DRIA 3BVXA 1DE6A 2XFRA 3LBMA 2EAWA 1PIIA 1FBAA 5HUOA 4PRWA 3WUFA 2Z8YA 3GHSA 3KVLA 1YDOA 4R88A 4PO2A 4HQVA 1KM5A 3C86A 3NDZA 3NZGA 5A94A 1TV8A 1UZ1A 2GJPA 3QZ6A 2X3XA 3ZLHA 4JDYA 4NASA 1RZMA 4XZ9A 2EJ1A 5DMNA 1QWGA 2E6DA 4GVHA 1DWHM 1LROA 4A29A 1RP8A 1GOWA 4F2BA 1O5KA 3GXDA 2GGGA 3MUXA 3RRXA 4DX3A 3W82A 1E0WA 5DMLA 1JNEA 2Z2BA 1ZHAA 3S9IA 2ON3A 3AZSA 2FFIA 3ZQ9A 3WFZA 3WH5A 4C6LA 3B8TA 3VD5A 1R46A 2A3EA 5DY3A 4PMZA 3SRFA 3E5BA 3ATZA 4WIWA 2E25A 1SFJA 2VC7A 4PRTA 2HS6A 4EZRA 4IHCA 1K7XA 3PAOA 4DF1A 3CL6A 1W9BM 3VO0A 3BGJA 1D3HA 2O0I1 3BUDA 4LUIA 3DXIA 2GSHA 4L6OA 1GHSA 2NSXA 2JE8A 1JZ3A 4D6IA 3N4FA 1P5BA 3MSGA 1C7SA 3HG3A 4LBRA 1X8FA 4IX2A 1QHOA 1H7WA 2Y8KA 1XCFA 3W1RA 5AHMA 1KGXA 3SUTA 3MT1A 1O4UA 4ECLA 1CT5A 4OBSA 4Q4QA 3QE6A 3UG4A 1LUCB 4DN1A 2WAGA 3DX1A 3W37A 2QCGA 1KD0A 5XIAA 3AS1A 3BW2A 2I16A 1KFWA 1GVYA 3A3HA 4G7EB 1FWAC 2CBVA 3E2QA 4UOZA 4GACA 2ANUA 5CJMA 3BO9A 3OVGA 3SECA 2PY6A 1RBOB 1OD0A 1B9BA 5GNZA 3OJGA 4LWWA 4UNKA 4W93A 4TXEA 3SN1A 1VBHA 1IXNA 3TZFA 2HNEA 5D38A 4MWAD 3W2UA 3IJ7A 4E3VA 2CPUA 1W3NA 3H7RA 3NCOA 3WLSA 5FAGA 1XC4A 3SY1A 1M7OA 1MSSA 3OLEA 3MUY1 2X7VA 1QUMA 1EKOA 4GZIA 3S1VA 1DHKA 4E0CA 5D2YA 2IS7A 3EWWA 3ITVA 3F4DA 4JTAA 2D23A 4UFMA 3WSUA 3E49A 4PUWA 3EWDA 4HK5A 4KIKA 1M7JA 4H9YA 4TU1A 5D37A 1X1OA 1E4NA 4AKVA 4ZO7A 3PG9A 2DSUA 4GQQA 4S1FA 4MFDA 2I14A 1RV8A 2J7FA 1O7AA 1UKTA 4NJHA 4KGLA 1HJWA 4O57A 3Q67A 1FWNA 1W1IE 3SCWA 5KBPA 3OQ8A 3LMYA 2EPKX 3ISIX 4BQ5A 2L5HA 2CEQA 4GI8A 4NXSA 3CV7A 4DAFA 4JCMA 2ZWYA 3DDFA 4IGNA 3D0CA 5DLCA 1R9XA 3BMWA 3QV9A 3BV4A 5HNUA 4QX4A 5DO8A 4S3GA 3W38A 3KRUA 2WLYA 2PP0A 3TX9A 1FWSA 3MJYA 3VOJA 4UR8A 1WO2A 3DHDA 5CZ0A 3GHTA 3PLTA 4QDMA 3AHXA 3SCVA 3QGKC 4GQGA 4OBTA 1YMYA 5CH9A 1KBBA 1WP6A 4MMWA 4FM3A 2YYUA 2RAIA 4H3DA 4O1EA 2Y89A 4X0VA 1UROA 1Q45A 1HKIA 2E0PA 2DUXA 2WSRA 4WXYA 2GF4A 3PWGA 4XZMX 3F4CA 5JBEA 3QQ1A 3VILA 4B9QA 3L4ZA 4C6QA 1V03A 4V1XA 4XQ6A 3USZA 3W24A 1L8NA 1QNSA 2HV5A 1JYVA 3AO0A 3MUZ1 3WLJA 3B8WA 1XDLA 4X61A 3F5KA 1Z6KA 3R79A 1TMLA 3GAYA 2DZAA 2O0TA 3RDKA 1T8XA 1Z42A 3M5VA 1WZLA 4FNTA 4J4KA 1XLHA 5U7SA 3VNJA 3VD7A 1XIMA 3QMRA 2DZWA 3Q65A 4ZQPA 4MUZA 3E1F1 2VUNA 4LUJA 3MO4A 4AIBA 2PWVA 4R5EA 1UWAA 3BVJA 3QYSA 4CNOA 3WLTA 1RY8A 3QNIA 1EOMA 1FTXA 4PYSA 2IKHA 4PSRA 5LKYA 4A3QA 3PBMA 4JTEA 1P1XA 1XYLA 1K02A 2FTYA 3UZWA 1WB0A 3SQSA 4E2OA 3B51X 1P0BA 3EKGA 2YXOA 2REQA 4XO7A 2DSWA 5TQLA 3W02A 4QJ1A 2QCMA 3KCOA 3HGRA 4QG9A 2Z6JA 2DT1A 3TE9A 4H9UA 1GGOA 3B9NA 4K38A 3CH0A 1V0NA 3VOGA 4C7FA 4HHPA 3NA8A 5F2MA 4ZB0A 4G7FA 1KXHA 2R1NA 2GVYA 4J40A 1I0BA 4ROQA 3OYZA 3BSHA 2DZVA 3JZUA 3L4UA 4NRRA 4MTVA 3BJSA 1H49A 4A8IA 2QUVA 5A8OA 4GFSA 5HINA 3A13A 3L12A 4EE9A 3QPEA 2OTDA 2HCVA 1LL4A 3LMFA 1QW7A 1P6BA 3A5VA 3VIIA 3ANVA 3AHZA 3QJAA 3ZS4A 4HGXA 3P67A 1JULA 3ORWA 4H8SA 5LHEA 1AMYA 4UTWA 3A21A 3GDBA 4M7TA 1FWCC 1LRQA 4DZHA 1GQKA 4DCNC 4Z2JA 4JDBA 1T7LA 4NT0A 1E4MM 1SO4A 3FHAA 3H4XA 1M04A 4HMDA 4LAUA 2PDWA 4LGXA 3HFTA 3W7KA 4GJIA 2XIJA 3WQPA 3VIGA 4LVAA 3N12A 3MMDA 4B4FA 3GC5A 1ALDA 1NWSA 4NF7A 4FNRA 3HG2A 5HATA 1TA3B 3GG8A 2B7PA 3ITXA 4H7VA 2PTDA 3IJDA 4H8HA 3CZEA 1ZJBA 2Y88A 1UMLA 1GJPA 4PTMA 3RO8A 4HSOA 3VNYA 4W7VA 3W71A 3GVQA 3O15A 4IWWA 4XG1A 2IXUA 4NVTA 5CQ1A 4GH1A 5HA7A 2PDPA 2O7QA 5EBAA 4F9JA 3IV8A 4HY9A 4HA4A 1W2VA 5AZ0A 2GQ9A 3C6CA 3UXAA 4JTDA 3M9YA 2YZRA 3V7PA 4KEVA 1WKDA 4DYLA 1OFDA 2CXEA 2XUCA 5CPQA 2V69A 3STEA 1HKWA 3W81A 3DYTA 3U2CA 1KWGA 4GZJA 4TMBA 1W1YA 4OUIA 4OVXA 4CD7A 3BUVA 5I5RA 4JIRA 1X6NA 3W7JA 1QVBA 4NPHA 1V8EA 3H4GA 6TAAA 5D09A 2FJKA 1V5XA 3N3MA 3LUTA 2E67A 1A0CA 1GOXA 1V51A 3SBFA 4CCCA 4LBSA 2VC6A 1SQ7A 2QGHA 2YCLA 1V7AA 2PTWA 4JX4A 3TZNA 1UB3A 5I24A 2GOKA 2XHYA 4PMNA 5C7VA 5A1AA 8TIMA 2H9AB 2VX7A 2J25A 3TYUA 1JCJA 3WQ5A 4O4VA 1YPFA 3AIUA 3MUIA 2E9LA 3WBWA 4JIIX 1O1HA 4F0RA 1KTCA 2OEKA 1G9HA 4UDYX 1DWGM 2QXLA 4F01A 5MKGA 1UKSA 3AAMA 1MUMA 3TDFA 4U31A 1XXXA 3LMZA 1J01A 3OIHA 3DH7A 3TN4A 1UD8A 4V2XA 2TODA 1CPUA 3EJPA 2JKEA 4EAMA 1JDCA 4LVDA 5GJMA 3DENA 4K6AA 1BEUA 1OFBA 3EEZA 1EJTC 2WMGA 4GY0A 2XPKA 4XB3A 3OZPA 3F03K 4EWJA 3GBEA 3OA5A 5EMUA 3UZZA 1DVJA 2VX4A 5IHRA 4K7VA 4DLMA 3GYEA 3WL1A 4WJXA 3FA3A 3SRDA 5DQPA 3BQ5A 1AMKA 1OM0A 3V35A 2D1LA 4C1NA 3IRDA 4GNKB 3H2OA 3NM1A 2PGWA 1GCYA 3ZEDA 2BZNA 3HURA 3NZQA 2YBTA 1HZYA 2CHNA 5CCZA 3N04A 4MWAB 2QQ6A 4UTKA 1YNPA 3B3DA 2OZNB 2XM2A 2HDJA 3OBKA 1ESWA 2PDUA 4N4PA 5E6YA 2X1UA 4P7OA 2NSOA 4AEFA 4HPJA 2NUXA 2XSBA 2G97A 4QG6A 3ZT6A 2G8ZA 4MJZA 1LLWA 2HVOA 1D9EA 1AQ0A 1DJNA 3KEHA 4KCVA 4OGZA 4O53A 4P8XA 3QV6A 3TAKA 4KBXA 3W84A 2EJAA 3B9OA 2VCAA 2DORA 3UITA 3Q37A 4QR6A 1WXYA 4EX4A 4HPNA 6REQA 3W6YA 4YTQA 5J5RA 4FA3A 4QEHA 2OEJA 1Q6FA 1UP0A 3NQAA 4BQ4A 1HUVA 2PF0A 4B5VA 2RDWA 5F2GA 3TSDA 4BWLA 4AWEA 4LFYA 3T47A 3LVTA 1KFLA 4HYVA 1E6ZA 3W86A 1XYMA 3HQNA 1EZWA 4J7RA 2GL5A 3Q4DA 4O4WA 4DYKA 3SSZA 3WF4A 5E0KA 3GR4A 2FGLA 1RQHA 2V3DA 3E3HA 1HGWA 3RFAA 2C7FA 4ZTYA 1YPXA 5KSWA 1M9HA 4H6QA 3R1ZA 3UF9A 4BCEA 4V27A 4AG0A 1MXSA 3TNBA 3SO7A 2OVLA 3VCCA 1H4PA 5HMSA 4HOXA 4IXHA 3EB3A 4TO8A 3UU0A 2QNEA 1Q8JA 1BVZA 5K4ZA 4CNPA 3GHRA 3LN3A 1EA9C 3A9BA 1E3XA 3CBWA 3G1DA 1WUFA 2WHMA 3SJ3A 1U33A 3BAJA 4HR1A 3IGSA 1YQ2A 2ISVA 5T26A 2G3MA 5M3WA 4EPBC 3VD4A 3IJ8A 3N73A 4L9YA 1X7FA 2GUYA 1KM0A 4QSFA 1TYGA 1J0YA 2VFDA 1FWTA 1MYRA 4HN4A 1RJPA 4JEJA 1Q7QA 3FW6A 1SZNA 3QYQA 3A4AA 5A6BA 3UYIA 1GQJA 4X22A 2AAMA 2J7GA 4TMCA 2D73A 3BAWA 5BNKA 4Q4PA 3S8HA 1H7PA 1OG6A 3S2JA 3IJ9A 2D2HA 1UC5A 3GTXA 1VJIA 2OPJA 2I9EA 3LHTA 4XBSA 2Q8LA 1PWMA 3S83A 4PC8A 5IOBA 3U8GA 2WVTA 3QXBA 5D2VA 1W0MA 9RUBA 3AIRA 1LLZA 2BV9A 2WMIB 4PL2A 5FJOA 4A2RA 4GINA 4J3ZA 3C61A 2X40A 3ZSSA 3IK4A 1YXCA 4Z2IA 5CPOA 4CKQA 1GNTA 2CZEA 4JNMA 2OWWA 4ES4A 3T4AG 2P3EA 3CHEA 1C3FA 3P3BA 2GJNA 2GJXA 1TTQA 3BG3A 4Z1CA 3B8SA 3VIJA 4UTMA 5HOSA 1K7EA 3NNTA 1U22A 1XJBA 3I3DA 3SEPA 4CGTA 4UTTA 4YVPA 3MHGA 5DX7A 3R13A 4CCZA 4P8WA 5T9CE 2OX4A 2FZBA 4FZSA 1XIBA 1QW8A 4JTLA 3WNLA 3ARRA 1PZ2A 4RW5A 4ENLA 4P7NA 2OX1A 1QOPA 4B3LA 1A5UA 4JQ1A 5LA0A 3AIEA 2ZUTA 2OELA 2BGSA 2QCEA 4JX5A 1CGYA 2EF9A 1ZWWA 1AA1B 3SCRA 1R85A 2D69A 1EC9A 4LXFA 5HQEA 1CB2A 4K8HA 4HOZA 3O6CA 4CN6A 1WZMA 3QFWA 4G6QA 1T41A 2PCQA 3B0VC 3ZFHA 2PWDA 3MWAA 3OBAA 3C0JA 4A2SA 2YL8A 2HPIA 3WH8A 1G67A 1HT6A 4BNEA 4GUIA 3D50A 4Y96A 3KRSA 1FP8A 2RHGA 2F7PA 3GXMA 2O9OA 4N2YA 3OHMB 4PN2A 3V4BA 1M5WA 4UOJA 4AQLA 4QCEA 3AYVA 1EFZA 4ZZ9A 3D51A 1OG0A 5DXXA 4XD6A 3QR1A 4FNQA 2X3WA 1I8JA 2V63A 3E96A 1R47A 3CL7A 3S9ZA 1XIDA 3B0PA 1I49A 4LC8A 2INZA 3LHYA 4PUNA 3DEQA 1IZCA 6TIMA 1PPIA 2YL9A 3DGRA 5KINA 1X39A 4RNFA 3BVUA 4ZQRA 4LUTB 4HA3A 4QDPA 1E15A 2Z2UA 1Z8AA 3H24A 2PBOA 3UCCA 5EBUA 4C7GA 1UW9A 2V30A 3DX2A 1H5YA 4IIHA 3WYZA 1VQTA 3B4UA 4FP1A 4XKYA 7A3HA 4F40A 3WNPA 1XBVA 3L2LA 3RPMA 4URIA 5I07A 3C2YA 2PWEA 1XRSA 3VX1A 1OA1A 2Y2WA 3E2SA 2PWGA 2E5DA 4PB3A 1PYMA 4LX4A 2X1TA 3EDFA 3KDRA 5H91A 5HNRA 3DKLA 2R8WA 3WLMA 3JUGA 2F2HA 4AHPA 3HBLA 3TNOA 2AQWA 2FHFA 2RDTA 2JF6A 2GAFD 2Z00A 1C92A 4WJ8A 4MB3A 2VZSA 5IDZA 3WF1A 4W5UA 3RV0A 2QT3A 3WLLA 3AQUA 7ODCA 3VGDA 4US5A 3ERCC 2Y5EA 2GVLA 5CKSA 1O60A 3R94A 3UA4A 3N13A 2NCZA 2PWHA 2FGBA 2IW0A 3L3OM 1N7KA 1REQB 4L64A 3FVDA 4J3UA 3TOPA 2EXOA 3POCA 4L5ZA 2I17A 3HPSA 5D04C 5ABGA 3WX7A 3TTEA 3LRLA 2BXYA 3EX6A 1TE1A 3B04A 1NARA 4O52A 2YJQA 1S38A 2ACQA 1JUKA 1JI2A 2OW6A 3BJTA 1KRBC 3BQ6A 3HOJA 1AQMA 4AZGA 3APTA 4UR9A 5TBOA 3BXWA 1UR1A 2TMDA 2WJDA 3EWBX 3IV3A 3EOOA 3PTDA 1KXTA 3VI2A 5DF0A 4MIMA 1A53A 1X7IA 4CD5A 3CTTA 4PULA 3RMEA 1NOWA 4HZ6A 1OD8A 4GK8A 1JZ7A 1JQKA 3G6MA 3D3AA 1YYAA 3L67A 4W8BA 3QMTA 2J78A 3WQ8A 3BK0A 5A95A 2NV2A 2CLOA 4GJJA 1VFUA 3GUGA 3ELFA 1J0KA 3APGA 4JTKA 3IIZA 3GLCA 1POJA 4OU1A 5AC4A 4Q4OA 2A6NA 4O1FA 1TV2A 3CAVA 2E7FA 3VUPA 1P7TB 1PDZA 3T4CA 2ZX6A 1H61A 4Z08A 1A47A 2OZ8A 1ITCA 4EOUA 1XH1A 1MUWA 1L8PA 3S3GA 3AJ7A 1LOQA 2Y4SA 3BLBA 2VGIA 4FR1A 1PX3A 4WPCA 1ICPA 1IZKA 3OA3A 5DBUA 3WUGA 4J2PA 1X04A 2OYKA 4L6DA 1UA3A 2VGBA 3DAQA 1TVPA 3CQJA 3J7HA 5T91A 3W4RA 2J13A 4UB9A 2WNNA 5BCAA 3IWPA 3UWQA 4YYFA 1JZ4A 1I75A 3L5MA 4NJIA 5EPDA 1DP0A 3N2XA 2H3DA 4JR5A 4RDWA 2QPUA 2XH4A 1P6CA 2D2OA 2DPEA 4GNVA 2E5BA 2G4FA 4TV5A 1K6WA 1S1RA 3KS5A 3T0CA 1H41A 1UZDA 1Q66A 1EP3A 3FAXA 2R91A 1TJ2A 3P5YA 4DVOA 4ZL1A 3V5OA 2HISA 3HG4A 8XIAA 4YVVA 4A3UA 1Z44A 5I09A 4DM2A 3D3FA 2QCCA 3WJWA 3GNOA 2XIQA 2E6AA 3SY5A 4ZEPA 4LTSA 3K46A 1UWQA 2RGMA 1YE6A 4ZSUA 2V8ZA 2Y85A 3AWOA 4XAYA 4DPQA 2WJFA 5EMJA 3K30A 4L1WA 3VXGA 3QTGA 1E1DA 1B0IA 1TCDA 3A24A 4ZOCA 4GVGA 1AZ1A 3PULA 1W5OA 3LDVA 4HTBA 1SU5A 1XI3A 3P5ZA 1OYAA 3O06A 3LU2A 3NOYA 2IPGA 4JTHA 2YPIA 2HXUA 2WC3A 1XYFA 1GQNA 4TR9A 5REQA 1QT1A 2VOTA 3S2NA 3OO2A 2XZ7A 2C3ZA 2OW7A 4IIEA 4LUYA 2V2CA 2RH9A 1EP2A 4QQ3A 2J74A 5C7HA 4JTGA 4NJKA 1TZ7A 3GG7A 1MVYA 2GA9D 1A3HA 2F6XA 3OQEA 1SFLA 4RPQA 2HE5A 2WWCA 4ZQOA 3W7IA 3TV8A 3KRBA 3WDHA 5A6BD 5HMEA 3SM0A 5K9DA 1HP5A 3H53A 1AFSA 2CZFA 1Y2OA 1OQFA 4AD1A 3GTIA 3LXCA 2WCGA 2A7NA 4NX0A 3WK0A 3LCGA 1B3XA 1G6CA 5C55A 4C5YA 1FA2A 1MDRA 1T99A 3B40A 3VA8A 1C9WA 2WCAA 4FXSA 1YDVA 4KWSA 2A21A 4GH3A 3CZSA 3V1PA 4GPNA 1BLIA 4IPNB 1N2VA 1FH9A 1HKJA 4TV6A 1LBFA 1XG3A 3NQBA 3OODA 1JZ5A 2VEMA 3WNOA 4QBXA 1JQXA 4YLWA 1XLDA 3FY1A 4QHRA 1HO4A 4BR1A 7CGTA 1ODZA 2NWRA 1LQ0A 3QFEA 3VOHA 1RCXB 4M82A 1GG0A 3RGTA 1VAHA 2A79A 4A8LA 3CZKA 3DI0A 3B06A 2E6YA 3L4XA 4QRNA 1JCYA 3RG6A 2QVHA 1X6LA 4ZXLA 1YIXA 3W07A 3D4ZA 2ZZ2A 3TJIA 4IQLA 2AL1A 4HZMA 1I2OA 2GUBA 5CBJA 3S6OA 1V3JA 2R1LA 3CUIA 1QCWA 3IIPA 5CZSA 4JFUA 4L65A 4NL1A 3DFYA 4D2JA 2HBXA 4C6MA 4R5LA 4HMEA 5E0CA 4IQJA 4I7UA 2QCDA 5PTDA 1PAMA 3PPHA 1WQ5A 1VJZA 3LPOA 2EHHA 4AY8A 4E3CA 4MADA 3IAQA 3U2EA 1B5TA 2QCHA 4R5GA 1EDQA 1GNXA 1H2JA 2VDIA 3G1SA 3C0QA 2BHZA 4FOKA 4WSHA 2OLHA 4H00A 1WKYA 2P0IA 4R53A 3WJSA 2BOFX 2W63A 3U6WA 4U3AA 2Q09A 2IXVA 3VFLA 3VE7A 3PTKA 4DWSA 5A2BA 3ARYA 4GYFA 4GVFA 4MY9A 3C2OA 3RU8X 2OSWA 5FSEC 3G3MA 2Q71A 3BVVA 1HJUA 3CWHA 3L0GA 4I7VA 3IRSA 5I6SA 2Y6ZA 5ABFB 3UGVA 2HRWA 4NKCA 1QNQA 4DO6A 4ZMGA 1EP1A 2Y0FA 2DZSA 3VZXA 3VKKA 4LCSA 5HPCA 3GY1A 3QOKA 3RJYA 3OIXA 2VCCA 2QMJA 3TMLA 5HULA 3VX0A 5CGQA 3S1GA 1H5VA 2OO0A 3NO1A 4KESA 3LK6A 2WJZA 4AMAA 1QWKA 1TTJA 2XVNA 4DBWA 2RAKA 3WKZA 4IF2A 5FESA 3C8NA 3I39X 1CXKA 3VDCA 4XUYA 3UA3A 4JQ2A 1XHGA 1XCXA 4DQWA 1MDLA 3AXMA 3B05A 2DIKA 1SR9A 3EYPA 1ZENA 1V6VA 1J6OA 5I79A 3V36A 4C90A 2C16A 4TVCA 1OF6A 4FOUA 4IP5A 2G3IA 4Y7EA 4PE8A 3M1ZA 1U5VA 4DO5A 3KWXA 1EZ2A 5FEZA 2CYGA 3N2CA 2VP8A 4LVBA 3TN5A 2POZA 2ZYFA 1E6NA 2EG7A 1PL9A 4AMCA 4NU7A 5LZLA 4GXMA 2RAGA 2C1GA 4L9ZA 3FGCB 3QF0A 1JYWA 3XIMA 2VTFA 4IL2A 9CGTA 3DFQA 5LNUA 5CC7A 2QZRA 1OX6A 5FL0A 2WYHA 4IIBA 2ZQ0A 4AHQA 3HA1A 4R5KA 2EPLX 1HKKA 2XSXA 4LYQA 3VDAA 1HN1A 1QMLA 4JNFA 2O92A 3DG6A 3W7GA 4CQ8A 3CIVA 4PMOA 4EZUA 1LL7A 4US5D 3VMOA 5B7YA 2IMRA 2Z1BA 2P53A 4LUSA 3RK8A 5EY5A 3QBUA 2Y8UA 3EWXA 1FWJC 3EJQA 4NQ1A 1JCMP 2PAJA 2BXZA 3U2ZA 1A3XA 4KWUA 1A3WA 5DELA 4N9EA 1WA3A 1EJWC 2C79A 4PUKA 4R34A 4FK9A 5FKYA 4NZ4A 3HGOA 4HMCA 4IMFA 2B0MA 3GIPA 5MKGB 4O15A 4UR7A 3AIWA 4KIEA 3VK5A 3V0TA 3AZTA 5CSYA 1EO5A 1SZGA 2XDFA 4JAWA 3PJXA 1H50A 2WKLA 4D8ZA 3BLFA 3TQPA 3MI3A 3PNZA 2WVVB 2Y7DA 1NU5A 1VEOA 3GM8A 4FZPA 5KITA 3TAOA 3B9DA 3N2MA 1GHRA 3DECA 4JLCA 1W1PA 3PJTA 5I03A 1DBTA 1DKXA 2Z1KA 4DB7A 3IJLA 3ZWTA 1DXFA 3D5HA 4XV0A 2PRLA 2F1AA 3RX2A 1M7PA 1OCQA 2J7BA 2J8FA 4Q8OA 1JPHA 1ZGDA 1XGZA 2EPOA 1L2UA 1QK0A 3EPNA 4JYDA 4UZSA 1R2RA 2Q01A 1ZCOA 3VOFA 3MMTA 4LNYA 3VDGA 3M0JA 4I8DA 2QUNA 1O66A 3ZLGA 4OT7A 3SRKA 1VCVA 4DUXA 4MAZA 1YLVA 3ZVIA 1PV8A 4XKMA 3CWNA 3HO8A 3ITCA 5M03A 3M0KA 3B03A 9XIAA 3QHOA 1ZBVA 2WPGA 1SFSA 1QO5A 3ALGA 5G4WA 4B92A 1IQ8A 1QFEA 2F9RA 3R89A 3KAWA 3IGXA 3OZMA 2Q3RA 1LTDA 2YIVX 1SVDA 4HVXA 6REQB 4QNEA 3R4IA 3IVUA 3UWYA 2VL4A 3W75A 3ZJ8A 2O9PA 2VFFA 4LT9A 3GVRA 1X96A 3STCA 3UR8A 4YHGA 3RR1A 3SYVA 5K9XA 3GDTA 2O9TA 4MG4A 4YS1A 3WDPP 4PL1A 2GGJA 4ALDA 2GQAA 2Y7GA 4DJDC 4ZOAA 1W91A 2ATMA 4AVOA 3HIJA 4RE4A 4CVWA 2QS8A 3SJNA 3R25A 2VXNA 3W7PA 1XD1A 3G1YA 3MUAA 3NFUA 3LD5A 3BDKA 1GTEA 3N1AA 5AHLA 1MRAA 3KBNA 3OVQA 1CNVA 2V3EA 4LQ1A 4F0SA 1QI3A 1NTHA 3HQOA 4MJ2A 4DI8A 4C1KA 1FWEC 1U1HA 2FVLA 2QKFA 3AI0A 2HBVA 4I5XA 4Z1BA 4HR1B 3JRKA 2PP3A 4L4OA 4LEQA 1E9YB 5CSRA 1J12A 3SQMA 3W7QA 3EXTA 4QXIA 3O63A 2W62A 2V5DA 1DPMA 4GY1A 4B16A 4C60A 2YA1A 3DDMA 1UP2A 3AISA 3GE7A 2PTXA 1FWWA 3MU7A 4R7JA 1K8XA 3AYTA 1VFLA 3PTMA 2JEPA 3ZVHA 3PBUA 1VCFA 3LENA 1KM4A 1YRRA 2J77A 3STFA 4C6BA 5D2XA 1HTYA 3KOYA 2CW6A 1VFHA 3GVWA 3EXRA 4GXWA 3L4WA 3W9ZA 2VZUA 2XWDA 1J79A 4IIFA 1GVRA 2C1IA 4Q8MA 1DJYA 1K1DA 5D2TA 3N2TA 3MB9A 2YCEA 1PE1A 4KEUA 1DJZA 4B15A 4LS1A 5E84A 4B91A 1RVGA 2IPJA 3THQA 4ASTA 1EUAA 2KZHA 2BVTA 3WNKA 4EK7A 5E9XA 3VCRA 2ZUUA 5C9WA 2FJUB 4L6HA 1S2WA 3EB2A 2PD5A 2QCFA 4UMCA 4IWQA 3CQHA 1UA7A 4KCUA 2WANA 4MZYA 2TRSA 2B7OA 4AFYA 3SUUA 4IUOA 1EC7A 2JNKA 3C2FA 1C90A 1PKMA 1BRLA 4ATMA 3IIOA 2XN1A 1RQBA 4DEFA 2X0SA 3C2VA 1KFEA 3P93A 3O16A 4R7OA 4FXRA 6XIAA 2OOFA 5AVHA 1CXFA 3FIGA 1YPIA 4DF2A 4H7ZA 2X05A 3C5QA 2PB1A 3Q58A 2DU2A 5C9XA 4Q6JA 2YDQA 1XLGA 1G7UA 1BYCA 2GJLA 4IQDA 4PMXA 3T09A 1TJRA 3H21A 2O55A 4INFA 4AXKA 3ENLA 1E0TA 1UD2A 4CEXC 4DJFA 1X03A 4RL3A 1A4MA 4DWSD 3VEBA 2DY3A 1TE6A 2FYMA 1ADSA 2DIJA 1GOKA 2IQDA 3TC3A 5AHIA 4GRSA 4PMQA 4M81A 3OYXA 4D1JA 3G1RA 4PMUA 3W1AA 2GUUA 1ENUA 3Q94A 4K36A 3LM3A 3OLDA 5FA5A 1KBJA 1L6SA 1R0MA 4IFRA 1G1YA 1RLCL 3IJIA 4NZ1A 3VMNA 3H7VA 1PUDA 4RNJA 1L6WA 3IPWA 1GT8A 4GE8A 2ZIDA 5I06A 3ACOA 4IG2A 3DOPA 3M0VA 1T6MA 1I1WA 4PFMA 1Q7ZA 1WXZA 5LXXA 2PFHA 2UY5A 3ITGA 3GVVA 5BRQA 5D05A 3ARUA 1FOBA 1VB9A 3XINA 1NDZA 3ZT7A 3GZAA 2BXVA 4RE2A 3VE9A 3RLUA 1I6NA 2OYLA 2DT2A 2CBIA 3IANA 2J7HA 2P10A 1GVQA 3RLGA 4WD0A 4Q32A 4KCWA 4RDYA 2E40A 2O4QA 4GXPA 2ACSA 3BSGA 5M1TA 1PVNA 2ZA3A 2W67A 3C8FA 2E1DA 3ABRA 3MA8A 1XLFA 3DN5A 4O17A 2FPTA 5GJPA 3AIQA 3F7WA 5XIMA 2JGYA 3ID7A 1HKMA 3QZEA 4JHMA 1VRDA 2A1YA 1VR6A 2PUZA 3QPYA 1J9YA 1UJPA 1R3VA 3EGJA 3QZAA 4ZO8A 1O7DC 3KE0A 3LCHA 4FX8A 3WMCA 4UNLA 1ZY9A 1HFBA 1EGZA 3DI1A 1QWNA 3QWEA 1LCOA 1S3HA 3DYPA 3W88A 5F1UA 1V93A 1KRAC 1IGWA 4JYEA 3T0BA 1FCQA 2CHRA 4GO9A 1OABA 3BLKA 3LRKA 1ODUA 2VGFA 4GUJA 3ANYA 3RJXA 5GJNA 1RA5A 4NXKA 3AMDA 3UEQA 1XLCA 1L2QA 3NTYA 5FOOA 4LYKA 4RV3A 2YL5A 3EWZA 4GC4A 4A8RA 4DM1A 3WQCA 2Z1WA 2Z1SA 1F8IA 3ONCA 5C54A 4BF9A 3V0SA 4QAIA 1OWQA 2XIIA 1KFBA 4PUMA 4ZODA 1OGGA 3F2CA 3BAIA 1GNLA 4LCRA 2P1FA 2J66A 2C19A 4ZA0A 2PODA 1GKPA 3IJQA 2XM1A 5CPSA 1GYLA 4LAZA 2A2IA 1BSLA 1F8MA 1K8YA 4ML4A 1S5NA 4J3SA 2A3CA 5U4NA 5E9AA 1ZFJA 5HMDA 8CGTA 2OXNA 4WEVX 4IPLA 4CEUC 3WK1A 3NURA 4TX6A 5FLEX 2B7QA 1E6PA 4LF1A 4JGDA 1J0HA 4Y8EA 2DUAA 4AC7C 1H63A 6ALDA 3GYCA 1B1YA 1IEIA 1UWUA 2AQOA 2JGQA 4XZNX 4PCSA 5CC6A 2OLAA 4WDTA 3CEUA 5CPMA 1UWSA 4H4IA 4J3XA 1JYNA 1PIFA 3MI6A 4POCA 3KZPA 3EOEA 1QPOA 3HQPA 1PZ3A 1FWDC 2QF7A 3TUUA 1JPDX 4H8NA 3SGGA 4IISA 3UD6A 1NDVA 5FJRA 1MNSA 5FI8A 3CO8A 3EA3A 5LNSA 4BK9A 3S42A 4HKPA 3WQ6A 4HNNA 2V2DA 3NQGA 1UC4A 3VUSA 4ADSA 5LA1A 1NWUA 4ZB2A 3UERA 1NWRA 5A8NA 2J8TA 2EEXA 1I2PA 3GQYA 4AZ6A 4RE3A 5DRCA 4J35A 4BEUA 1TVLA 3T9PA 1LDCA 2P5NA 2JIEA 4DBUA 3A47A 4FLRA 4KFOA 3O0FA 3THCA 1QOXA 1RCOB 4XO6A 4AF0A 1IEQA 2QJMA 4C91A 2JNSA 1TZ9A 2PGEA 1OC5A 4QTGA 1A5MC 2GK1B 1XKJA 2PPGA 5DN1A 4UTWC 3JU2A 3NPXA 3UWWA 5AC5A 3GG1A 4B9ZA 2WKJA 2VI0A 2WVUA 3IUIA 3CAWA 3KVKA 3ZWSA 2WC7A 4B3KA 2XN0A 2XH0A 1BQCA 2NQJA 3OGVA 2HVMA 2V82A 1MQRA 5FJUA 1K7FA 4L61A 3CUHA 4WQ6A 3UQNA 2V68A 1EJVC 3L0KA 3PFRA 2Z25A 4GQ0A 2AKMA 3OWGA 1UD3A 1SO5A 4AEOA 4NAFA 3LZ3A 3NQCA 4L4MA 4U33A 3QH2A 1DXEA 2VCBA 3LV6A 3ZYZA 2DSVA 2G4JA 5REQB 5K2ZA 1YWMA 2W61A 3NPUA 3DG3A 2XIBA 1TREA 4IMEA 4AEEA 3UVAA 5D2WA 1AL7A 3B53X 4O10A 3MY9A 1DKWA 2Z0IA 3REQA 1UBSA 2VKZG 1H7XA 2OCZA 3GXNA 5FEPA 1GKQA 3DX0A 3UZ5A 1Z89A 3PNUA 5BROA 1ZZMA 5C9UA 2D2JA 4WLCA 2KX9A 1CYGA 3TN3A 1P4CA 1S5VA 1QI5A 2FH6A 4LY8A 5HAOA 4BKNA 3ZO9A 4L7ZA 4TQTA 1OFPA 2VWSA 4JFWA 2W0UA 4ZOEA 2GSEA 3GTHA 1EPVA 1LT8A 4JNYA 3LXBA 5A6JA 1I60A 2PWFA 4WY0A 1G4PA 4M56A 5BW6A 4GG9A 1T5AA 1VP5A 3WIJA 5LYRA 4JYFA 3WF3A 3F1QA 3AU2A 1E70M 2CWNA 4JTSA 2OZ3A 3CV5A 1I9CB 1N82A 1CGVA 3NDOA 2CKSA 3C4UA 2VUYA 3NQ8A 3R12A 1P6WA 3DPOA 2G3JA 4FIRA 4NZCA 1AG1O 2QCLA 2NUWA 1LZOA 1PX8A 2V5LA 3SUSA 4IFKB 3G2GA 4UBPC 3HAJA 4U5IA 2J7DA 5AKQA 1KWKA 4LVFA 5EA9A 4J2MA 2JQXA 3FAWA 1OX4B 1RY0A 4WGXA 1R9YA 2ICSA 1UQZA 4JTRA 2VEKA 3GW0A 4J9JA 1E5JA 4HK6A 3BLPX 7XIMA 2QIWA 1FCBA 2C1HA 4YHEA 3WJXA 1EO7A 4KRZA 2Y8VA 1XIHA 1JG9A 3AALA 1QJWA 4C6KA 1VZWA 4N4QA 3AMLA 2QCDB 5GVJA 3EDJA 2BOEX 5ABHA 1HXJA 3CLWA 3WH6A 4U3CA 1UR0A 3MSYA 3H70A 1DQUA 5AC8A 3G9GA 3U4FA 1R30A 2DVTA 3CB3A 3IGHX 1QXLA 4FLSA 3L5AA 1UYQA 3MJMA 3MPGA 1L6GA 4GFIA 3BOLA 3KCJA 4DZAA 4CD4A 3V16A 5IM51 1PXGA 1TJ1A 1VD6A 3E0VA 1OYCA 3CO4A 3GKAA 3NQEA 2Y61A 3WH7A 3FYOA 4D6GA 1W3HA 2E6FA 5C2XA 2C0HA 2VMFA 4ICNA 2ZDSA 4C6EA 5BOOA 3NPWA 1WDZA 2PDYA 1A49A 1YTEA 3LG3A 3VNLA 4I9JA 4JEQA 3P84A 2GDUA 3P60A 4UOQA 1G01A 3AYRA 2YXGA 4LAOA 4PTXA 1PS9A 4Z17A 1BG4A 1Z9AA 2WVSA 1YHTA 1UH3A 3GFXA 4HNLA 3WFLA 3N9KA 1VFSA 3DBNA 5E0FA 3NAVA 4S3KA 2QUTA 2ATSA 2PMRA 4H19A 3CKDA 2D20A 2D0GA 4NYYA 4KT2A 2Z7KA 5TD4A 2OMAA 4C6FA 1V3KA 1F4AA 3C3NA 3QC3A 3W7EA 3W28A 1CLVA 2INFA 2FZMA 1Q2SA 3PUEA 1DJHA 1LJYA 4FHAA 3GNPA 2OG9A 3K5XA 1QPRA 1PKYA 4DBDA 3W2NA 1TPDA 1S39A 3U7VA 4WR3A 2GQ3A 4ZSTA 3DG7A 2AOSA 4AVMA 1GKRA 4BWLC 3MDUA 4ORIA 3DPQA 1ML1A 5FL1A 4P7RA 1Z41A 4JWEA 3GH4A 1C8QA 3R5EA 2QDEA 5GNXA 4AX6A 1XISA 2DH3A 1XRTA 3G3DA 4QS5A 4YTRA 3TFXA 2XIMA 3SCTA 5CGTA 4ROPA 3A3WA 3W74A 3H26A 5CBBA 1JPMA 4JL9A 3QLLA 2EGZA 1E6RA 1QHZA 1YBQB 1OINA 4AX7A 1BFNA 3MC5A 3S6TA 1M03A 4EZXA 4LUSB 4GGHA 4GD0A 3HG5A 1GW9A 4WY0F 3HPXA 3AS0A 4LV9A 2YFNA 3E02A 3D4YA 4MB4A 2INEA 2F2KA 3WEZA 4OECA 1US2A 4QNWA 3TYDA 3K4WA 1B3OA 2EG6A 1TX0A 3HV8A 4U4MA 4A4AA 1BXBA 1NP0A 1I45A 1OB0A 4E5TA 2FTWA 4PRRA 4X60A 2DW7A 1W1TA 3TC7A 5AYXA 2WB5A 2WOQA 4Z2HA 1Q13A 3OZOA 2F18A 3H2MA 2QMKA 4CU6A 3NQVA 3E2RA 1C9DA 4Z1DA 2F6UA 4IQEA 5FF0A 3VGBA 2BGNE 1YE4A 2PDBA 4KFNA 5FJIA 3FA4A 1VFTA 2J75A 3PZMA 1B3YA 1LF1A 2J62A 2UZ9A 5I7GA 1CENA 1CGXA 3SUWA 2ZRWA 4D6EA 4R3UA 2VT0A 2WV8A 3AZRA 2OFJA 4EZZA 2ZRVA 1R2TA 3O3NB 2ZWZA 1WZAA 3BUIA 1US0A 1WBHA 1Y5XA 1PWLA 2UWFA 5I3KA 3VIKA 3PG8A 1E1CB 5TKYA 5A6SA 2HVNA 3THUA 2B7NA 5CSSA 1TWSA 4CLMA 1K9DA 3I6RA 3E0LA 3LLFA 2C0AA 2ODOA 4GX8A 3UY7A 1TWDA 1UZHA 1V6XA 1J0ZA 3ZJKA 1EXPA 3T6CA 1LBLA 4UTTC 5ABTA 4NI8A 2OYMA 5J04A 1YW1A 3SY8A 5JXQA 3EJRA 1S3TC 2HQAA 4OV9A 1N8WA 5FEXA 3NZ1A 2YGYA 4IICA 3M5YA 3HF3A 3S2LA 2XYLA 2F61A 2WZEA 3L9CA 5LIWX 5C70A 5BWAA 3U9IA 1TUFA 2Z0NA 4QISA 1W8GA 2D24A 4GBUA 3WQVA 3GBDA 4JHZA 1JJKA 3EDDA 2QGYA 4AZIA 2QHAA 3LI1A 2GQ8A 2ZX8A 3URBA 2VNCA 1OFRA 4MDPA 3TYAA 3OEXA 8XIMA 1UD5A 4RCXA 3GC2A 3RCMA 4WDUA 2WINM 1KV5A 4MLRA 3QGAC 2NVDA 1SM9A 5FD0A 4DJDA 3M4HA 1QI4A 4W8AA 5A6KA 4BQ3A 1VEPA 3QGVA 4MYXA 5IBXA 4RV8A 2WWDA 1VBJA 4EPDC 4JFTA 3MQTA 1W31A 2PDHA 2UV8G 3CL8A 4YTUA 4FSAA 3PY2A 1KR1A 1EEPA 3N19B 2E9BA 1JD9A 5LHFA 1XLMA 5K9CA 2E8YA 3V5FA 1GYNA 4GYJA 4N7QA 4F0HA 3SFWA 4OZOA 3ZR6A 2V3FA 5A8MA 2P76A 2HZGA 1BYAA 3DFNA 3UY8A 2OB3A 4ZOBA 1V79A 1HIZA 4MHBA 1HL9A 1J5SA 3CAQA 4PSPA 3KCLA 3UETA 1EIBA 5HJLA 2HMCA 3ZMRA 4Z2GA 3U2OA 3PP7A 1ZRQA 1AH0A 2ZZ4A 3RCYA 4HB7A 3F4VA 3ZVHB 1J93A 1AH3A 1EYEA 2ZVIA 4HNOA 3MSDA 1E5NA 2BG5A 3BJFA 3W1PA 3BAYA 4EPKA 1OF8A 1BGAA 1JVNA 5HJYA 1ZTVA 2FLIA 3EX3A 4UQ9A 3LBCA 1JCNA 4IJRA 3LBOA 2CZDA 1TV5A 1A4LA 3KL0A 1X1NA 3VKHA 2ELBA 5RUBA 2ZCGA 3CMFA 3FJLA 4GHRA 5G2HA 2X7WA 1RK6A 2X5CA 3W25A 4FAMA 1DXIA 1YKWA 2C91A 4RLIA 2E68A 3R10A 1PCWA 2DQXA 4AVFA 4WK9A 1K9EA 4WF7A 1W54A 2QXWA 1TG7A 2PRMA 4M19A 3G8EA 1EQPA 2QUUA 3OTRA 1KKRA 1NF7A 4DBEA 1VENA 5LGZA 5AYZA 3W1LA 4Y8FA 3MSRA 1XBXA 3THDA 3NSXA 1JAEA 1ZNNA 3L65A 1OAOA 2PDJA 4DO4A 3KVMA 4OTKA 3VNDA 3VTRA 1I2QA 3IEBA 3NXFA 3A4WA 4ML9A 1GEQA 1DOSA 4LYPA 4XIAA 3PM6A 4EZOA 4BF7A 4ZBCA 2NXHA 4DRSA 3Q2DA 5JVLA 3TP4A 4F2TA 4HMNA 2A3BA 4AWTA 4KERA 5M17A 4HYRA 1OEPA 3SAZA 4EZSA 2GWGA 1M65A 4UNIA 1UD6A 1AODA 1FHLA 4OV4A 2YA2A 3RHGA 4P5UA 2EBNA 4XD3A 1MZRA 1FWIC 4PMDA 1O12A 1CW2A 1KQZA 5T8GA 4GVIA 1K4GA 3CLMA 4MZ1A 5G4HC 4PB5A 1BF6A 4V1YA 3VM5A 1W3LA 4P61A 4EP8C 5AYIA 4XAGA 3T0DA 4TTGA 3N11A 1OFEA 3CJPA 3W1NA 3SZ8A 2W4XA 3ZM8A 4F66A 5KZDA 4EAYA 2PA6A 2FHCA 2WSQA 1H7RA 3N29A 4YCOA 3K13A 1XV8A 4IPJA 3P0WA 3GDKA 5EU9A 3T2PA 4MNMA 3DX4A 4QE5A 4IX0A 4LYRA 2Z1VA 1F76A 2LLEA 2IKGA 4QAWA 4KEMA 4S23A 1TZZA 2IPFA 3F7JA 3SCPA 3HV9A 3NG3A 3QW4B 4ACZA 4ATWA 1JFHA 4JKKA 5FF2A 1RR2A 3GNNA 1BD0A 3VZYA 3QSRA 2Z2AA 2FPYA 4I7WA 4G5DA 1KXQA 4WOQA 4UQEA 4PTNA 1XLJA 3T2OA 1RQEA 1W9XA 1C8XA 3K8KA 1D7KA 2R14A 1C8VA 1VFMA 3SB0A 1PS3A 1KTBA 1W3IA 3TJXA 3LCXA 4RX0A 2CC0A 1H60A 5K7JA 3P8IA 4IM4A 4JIPA 1UH2A 2PSNA 4QM1A 4L1GA 1R34A 4F79A 2A6LA 1ZJIA 3VOIA 4TX8A 3W00A 5MHBA 3RO6A 4Q4KA 3WQDA 1NIUA 3BPWA 5FF4A 4N9BA 3SIMA 1BWLA 1XLLA 1E6SM 4IOTA 4PEEA 1DJWA 2Q12A 5I3HA 5A2AA 2BTMA 2JF7A 5HDRA 5KZEA 2G0WA 3LV5A 4CU8A 3VM7A 3CPGA 2BODX 3RM4A 1LUCA 2PMQA 1BXCA 5M5DA 2ONEA 1EJ7L 2E4TA 4YJ5A 3P14A 4B2DA 1VPXA 2GPTA 4LS0A 4G7EA 3KDOA 1IHIA 3BTNA 1BPLB 3EA1A 3MTWA 3UZXA 4XBJA 2EWFA 3LI0A 3W6MA 1XPYA 1DE5A 2E09A 4UFLA 4G9PA 1XX1A 1T40A 1H1ZA 2BASA 1BGGA 1EYWA 4HJFA 4IL0A 4JFVA 1B31A 8RUCA 1K03A 3EOSA 4QIUA 4XIMA 1WBJA 4Q6XA 1B3WA 3JZEA 3QC0A 1OSEA 2OZ0A 1VFOA 4EPEC 2XIOA 4XTDA 2FZ8A 4KWVA 1L6YA 3GIYA 4QE1A 1HNYA 3R8RA 3WLNA 1I2NA 3UXKA 3B8UA 3VEAA 3CAKA 1GK8A 3T05A 3L3PA 1GOOA 1FDJA 2XWEA 4K8GA 1SGJA 4Q4RA 3G1HA 4Z1AA 2OBLA 3PTQA 1VIZA 3KRZA 2GVEA 3TONA 3WK2A 3UPWA 5JQ9A 3FSUA 4I3GA 4DYEA 1OX5A 4DBSA 1XC6A 3O2LA 2XVGA 3FCPA 1UUMA 4I9MA 2ISDA 1J11A 4K37A 4ACYA 5C5YA 3E12A 1R3TA 2PF8A 3FD9A 4NILA 1ISVA 4EZPA 1WYIA 1PO9A 5BRBA 1R3WA 2H8ZA 2YB4A 1FWHC 3M44A 3EOLA 3A4XA 3SGZA 2PLKA 3CWOX 4JL2A 4KGJA 5DT5A 4AU0A 3E0IA 3SADA 4ZGYA 3VU2A 1XICA 2W6RA 4O50A 1V08A 4Q22A 3W7CA 2ABBA 4XISA 4PBEA 2ZTKA 4TX9A 3SR7A 4HU3A 5D9MA 1BYDA 3URNA 1VLIA 3C2EA 1SPQA 3T0TA 4J27A 4WXZA 3M41A 3CZLA 4BFAA 1FVPA 2ZUNA 3TC6A 3BAXA 3W7HA 1W5QA 4GUHA 1ONEA 5BZAA 3IARA 1N8FA 1O68A 3GU9A 2YB1A 4IP7A 1XD0A 4FNPA 2P3ZA 1C91A 4DWSC 3CUXA 5CPTA 3TTSA 1KCKA 4JZ5A 1XL9A 3ZR5A 3O1NA 4AD3A 4ERIA 2MUCA 1G4SA 4QJ4B 3W7LA 3BGGA 3HAHA 3TH6A 3EX4A 4IMCA 3QPZA 2Y63A 2DFAA 4EZNA 2YDRA 4DJDD 4LS2A 1NWTA 1J18A 3KW3A 1ZS2A 5G1MA 1H3GA 4F4RA 3S1WA 3KXQA 3F5JA 3A9IA 4U28A 3ZZ1A 5C2CA 2BP1A 2DW6A 3MUCA 3SCUA 1R33A 3DFSA 3NQ6A 3T42A 4IXXA 4A3HA 4NSBA 5A3HA 4RDVA 1E56A 1SU8A 1TPB1 5FEWA 1QK2A 2V5CA 2QAFA 4YYCA 1NP2A 1JZ6A 4P7LA 3URQA 3NGJA 1HP4A 3N34A 5H8PA 1WNOA 4LBUA 4JN6A 4B9YA 3TSBA 1UIOA 4PMYA 4CNSA 1JF6A 5TNVA 1XIEA 4Q8UA 3WF2A 3NSNA 3H23A 1XH2A 2XFYA 1WZKA 4M29A 5CZJA 4FPSA 1ZAHA 4LRSA 2VM8A 3VKJA 1VGAA 2FQIA 3LPFA 3LA4A 4Z0JA 5CPLA 1IEVA 1H0IA 4Y9PA 2VZTA 5BRPA 4YWSA 2J7EA 3I3EA 2CLPA 2WK2A 1RH9A 3DC0A 3OK8A 5BMWA 2ZUSA 4CVUA 4D6HA 1A5CA 2Y70A 3MCNA 3W2KA 4YPJA 3GRIA 4MLJA 5B80A 3L66A 3BLDA 1E9VA 2BHUA 2HS8A 4NZ3A 3LHUA 4GKTA 1ZUAX 3VKCA 3ARTA 2OKTA 5A8QA 1JFXA 1XR2A 1CLKA 3GH5A 4QLJA 1EDGA 1BYBA 1BVNP 2YW3A 4DNHA 2OT1A 4EZTA 5CC3A 1OCJA 3R0DA 3M0MA 3DZ1A 3HAIA 1X97A 1PEZA 1DWFM 3ICJA 3NYDA 3LSBA 4M6QA 3TQ0A 2J79A 3ZR4A 3WD1A 4C1LA 3M7SA 4RDZA 4DUVA 4CU7A 1MXDA 1C29A 1XINA 4GOAA 4GIYA 3MKKA 3W7RA 3F2BA 1UR4A 1LOLA 4WOZA 3WFAA 5LXEA 4DELA 1PB0A 1RVKA 2WSPA 3V5CA 3I10A 1IXOA 3ZXWA 1XGDA 2CFFA 3S2CA 4JS3A 5AZ1A 4RJEA 1XBZA 2I1OA 2VEGA 4P2VA 2MANA 1I2RA 3NWRA 3STPA 1LORA 5I3IA 1QOQA 1XIFA 2OWXA 2VEFA 1SW7A 5LGXA 3B8VA 4RE0A 4Y9OA 3GNXA 1R3YA 1SU6A 2PS2A 3N18A 3W73A 4B4HA 2BVDA 5AFDA 1YX1A 4ZQMA 3BW3A 3D6NA 1SZEA 1RD6A 3IVSA 4J1OA 4W4QA 1W9UA 2ZBTA 3A98A 3WNMA 4M5PA 2Y1HA 3CAZA 2VDGA 4MY1A 1S2AA 4Q8TA 3G8RA 4E8DA 3MCMA 4GY7A 5BOEA 1GORA 2E1WA 2V3GA 2VC9A 4C6OA 4BEQA 3QMSA 4LW7A 1E1FA 4GCXA 3M0XA 4JN4A 2X1IA 3OG2A 1XDMA 2QDGA 3VOCA 4FIQA 2ZC8A 1Q3NA 3T4WA 2H9AA 3AJXA 3QV7A 1H51A 3Q0KA 3FEQA 2GJRA 2PGRA 2PC8A 6ENLA 1ONXA 5FJPA 1PBGA 3IGUA 1FH7A 5I3GA 3R8HA 3KBVA 1A5KC 2BOGX 5BXPA 2CBUA 1TPUA 3IAPA 8A3HA 2A4AA 3EXSA 4F8XA 3E2VA 4RNHA 5HNNA 3LTPA 3WO8A 4M51A 3N25A 3PHAA 2RDXA 3UFYA 2RAJA 1X1ZA 5A6MA 2YLAA 1W32A 3U4AA 5EB8A 1FX6A 4IJCA 3T7VA 4N0RA 1XIJA 3M0ZA 4L9XA 4GX9A 3P0XA 4FZIA 3A64A 5A8PA 2P50A 5CZKA 4Z0SA 4PCNA 4C6IA 3GWQA 3EKLA 2CNCA 4N42A 1XBYA 1F6KA 5FJJA 4GIAA 2OBMA 2QV5A 4B2DD 1OADA 4JQ4A 2GWNA 1F3TA 4BQ2A 4EXAA 3W7DA 4YWIA 3P8JA 3OHXM 4HZ7A 4FLQA 4TOQA