4AZ6A

Differential inhibition of the tandem gh20 catalytic modules in the pneumococcal exo-beta-d-n-acetylglucosaminidase, strh
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
435
structure length
435
Chain Sequence
SHNEKLAKKKIVSIDAGRKYFSPEQLKEIIDKAKHYGYTDLHLLVGNDGLRFMLDDMSITANGKTYASDDVKRAIEKGTNDYYNDPNGNHLTESQMTDLINYAKDKGIGLIPTVNSPGHMDAILNAMKELGIQNPNFSYFGKKSARTVDLDNEQAVAFTKALIDKYAAYFAKKTEIFNIGLDEYANDATDAKGWSVLQADKYYPNEGYPVKGYEKFIAYANDLARIVKSHGLKPMAFNDGIYYNSDTSFGSFDKDIIVSMWTGGWGGYDVASSKLLAEKGHQILNTNDAWYYVLGRNADGQGWYNLDQGLNGIKNTPITSVPKTEGADIPIIGGMVAAWADTPSARYSPSRLFKLMRHFANANAEYFAADYESAEQALNEVPKDLNRYTAESVTAVKEAEKAIRSLDSNLSRAQQDTIDQAIAKLQETVNNLTLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-N-ACETYLHEXOSAMINIDASE
publication title Inhibition of the Family 20 Glycoside Hydrolase Catalytic Modules in the Streptococcus Pneumoniae Exo-Beta-D-N-Acetylglucosaminidase, Strh.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
total genus 175
structure length 435
sequence length 435
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2012-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.90 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 AF1782-like 4az6A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4az6A01
2CBVA 4JCLA 3ZJ6A 5KZ6A 1B2YA 4LX4A 2WWCA 4Z2LA 1JZ4A 1E4LA 2JALA 1KGXA 1NWRA 4B15A 2X8RA 1MXGA 2VCCA 5D8ZA 3W27A 3RPMA 3FHAA 4FLOA 4OBRA 1JIBA 1UR9A 1KFWA 2WMFA 1BFNA 1RD6A 3BXWA 4GO9A 1D7FA 1FOBA 1W2VA 3GXFA 2OLHA 3QOKA 3NSMA 1EDGA 1ZU8A 2J78A 1JZ5A 4V2XA 4PMZA 1W1VA 1K9EA 3VIJA 3UR8A 2Y8KA 2J62A 4W8LA 1UA3A 2Y2WA 1UH2A 5M03A 3VIMA 3ARSA 1E3XA 1GHRA 1XHGA 3VD4A 1GOWA 4N0RA 4JCMA 3THDA 5IXEA 5E6ZA 3W4RA 2CNCA 1Y7VA 1HKJA 3W82A 1C7TA 1KR1A 3TTYA 3T0DA 1QNPA 3MS8A 3AICA 1GOMA 4ACZB 3CUJA 1DTUA 1E0VA 4AEEA 4W7VA 2V3EA 1W3HA 2VURA 2FGLA 1MFVA 3TTQA 4MB5A 4PTVA 1KXHA 2OYLA 2AAAA 3AIWA 1ITCA 2BFGA 1Q4NX 3SIMA 4ACYA 2WPGA 1C8QA 1VFFA 1R87A 5D8WA 4OKDA 1J0KA 3POHA 2CXGA 2BV9A 1FH7A 4AZCA 3VGEA 3NIYA 4PMQA 1GOOA 3WH6A 1UUQA 3MMWA 2OSWA 1HL8A 2E4TA 3WL1A 1ZBCA 4A3HA 4JAWA 1BPLB 1QPKA 3WQ4A 4MDPA 5A2BA 1JNEA 2V5CA 3SCPA 3THCA 1HL9A 5JUVA 1DWHM 3B9DA 3AHTA 3WF3A 2XM1A 3M46A 3BSGA 3N13A 4UFIA 4HMCA 2DSZA 3GNRA 1J18A 3VO0A 3RIKA 4CD8A 4U5IA 4UFKA 4AZ5A 5FD0A 2G4FA 5A6BA 1W3LA 7CGTA 4URIA 4AMCA 1PIFA 1B3XA 2W67A 3VINA 4D6IA 5FL1A 1E6PA 1EO5A 4HTYA 2YBUA 4DUWA 4DM2A 1GOQA 4AD2A 1OGBA 2B31A 4JL1A 2BY2A 3BCFA 3OIHA 1O6IA 2WC4A 1Q6FA 5A95A 2OYMA 4HA1A 1XC6A 2PBOA 1OINA 2DGAA 5GNXA 4AC1X 1QHOA 3UG4A 3A4XA 5M5DA 1TZ7A 3O2LA 5A6JA 3AXHA 1AQHA 2PC8A 2WBKA 5DMYA 2CYGA 4U31A 1BAGA 2VI0A 3UETA 3W0KA 4UCFA 5A6BD 3VMOA 1E5NA 2ZXQA 5HPCA 1G01A 4BQ5A 3VGDA 4CU8A 5TD4A 2DH3A 3S6TA 4XZWA 4UZUA 4MNMA 1FH8A 3N9KA 4H8VA 3WDQA 1NH6A 3MMDA 1RP9A 4JHZA 3IJ9A 1WCGA 2J4GA 4MDOA 4AY1A 2WHMA 4LQ1A 1H5VA 1UKTA 2DEPA 2DT0A 1QBBA 1HXJA 3DC0A 3VILA 2WC3A 1CPUA 4J3UA 4HA4A 2VX6A 5AYBA 4UQDA 3PHAA 2WKLA 4QCEA 4LYRA 4BF7A 2GJRA 2YL8A 1FHDA 1GCYA 2IUZA 3AXIA 2E8YA 3HMCA 1NWTA 1KXTA 1DWIM 4F8XA 1LL4A 4XX6A 1CGXA 5AC4A 2PWEA 1XSJA 3UR7A 5A8PA 5I5RA 2WVVB 2YKKA 1HF6A 1KGUA 4LYQA 3VX1A 4OOZA 1FH9A 2VNCA 3BLPX 4GO8A 2GUYA 4XZBA 4B9YA 4P7OA 3VDHA 1LG1A 9CGTA 1V3KA 3WD2A 5FOOA 3AOFA 1QI4A 4AZBA 3WKZA 1OWQA 4ATLA 4JFUA 1EOKA 2O92A 2G3JA 5F7UA 3CUGA 4DWSB 1JL8A 1G0CA 2G8ZA 1I1XA 1J01A 1OBAA 4H04A 4DWSD 3OA5A 2DPEA 3CZEA 3BAIA 2VOTA 3WH7A 3EMQA 1ISXA 2ZIDA 3WEZA 1XH2A 1LG2A 4FK9A 2XIIA 2G3IA 1AVAA 1CGVA 1HNYA 2F2HA 2JIEA 3I3EA 2ESCA 4DWSC 1GJUA 1J0JA 5EBAA 1I1WA 3K1DA 4PCTA 3KE0A 3FXYA 5IFPA 1KR0A 4FZPA 1D3CA 1UR1A 1QI0A 3BH4A 3PZGA 4B3LA 1E40A 4U3AA 4CU7A 1US3A 3N18A 2FHFA 3KEHA 3ZSSA 1BGGA 4PUEA 1W3KA 4AZGA 4EAMA 1BVZA 4AD0A 5IFTA 1PX4A 3KZSA 4GI9A 2WMGA 3KWXA 2WM0A 2ZWYA 4WK9A 1ZJAA 4WJXA 1UWSA 4EANA 3MSDA 4FMVA 4HPGA 2D1ZA 3AFBA 2VX4A 3WQVA 3MANA 1OD0A 2VCBA 2VO5A 4Q7NA 2GK1A 2DSUA 4D6HA 1UWUA 3K8KA 1TA3A 4ZEPA 3OBAA 4W85A 2E0PA 2WMKA 4OJYA 3RM4A 3ZT7A 1KXQA 1PJ9A 1NOWA 5ABFA 1ISWA 3OGRA 1WDPA 2PB1A 1GW1A 3A6OA 3T2PA 4D72A 3WDIA 1PBGA 4J3XA 2DT3A 4YHGA 2J25A 5JBEA 1G9HA 2Y24A 3ARWA 3BAJA 4ML4A 3HJEA 4AD3A 2D22A 1J0IA 1W9UA 2D0FA 2VZSA 2ZUTA 2JF7A 1UZ1A 1KBBA 1EO7A 3ARYA 4MNJA 1H2JA 2CBIA 4H8UA 5C70A 4BZYA 5LA0A 1LWHA 2UY2A 4XB3A 3IAPA 4J27A 3J7HA 2YDRA 1A3HA 4HOWA 5A8QA 2ZXBA 1ESWA 3PZOA 5CSYA 2VTFA 3VUPA 1UWIA 2W5FA 4IM4A 4LYPA 3IAQA 1UKPA 1GQLA 1UH4A 1NP0A 5IHRA 5KEZA 2EXOA 3VIKA 1L8NA 4CCEA 1UR8A 4Z2GA 2VR4A 3A4AA 1A47A 1UD4A 3W29A 1GZJA 1EXPA 3ARPA 1CGWA 1CENA 1DEDA 2J8GA 2YL9A 4XV0A 3D3AA 3L4VA 3B9AA 1FA2A 3VD5A 4NSBA 1DWJM 3AMLA 2YDQA 1BHGA 1E70M 3WL0A 3W38A 7A3HA 3B9EA 5LA1A 4BQ4A 1TVNA 1V02E 2NW0A 1BSIA 1QW8A 2NT0A 3AMDA 4PMDA 2VUYA 4L4PA 1HJSA 2FH8A 1I75A 2GFTA 3L2LA 4M56A 1PEZA 1CDGA 3VD3A 3SUVA 1PZ2A 4W8BA 4B16A 3CHDA 1E1FA 3CZLA 4H2CA 4JFSA 1KB3A 1UKOA 3CPUA 8A3HA 4CCDA 2D24A 3DHUA 3OLDA 5GPRA 3EMCA 2QHAA 5CPQA 1KQZA 1UD6A 3LPPA 1Q6EA 5DF0A 1W1YA 2CHOA 1OSEA 1WO2A 5I3DA 4HPHA 1AQMA 3VGBA 2JNKA 2XVKA 2DDXA 2W62A 4AISA 2PWHA 4PRWA 4TVCA 2WLYA 3AMCA 4AZ6A 5CGTA 4P8WA 5BRQA 2YIHA 3VX0A 5BXPA 1UWRA 5E09A 1HJUA 1HKKA 3I3BA 5ABHA 1Q6CA 3PTKA 4UOQA 4MAVA 3WFLA 1DWFM 3GNPA 4W8AA 3AS3A 3ZT5A 2VZVA 1TVPA 4MB4A 3DYPA 1WDRA 1GOIA 4U5KA 3NSXA 1SYTA 1TUXA 4NI3A 1GQIA 2PF0A 4JKLA 2WHKA 3BAXA 2XFYA 1HP5A 1HT6A 2BXZA 2Y8VA 4YPJA 1VENA 2EPMX 4E4PA 2V38A 1JGIA 3IJ7A 4W7UA 2WCAA 4C7GA 3BMWA 1MYRA 2J75A 2FGZA 4KGLA 3SCWA 1EOMA 1JG9A 4QP0A 2J7BA 3WH8A 2XWEA 2QPUA 3DYMA 4WSKA 4ZE5A 2X0HA 1JYWA 4M1RA 2J7EA 4R27A 3FNDA 4QCFA 4J3TA 1JF6A 2A3AA 3TOPA 1EQCA 2XHYA 1KQYA 1X6NA 2Y5EA 1GHSA 3BCDA 3PZVA 3CZKA 4GIAA 3VIFA 3AISA 1V03A 4MNKA 2D23A 1E9LA 3UG3A 1CLVA 4OUEA 2WVSA 4QDMA 1WNOA 4RE2A 2Z1SA 4UFJA 4F9JA 1FHLA 1FP8A 4CN6A 4BA0A 1JDDA 1MVYA 3A47A 3CUFA 3N12A 5HBFA 2CETA 3BAYA 1UD3A 2XVLA 1KXVA 2WCSA 2NSXA 1JDCA 1CEOA 4J3WA 1MFUA 3PZ9A 3K4AA 2J47A 3SCUA 1RP8A 2JFEX 3WNNA 4F66A 3W6MA 1UQZA 1CIUA 3GZAA 2W91A 3CIVA 3QHOA 1H41A 4NRRA 2Z1KA 4V28A 2A3HA 2X0YA 2PWDA 2CCRA 3AHYA 4P7QA 3MV11 1HVXA 4BQ2A 5D4YA 1SFSA 2GJPA 4PMYA 3WUGA 3WNLA 2YL5A 2OSXA 4A4AA 1VJSA 2X2YA 4MJ2A 1S46A 2C8NA 4J7RA 3NSNA 2CKSA 3FAXA 2E8ZA 5FKYA 1V02A 1K9FA 5JIWA 3GXDA 3M07A 2D0GA 5GNZA 5CQ1A 3WQ6A 3WSUA 2DSWA 3PZTA 3AHVA 2WMHA 3WF0A 1B3ZA 1UWTA 4QLLA 1VFOA 2ZOXA 1J0ZA 1EDTA 4UZSA 1UYQA 1E6XM 1W2PA 4IUGA 4ZFMA 3M6DA 4P8VA 3N15A 5IHSA 2VZTA 3WELA 1UZ4A 3VGGA 2WZIA 3RM9A 2RGLA 1M01A 1HJWA 3AHXA 1MW3A 4D6CA 1JFXA 3HU7A 2WANA 3BGAA 1IV8A 1J9YA 1KWGA 1BYCA 3VU2A 4AWEA 1B90A 2CKRA 1UD2A 2WZHA 1HKIA 2BHUA 1E6SM 3VD7A 2D3LA 1PIGA 3ARVA 4PMXA 3SCOA 2ZUSA 1VJZA 3DECA 4D1IA 1TMQA 4AZCB 1WAWA 2OSYA 3VDBA 3D5HA 3N1AA 3F4VA 1H0GA 4E8DA 1CWYA 4PSPA 2XSAA 3A3HA 1HN1A 2BVYA 3EDKA 3MO4A 1VFMA 3O6AA 5CG0A 4TX8A 4U3CA 1E3ZA 1E4IA 2WHJA 5CJ5A 1SMAA 3I3DA 1QW9A 3VVGA 4KMQA 1GNXA 5BYWA 3W81A 1B9ZA 2YLAA 2ZXDA 2BNJA 1UHVA 5CPSA 3K8LA 1NQ6A 5GNYA 2EPOA 2X09A 2WVUA 1UD5A 4MPKA 1ISYA 1OIMA 2YDSA 4Y7EA 5ABEA 1H49A 3GXMA 3QHMA 4JFTA 4KH2A 5A6SA 1GUVA 2XFFA 4BCEA 2UWFA 3WBAA 2XUCA 2WLZA 4E2OA 1HJXA 3FAWA 4HU0A 3OLGA 4PMUA 4EKJA 2AOSA 1V3LA 1JAEA 1E6QM 3PTQA 2PMRA 1XV8A 3GH5A 1IZJA 2XVGA 1E55A 2YA2A 1J12A 3W6LA 4D6GA 3BSHA 5GQBA 3SUUA 2GSJA 1JDAA 1VEPA 3PZNA 1NM9A 1NOFA 3W25A 1CGYA 2VX7A 1QOXA 2EO7A 3VM7A 4GZIA 1XD1A 5I0DA 5DT5A 1XH0A 5HOSA 2J77A 1CNVA 2CBUA 4BS0A 2OYKA 1MW2A 3WENA 1BGAA 4HOXA 1WP6A 4UOZA 5JIPA 1CYGA 3WIJA 4PSRA 2QLYA 2W66A 1UQYA 2QMJA 2BHYA 1CBGA 2FH6A 2V5DA 3VOCA 4M29A 3KL5A 1JZ7A 1UKSA 2WMJA 1BQCA 5DEZA 2VRJA 4ZENA 4PN2A 1WZLA 3AS0A 1WDQA 4UQ9A 3EYPA 3TTOA 3AIRA 3CTTA 3W53A 2BY3A 4CKQA 2WWDA 4TUFA 4KRUA 4A3YA 1MWOA 1K6AA 1BG4A 1H0IA 3NDYA 4HZ6A 4AD1A 1B30A 4W93A 2GJXA 1H4PA 1L0PA 2XFRA 3ARXA 3L4UA 1JI2A 3SCTA 2W92A 5A6MA 5C71A 4WKFA 1W1PA 2YBTA 1C92A 1D2KA 2ZWZA 4TTGA 3MUZ1 4D71A 4GQQA 3RILA 4C7DA 4QLJA 2FHCA 4UFHA 1GQKA 4AYSA 4CCCA 1TCMA 4GPNA 3AIEA 1VIWA 4C7FA 1V6YA 4FZOA 4KGJA 3MUY1 4TVDA 4J3SA 4LXFA 1MQPA 2HVMA 1V0MA 1G94A 3AQUA 2WMIA 2ZX7A 4X0NA 1B0IA 5HDRA 4PUDA 4RE4A 1OIFA 1KGWA 1N82A 3ARTA 1GVYA 3NJ3A 4EK7A 5BXTA 1B1YA 4TTUA 1PX3A 3EBVA 2VQTA 2BVDA 1V3JA 4RE3A 3WNPA 1J10A 1R7AA 1H09A 3UG5A 1QVBA 2CPUA 3WEMA 1E0XA 1M7XA 2Y4SA 4UQCA 4W84A 1H3GA 1V6WA 2YA1A 4OIFA 2XGBA 3SCNA 2AMGA 4H7VA 3TA9A 4AD5A 1ISZA 1QI2A 3ZSTA 3VMPA 2EEXA 3WFZA 1H1NA 3L4WA 2GK1B 4JKMA 3ZMRA 1QNQA 1TA3B 2ZX6A 2VVNA 2EPKX 3VIPA 1E43A 1NP2A 2ZUNA 5A8OA 3CMGA 2ZUMA 5EB8A 4AZ7A 1F4AA 3VNYA 5ABFB 4X9YA 1MQRA 3L4TA 5EMYA 5EFFA 4ATWA 1CXLA 3WD3A 1E6ZA 1E72M 2J74A 4UOJA 1QHZA 1V6XA 3OLIA 5A8NA 5HPOA 4P7LA 3OZOA 5E6YA 1XH1A 4QLKA 3WDHA 2ZX8A 5ABGA 3VMNA 1MQQA 3VDAA 8CGTA 2XPKA 1HJQA 4S3JA 1MXDA 1V6VA 2CEQA 3N17A 1M03A 3SURA 2VZOA 5I24A 2VC9A 4KWUA 1CXKA 2WNWA 3AYRA 4GI6A 4MB1A 1JYXA 1G5AA 1B3VA 2QMKA 3S2CA 2WCGA 3AZSA 1NWUA 3SCVA 1TG7A 3WY1A 1WDSA 3GBEA 2WHLA 1XD0A 4DM1A 3AZRA 1BYAA 3OGSA 1KWKA 4JHOA 4GZJA 4UNIA 3UEQA 1EH9A 3NYDA 4QAWA 1B3WA 1DWGM 3K4DA 2WKGA 4FF5A 3GH4A 2WB5A 2W61A 3RJXA 4W89A 1FFRA 2XM2A 4HZ7A 2PBGA 1GPFA 2GDVA 1V6UA 2ZXAA 1B3YA 1ISVA 1RPKA 3CHFA 1WZAA 1R8LA 4PTWA 1RH9A 4PBGA 4W87A 3CGTA 3W37A 1QNOA 5E0CA 1V0NA 2VJXA 4D6DA 4XUYA 4AIEA 1BYDA 4AXNA 2J8FA 3DHPA 1ZBVA 3U57A 4CD5A 1DWAM 4D6FA 4CVUA 1CGUA 4M81A 3ZO9A 1CXEA 2OO2A 5I78A 5JBFA 1Q6DA 1VEOA 2W63A 3ZQ9A 2DIEA 3AYSA 3PZUA 3AS1A 4MTVA 3EMZA 4F79A 1ZJBA 1W91A 2WVTA 3ARZA 5CLTA 1HX0A 4NF7A 2E9MA 1C93A 1UH3A 2FDMA 4Z2IA 4CN4A 1M53A 3GYCA 3A4WA 3II1A 1EA9C 3LPFA 1CZ1A 1UKQA 1WB0A 2A3EA 5LYRA 1E5JA 1CGTA 4H41A 3ZT6A 3AXXA 3K8MA 2YOCA 1EIBA 5BCAA 3BC9A 1ZBWA 5I77A 2XWDA 4LPCA 5AY7A 1IZKA 4PCSA 3ZR6A 3CH9A 1H11A 1CXIA 2C0HA 1OM0A 3WUEA 2WW5A 1C7SA 2WK2A 1E6RA 4GZEA 2BHZA 4Q22A 4MNLA 3GXIA 3OB8A 4M82A 4M8UA 3SEPA 1V3MA 3CZ8A 2DIJA 4D1JA 3JUGA 5DFAA 1LLOA 4JZ5A 4P8XA 3VPLA 2O9TA 3VIHA 3WUBA 1OCQA 4D6EA 3VDCA 2YLLA 6A3HA 3CUHA 1SR0A 2J7CA 3WMSA 3W28A 2F61A 4ZE4A 1XCWA 3ZR5A 3MV01 4N42A 2J79A 6TAAA 3GDBA 1GORA 1BLIA 2VT0A 3AIQA 3MKKA 1E4NA 4MAZA 4OZOA 2V3DA 3PZIA 3IANA 1EHNA 2VX5A 1BTCA 1W9VA 1WE5A 3VGHA 3T2OA 1CXFA 2XSBA 1YQ2A 5A1AA 4ACZA 1X1NA 2XVPA 4FLQA 5CXPA 2VR5A 5D9MA 3VD9A 2ZICA 3PZQA 1W32A 4H8HA 3RDKA 4B3KA 3BAKA 1W1TA 1GJWA 3AIVA 4AD4A 3L4YA 1J11A 2UY5A 2F8QA 5A69A 1UR0A 5BROA 2W4XA 2YA0A 3WQ5A 5CZKA 2WXDM 3LPOA 2TAAA 5AC5A 3WD1A 4J3VA 3QHNA 5D9OA 2XJ7A 5I2UA 1M04A 3ARQA 4P8UA 1ECEA 3U5UA 3PZMA 1OGGA 1NOUA 3MU7A 1J0HA 1LF1A 3ARUA 1CLXA 1X6LA 4WF7A 3ALGA 4PYSA 3SCRA 1JXJA 5CGMA 3BAWA 1JAKA 2CIPA 2ZUWA 5E70A 2DH2A 3KL3A 3T09A 1VF8A 1V3IA 4FLSA 3POCA 4HMEA 1E71M 4Z2JA 3L4ZA 4Z2KA 4IPNB 3T0BA 3RJYA 1CXHA 3GTNA 3WDRA 1JNDA 2XIBA 1ITXA 1JF5A 2WAGA 3BMVA 3U7VA 2GDUA 4JFWA 1ODZA 2RGMA 1IT0A 3VNZA 3T2QA 1UWQA 1ODUA 1WKYA 4CD7A 3OGVA 1U30A 4W88A 4EE9A 1C91A 2X05A 4PTMA 3TONA 1R7OA 3WBEA 4IPLA 3N11A 3M7SA 2FHBA 1TE1A 2A3BA 2HISA 2E40A 3LPGA 4TVUA 2CHNA 5A6LA 4V27A 1MW1A 1US2A 2D2OA 2BXYA 1HVQA 5FIPA 4JIEA 4M80A 1B31A 3APGA 4JL2A 5D9NA 4YN5A 1JD9A 3MUIA 2J7HA 1W3JA 1W9PA 4CGTA 2ZUVA 2VL4A 1QI5A 4U2ZA 4TX6A 4MB3A 4HMDA 1E6NA 4UQBA 2CERA 5DO8A 3ZJKA 2MANA 4W5UA 4FLRA 1ZS2A 4MADA 2WVVA 1JFHA 3L4XA 2DQXA 2VMFA 5D9PA 1QI3A 3FW6A 5BXSA 4NZCA 4U2YA 4QFUA 3VIGA 2DSKA 2O9OA 4J28A 1UR2A 3WNOA 4X0VA 2D20A 4HOZA 4GINA 1UD8A 1G1YA 5DT7A 2X1IA 4HU8A 4UQEA 3ZIZA 1MW0A 3WD4A 2O9RA 1K9DA 3CZGA 1C3FA 2ZX9A 3U7BA 1GOKA 3CLWA 1Z32X 4B9ZA 1XGZA 2XG9A 2DSVA 3OLEA 4DWSA 1PAMA 5FCZA 2EPLX 5HNNA 5EFDA 3CZJA 4Z2HA 3VM5A 5I6SA 3VGFA 5HXMA 5FL0A 3SUWA 5CSUA 3PBGA 3QOMA 4AIUA 2JIWA 2PWGA 1GQJA 3WNKA 1UG6A 2UY4A 4BQ3A 1EHAA 2EBNA 4AZIA 1VAHA 1XSIA 1LJYA 3WF1A 2WBGA 2EQDA 1SMDA 3FN9A 4M24A 1E15A 3F5LA 5E9AA 4GQRA 1ZBKA 1EQPA 4ZXLA 2J7FA 3ALFA 1LQ0A 4HZ8A 4AZHA 1KCKA 3BLKA 3WDPP 1ZB5A 3SUSA 3AIBA 2JEPA 3F5KA 4PMNA 3ZJ7A 4AIOA 2GJXB 1VEMA 2E3ZA 2OWXA 4L4OA 3CUIA 3O9NA 1F4HA 1K9TA 1V08A 2G41A 4OOUA 3NDZA 4CD6A 2CESA 1WZKA 4K68A 3GNOA 3HN3A 2J7GA 2EJ1A 3EDDA 3PN8A 3U5YA 3T08A 1OT1A 1JZ2A 5ECUA 3WF2A 3MMUA 4RL3A 4WLCA 1P6WA 3CHCA 1LWJA 1W9BM 2XYLA 4HA3A 2JE8A 2WMIB 1E4MM 1GVIA 2JF6A 3NUKA 4OBSA 3TP4A 2BY1A 3ZOAA 1J0YA 1Q6GA 3WUFA 1VRXA 4TOQA 1KCLA 1VBRA 3IK2A 1QNSA 1LL7A 2QPSA 4PMOA 2E9LA 3PTMA 3RCNA 1V0KA 2PWFA 5A94A 3ZJ8A 4D6JA 1E56A 3FHQA 5A2CA 2WSKA 1XRVA 4ZXOA 2VQUA 3VKKA 2WC7A 1O7AA 3E1F1 2IXVA 2V3FA 3CO4A 1OGSA 5C8BB 3AHZA 1BF2A 2DT2A 2ZUUA 1UA7A 5BXRA 2OWCA 1JZ3A 4CN1A 3VIOA 4W86A 3IJ8A 1QHPA 4PTXA 3GH7A 4R5EA 5LA2A 5E0FA 1XYFA 3UCQA 2D0HA 1R85A 1BYBA 1LL6A 2WZEA 2NT1A 1CECA 1TFVA 1FP9A 4UFLA 3UERA 3WQWA 2ZE0A 5I79A 3AZTA 4HP5A 4TXEA 3TTSA 2VRQA 3N04A 1CTNA 3B8SA 4P7NA 3LMYA 1KBKA 2G3MA 5CLWA 2EPNA 3DYOA 4GXPA 1BG9A 5IDIA 3F5JA 4YHEA 4PMVA 1FFQA 3WN6A 3WQ8A 2CITA 2Q8XA 2ZX5A 3AMGA 6CGTA 3WEOA 1VBUA 3SCQA 1V3HA 1EDQA 1BVNP 1WPCA 1AQ0A 1U33A 2PI6A 4LGXA 3WD0A 3AIUA 1VFUA 3RO8A 4AW7A 5JBDA 1PX8A 1JYVA 1PZ3A 5A6KA 2J7DA 4KRTA 2DT1A 7TAAA 3MSGA 3SUTA 1NARA 2VZUA 2XVNA 4UTFA 1AMYA 1PPIA 1R86A 3AROA 4W7WA 1OB0A 3OG2A 1QNRA 2BY0A 1JI1A 3K46A 5I23A 3W24A 5A8MA 3UESA 3RM8A 3ECQA 4PEEA 2VVSA 1C90A 1HIZA 3RMEA 4S3KA 2IXUA 3L2MA 3WH5A 5A2AA 4F9DA 2VCAA 3CBWA 4PMRA 3VIIA 4GI8A 3T0AA 1E1EA 5AYIA 1C8YA 4WSJA 3KL0A 4DUXA 2YL6A 2WYSA 4P7RA 5A3HA 4E8CA 5M17A 3OZPA 4JFVA 1V0LA 3GBDA 2BVTA 2OZNB 4UR9A 3EDEA 3WMCA 4WKAA 4GKLA 3QGVA 3EDJA 4UFMA 3WH9A 1VB9A 1GONA 2G3NA 3EDFA 2OWWA 4MJ4A 1HJVA 1WZMA 1U2YA 4U33A 1JYNA 1HP4A 1E0WA 2O9PA 5A6AA 1XYZA 4NRSA 1NWSA 1C8XA 4JKKA 1HKMA 4CD4A 2XGIA 3CMJA 5M3WA 3NCOA 3QR3A 2C7FA 3GM8A 4UQAA 3FY1A 2UY3A 3AMKA 2V3GA 1E73M 1JD7A 3G6MA 1JZ8A 3VTRA 2QV4A 3AI0A 1W9XA 1TR1A 4WKHA 4ATDA 1YHTA 1UOKA 3ARRA 2WSPA 3WDJA 5BWFA 3WNMA 1DP0A 2BS9A 4W5ZA 1XSKA 4AEFA 4CUCA 1OD8A 1DHKA 4WIWA 3ZM8A 4CVWA 1OT2A 1W9DM 3WMBA 3MUAA 2D3NA 3AJ7A 2QF8A 1ZL1A 2E9BA 1UR4A 1JXKA 2XTKA 2YJQA 4IISA 3G6LA 1JZ6A 3SCSA 3CHEA 1EGZA 5BRPA 2GVYA 5CPTA 2JEQA 2CBJA 3AS2A 4CU6A 2A3CA 3W26A 1QBAA 2VRKA 3WF4A 1XCXA 4DUVA
chains in the Genus database with same CATH superfamily
1E0UA 1Y5WA 3UBPC 4C6DA 4Z2LA 4BF9A 1JZ4A 1E4LA 1S1PA 4B15A 1OK4A 1VFTA 3CIXA 3FHAA 4DCNC 4FLOA 4OBRA 1LBFA 1UR9A 3W02A 5HAOA 1D7FA 4RDWA 4TMCA 3GXFA 3CQ0A 1EDGA 1ZU8A 5TIMA 4V2XA 3LUTA 5C5YA 4FXRA 1W1VA 1K9EA 4HA0A 3UR8A 4H9TA 3O06A 1EF2A 2DV0A 3BUQA 1UH2A 4B4HA 1XLJA 3TNBA 3IV3A 5IXEA 4XISA 1Y7VA 4TO8A 1HKJA 3QC0A 1UMYA 3QKZA 3FCPA 1C7TA 3T0DA 1EXBA 1IIGA 3AICA 2G97A 3CUJA 3O7UA 1FBAA 2V3EA 5BW6A 1W1B1 3FKRA 2FGLA 1MFVA 4DY1A 2OYLA 3HGJA 4XAZA 3UP8A 2BFGA 1Q4NX 3MA8A 4KPLA 4HHHA 3SIMA 4ALDA 2WPGA 3G8EA 3B0PA 3H2MA 5D8WA 3GIYA 3R94A 1J0KA 1E9IA 1H61A 3EX4A 1FH7A 3VGEA 3EEZA 1A50A 2PZNA 3P14A 3LG3A 3VE9A 4J3ZA 3R7MA 3MMWA 1LT8A 4K3ZA 1ZLPA 2LLEA 1F8IA 1QMLA 2G37A 4MDPA 5A2BA 5DMMA 4YU1A 4QG9A 3SCPA 1DWHM 4RZ5A 3BSGA 2G95A 4UFIA 1KFEA 3G1RA 3HAJA 1LYXA 3I7QA 3AWOA 3GC5A 3RU8X 4AMCA 1PCKA 1AQFA 1UBSA 4ZOBA 4HNVA 1EO5A 1TUFA 4DM2A 1GOQA 4AD2A 1OGBA 4JL1A 3S1UA 2GGEA 3BCFA 3OIHA 4UR8A 4POCA 1WX0A 4HA1A 3G3DA 1J6OA 3W01A 4IWQA 1QWKA 2HE8A 3L5AA 4GFSA 2ZCGA 1AQHA 3HAHA 5DMYA 1HW6A 4U31A 3UETA 3W0KA 5A6BD 4M0XA 4KEVA 4QISA 1H7RA 5HPCA 2E09A 1WKDA 1F3XA 3S6TA 4A2SA 3FJNA 4XZWA 4UZUA 3PNUA 4KCWA 4H8VA 4ICMA 4HTBA 2H3BA 4JIPA 1RP9A 4GJJA 4UTHA 2H3DA 3L0GA 1RAKA 4AY1A 2Q8ZA 4LQ1A 1QBBA 3DC0A 4EZWA 3VILA 3K4WA 3CC1A 3KDOA 3GVGA 5EU9A 3W87A 2VX6A 5AYBA 4BF7A 2GJRA 4QG6A 2E8YA 3LHVA 4AWTA 1KXTA 3NEHA 4F8XA 5C5BA 4XX6A 1CGXA 4R85A 3BUBA 5AC4A 1RBLA 2CU0A 5A8PA 1XR2A 1TWDA 1GVQA 2YKKA 4S3CA 3W7DA 1TB3A 3GI7A 3NQEA 3W1PA 3VX1A 5CSRA 3EWCA 2VNCA 2J6XA 1WUFA 3BLPX 3VDHA 2C18A 3LDVA 9CGTA 1ZAHA 3WD2A 3ZFHA 3AOFA 5FOOA 5K4XA 1K7XA 5BOEA 5KITA 1QI4A 4JFUA 4H83A 2G3JA 2TYSA 1GKPA 2H8XA 3CJPA 1G0CA 2AKZA 1I1XA 1OBAA 4DWSD 5C9WA 5LIYX 4NT0A 3G1DA 4IW0A 2ZIDA 4QM1A 4KFPA 3GB6A 3LN3A 2G3IA 2C1HA 2F2HA 5LIKX 3TJ4A 4ES4A 4Q4RA 1SW3A 3K1DA 4ONVA 3KE0A 3FXYA 1P0NA 2VEKA 3WJZA 4G6QA 3DFNA 4DJDD 1Q66A 4NYYA 3IPWA 1BGGA 3D2EA 1BWLA 2Z00A 4AZGA 3SFKA 1VHCA 2BSLA 2UV8G 2PDNA 5CC3A 4AD0A 1PYMA 4GI9A 2WM0A 3IV8A 4WK9A 2D1ZA 4DWDA 1EP3A 1FRBA 2VX4A 1KBIA 4EXQA 2VCBA 4D6HA 3FJLA 4ML9A 2ACSA 3OBAA 5HATA 4R5JA 4RXFA 3KAVA 1GKRA 3ZT7A 3M1ZA 4GXMA 5ABFA 3OGRA 2YCLB 1YDYA 5MHBA 3T2PA 3BUVA 1LRNA 1PBGA 2VFDA 4JTTA 4A6GA 1XQKA 2DT3A 4NJIA 1U22A 2J25A 3URQA 2YR1A 2TMDA 5CBJA 3CT7A 5JBEA 3UZYA 2DZTA 2Y24A 3ARWA 4ZB2A 4AD3A 5LSMA 1RVGA 3ZS4A 2ZUTA 1UZ1A 1KBBA 3V1HA 4OT7A 4H8UA 4ZQNA 4ERAA 3NO3A 4XB3A 3GG0A 1CI1A 4YNGA 1XIHA 4J27A 3N4AA 2VELA 1GT8A 2YDRA 1A3HA 2RKXA 1Q6QA 3GRIA 1OEPA 4JYFA 3OZYA 3D46A 2YW3A 4WR3A 1XDMA 4FIRA 5JXQA 4I5UA 3DX1A 2YFNA 2Q13A 1ZP4A 3IAQA 1WDWA 5CH9A 3G8RA 1S5NA 1NP0A 5IHRA 4CCEA 4DPPA 1UD4A 2P3EA 4L65A 1XLAA 1GZJA 4UNLA 1EXPA 1SO5A 3ARPA 4O14A 4DB7A 5DY2A 1B54A 1G4TA 2YL9A 3CQKA 1A49A 3L4VA 5H2ZA 4AF0B 3VD5A 4PULA 3AMLA 4O52A 2YDQA 1BHGA 3WL0A 3GUGA 4XBSA 3CB8A 2GQ8A 3H54A 1W1ZA 4FPSA 3B9EA 5LA1A 5AN7A 2V82A 3BJFA 1M68A 1F76A 2Y85A 4A21A 1TSIA 3B0VC 2GZXA 2FGBA 5FJTA 2VFHA 4IWPA 1A80A 2X0SA 3MDUA 5JQ9A 2ASHA 1CDGA 1PWMA 2QJHA 3EJQA 4ZSUA 4JFSA 3UPWA 1UKOA 3THQA 5K3VA 3GC4A 4QG8A 1HQTA 1IGSA 4HCHA 5E5CA 1OYAA 1SZEA 3R58A 2QUMA 3LPPA 2CZFA 2Z28A 4UTLA 5I3DA 1XIFA 2Z8YA 4JWCA 2XVKA 2DDXA 4TQTA 4WY0F 4L1XA 1DXFA 4TVCA 4RZ6A 1UWRA 4LYKA 1T5AA 1HKKA 3GTFA 4UOQA 4MAVA 1DWFM 1RA5A 3W83A 3G5EA 4U5KA 3GYEA 2J88A 1GQIA 2JGYA 2PF0A 5LNVA 2NX9A 3S9YA 3M0XA 3CYVA 3SRDA 2WHKA 5D38A 2AGTA 1HP5A 2GUUA 4C90A 1N8IA 1GVOA 1RY8A 3PJXA 1WKEA 2BXZA 3FFSA 3QY6A 2LXYA 4IGSA 1VR6A 4E4PA 1J79A 3WBXA 4AHQA 3IJ7A 4W7UA 3FA5A 4LAUA 3SCWA 3WH8A 2XWEA 2Z0IA 4S3FA 2X0HA 4HN8A 2BGSA 4M1RA 2C1GA 4YVPA 1BKHA 3FNDA 4QCFA 2FZ8A 4IFKA 5C6MA 2PDCA 2FYMA 2NSOA 1UC5A 3PZVA 3AISA 1V03A 4MNKA 2D23A 4CQ8A 3OODA 4OUEA 5KSWA 1WNOA 4UFJA 2Z1SA 1FHLA 2FB2A 4F2UA 4G1KA 5XINA 3M0MA 4BA0A 5G4WA 3QW3A 3A47A 2IKIA 2CHRA 1WXZA 1T96A 3O3OB 3RNDA 3BAYA 1POKA 1ZZMA 1KXVA 3EKGA 4DJFD 1IEXA 2XZ9A 3N4EA 1JDCA 3MI2A 1YNPA 4KKXA 1NJJA 1CEOA 4J3WA 5LXEA 2J47A 1W56A 1Z48A 4GUFA 2JFEX 3PG8A 1EUAA 3MDWA 4F66A 1GEQA 3ES7A 4NJJA 1CIUA 3CIVA 1GG1A 1OJXA 2A3HA 2CCRA 1Q13A 4EZQA 1AODA 5G4EA 2VM8A 1XYAA 3DAQA 5I02A 1S46A 4CQDA 2XH0A 3H2NA 3GXDA 2HPIA 1MNZA 3PZTA 4RPPA 2WMHA 3KBSA 2H9AA 3WF0A 3GLCA 3QC3A 4Y9NA 1LLWA 3EA3A 1J0ZA 4UZSA 1UYQA 1E6XM 1W2PA 2I7GA 3VKBA 4F0KA 1FXQA 3VGGA 2WZIA 3GX9A 1M01A 2D2GA 3NPVA 4GVHA 3ZR4A 4S3EA 1I4TA 4D6CA 4N9CA 4BFAA 1OFPA 1JFXA 2WANA 2KHOA 3H2OA 2BOGX 1KWGA 2WJDA 1B90A 2CKRA 1UD2A 1Z42A 4LSBA 2V69A 1HKIA 2WZHA 3BW4A 4HNCA 5GJNA 1E6SM 1MEIA 4JY8A 2ZUSA 1JPHA 1TMQA 1PSCA 3P82A 4AH7A 3VDBA 4Q8MA 3F4VA 3KS5A 1Z9AA 3UR5A 4E8DA 3S1VA 1SR9A 3SRFA 3EDKA 4YCOA 3O6AA 3GKFA 4LOCA 2DZUA 5CG0A 4TX8A 1OFQA 2ZRVA 4GYPC 4YXGA 2QDDA 4L80A 1GNXA 4JR5A 5CJNA 1A5UA 3QY8A 1B9ZA 1OA0A 2ZXDA 1UHVA 4IHCA 5CPSA 4EPKA 3PLTA 3S6DA 1D8CA 3E3HA 4MPKA 3GVRA 3WG6A 3I65A 3LCFA 3C0SA 4YL2A 4KH2A 1XQLA 3VABA 4NAEB 1JCNA 5CBBA 3TU9A 2VDIA 2XUCA 2BOFX 2WYHA 4E2OA 4GCXA 3FAWA 3H7RA 2CZDA 3EA2A 4MY1A 1JAEA 4P5UA 1OX6A 2GVJA 3BMXA 1IZJA 2Z6IA 4PODA 1E55A 2YA2A 3W6LA 1EKOA 4EWJA 1V6TA 4PBFA 5HNRA 3W70A 3F4NA 1RR2A 1G7VA 1KKRA 4E3TA 1TPVA 1NM9A 4GOAA 1NOFA 1MUWA 3WJSA 4LY4A 1SZFA 1BF6A 9RUBA 3ABQA 1QPRA 1OABA 1H7OA 2CBUA 4HPXA 4G7EA 2GYIA 1BGAA 1PDZA 4UOZA 5JIPA 2I14A 3DI0A 4JTKA 3K30A 2GPTA 2GLKA 4M29A 5AHMA 4CNUA 2EF9A 1JZ7A 3AU6A 3IGSA 4MKNA 3HGRA 2WMJA 4C91A 2R6OA 4CNOA 1WZLA 1V4YA 3PY2A 4JICA 1WDQA 4UQ9A 3EYPA 1DKYA 2YZRA 4AVOA 3CTTA 3S1GA 4LBSA 1JR1A 3WQGA 2WWDA 3OJGA 4KRUA 5DY3A 1KKOA 3NDYA 4AD1A 1NU5A 1SU8A 1EBGA 2XFWA 1CB7B 1K3UA 4A8RA 1KRMA 3KCLA 3D50A 2P53A 3DBNA 1C92A 4M6VA 3M16A 3HPZA 3MUZ1 1Z8AA 4D71A 4GQQA 2FHCA 4AYSA 3E6EA 4GPNA 3AIEA 3ZLHA 4C7FA 4L61A 3WK1A 2PUZA 4KIRA 3HQOA 3W00A 4UMCA 3SN1A 1TPB1 4C1KA 4PEKA 3AQUA 2HROA 1R2RA 2YPIA 5HDRA 2PEVA 4PUDA 2G50A 3B4UA 1N82A 1EBHA 2XU2A 1SW7A 4TTUA 5DELA 3XINA 1V3JA 1TPDA 3P67A 4S3DA 1H09A 3UG5A 1M7XA 3HTWA 4W84A 3W86A 3KDRA 4FOUA 3S5SA 1V6WA 4OIFA 4IL0A 2XGBA 1ISZA 4WGHA 3RUBL 3ZSTA 3OO2A 1YLVA 1UIPA 3TR2A 2BBFA 2EEXA 1H1NA 2ZX6A 3NEVA 2DQWA 2VVNA 3VIPA 4ZO7A 3T0CA 3CMGA 3BSMA 3XIMA 4X9YA 2NQHA 3B9NA 2TPSA 4WGXA 4Z1DA 3C52A 2C3ZA 1GWJA 3R4IA 3VC6A 2J74A 2X2GA 3S9IA 3KCOA 4B5XA 4DXVA 4P7LA 3OZOA 3GVVA 4HT3A 4MWAB 5E6YA 3MUCA 1XBXA 2QPXA 3EKZA 5U4NA 1IT7A 1MQQA 3O07A 4I9MA 8CGTA 3Q0KA 4Q4KA 4CNNA 1VS1A 1HXKA 4LU0A 4CEUC 1C8VA 5FI8A 1TWIA 3UVAA 3A24A 1S2TA 3NQBA 3SURA 1UZHA 1RUSA 4C5ZA 3VNLA 2PLKA 3BVUA 1G5AA 3NL5A 2QMKA 1ONWA 3S2CA 3DGRA 3G0UA 1F6PA 1K1DA 2E28A 4AVFA 3SCVA 4UIOA 3WY1A 1WDSA 2EFLA 2P8BA 3GBEA 3PS7A 5EKYA 1I0BA 2PAJA 2FMOA 4LAOA 1FWNA 1BYAA 3GWQA 4DZAA 4GZJA 5FF0A 3BG5A 3M0KA 3NYDA 4C6OA 1DWGM 4DLFA 3F2DA 4ZQMA 4OE7A 2XIJA 4DZ5A 2VD8A 4NIRA 2ICSA 4WEVX 2XM2A 3IARA 1V6UA 2ZXAA 4G8TA 1YPIA 1RPKA 1R8LA 3ENLA 3W37A 3IK4A 4O15A 4IZGA 5XIAA 4D6DA 5K9XA 1XIGA 4AIEA 2OU4A 3C8FA 2J8FA 4GCAA 2RJGA 3O8AA 4ZMGA 4C65A 1PTGA 3REQA 4LRSA 4M81A 2QCMA 1CXEA 5JBFA 4M1BA 4TIMA 4GI4A 2W63A 3ZQ9A 2HNEA 5HQMA 1P43A 3PZUA 1BTMA 3AS1A 1JCTA 3QQ1A 4E3CA 4OUIA 1QNVA 3LCLA 4O17A 1HX0A 4NF7A 1C93A 1UH3A 2FDMA 4NP7A 3GYCA 3VOFA 4G7FA 1EA9C 4WRHA 3U6WA 1UKQA 4RZBA 2A3EA 2VUNA 2PZ0A 2ZC1A 4DBWA 4JYEA 2YOCA 3MMTA 2I9UA 1DXEA 2QDGA 2TRSA 1M7OA 5JH1A 5BCAA 3LI1A 1RA0A 4NVTA 5I77A 1T41A 1IZKA 3CH9A 3I68A 4NZ4A 1OM0A 3N3MA 1JPMA 4ZA0A 2V30A 2CLMA 2OEJA 4ROPA 1OVDA 1TQVA 1Q2SA 1I8JA 4KWSA 4M82A 2PRMA 3UYCA 2BASA 2GQAA 4D1JA 2ALDA 4UTKA 1O5XA 3MB9A 2O9TA 2DFAA 4DO5A 1OCQA 3T46A 2YLLA 4CQ9A 1SR0A 1ELSA 2J7CA 3SQSA 3W28A 3I6RA 4N42A 3GDBA 2VT0A 2BWGA 1MDRA 1OC5A 3MKKA 4U4MA 4MAZA 4M51A 3IVSA 4FXJA 3GG8A 4OZOA 3VKJA 2VX5A 1BTCA 4JTEA 4LF1A 3DCPA 1ONXA 3T2OA 1CXFA 4GIYA 4JTJA 2HS6A 3T07A 4PZVA 3NG3A 2PGFA 4LUTA 1TPWA 3LLLA 2XVPA 2E7FA 2OG9A 3WQOA 4FALA 4GUGA 3VD9A 3EJRA 4LS2A 5F1UA 3SBFA 1PYFA 4H8HA 1IEWA 1HL2A 3BTNA 1RCQA 3BGGA 1W3IA 3WMLA 5BWAA 4R7WA 5I07A 3NZQA 2OZTA 2F8QA 1L6FA 1R38A 1UR0A 1GTEA 4XZ9A 4LCQA 4NJHA 3NL6A 1UOZA 2WNQA 2WXDM 2DZBA 5D2VA 4H1ZA 1ME9A 1V7AA 2YDAA 3LI0A 4OBTA 5AC5A 4GYFA 3CQJA 3GVWA 3QLDA 1U1UA 1J2WA 4KEMA 1VYRA 1BXCA 3EB4A 4X3ZA 3EXRA 2Y7GA 1X6LA 2BX7A 2QJJA 4FZIA 3WK3A 4R34A 3GQYA 1RJPA 3LQGA 3W7LA 1QK0A 1JAKA 1R2SA 3GHRA 1UCWA 2ZUWA 5C9UA 3BE7A 5K4ZA 2QDHA 1JPDX 3POCA 4HMEA 5E0KA 3T0BA 3WLRA 3GTNA 3WDRA 1FWWA 3N2OA 4JQ4A 2WAGA 1KO0A 2C1IA 3FEMA 1ODZA 3G9GA 4CD7A 1U30A 3W07A 3KOYA 4LUSB 3TN6A 2QS8A 3M7SA 2FHBA 2A3BA 2CHNA 2VEIA 4NAEA 2BXYA 4LTSA 1VJIA 4JIEA 1B31A 3W88A 3DU0A 1A3XA 1JD9A 5HNUA 2RJHA 1UC4A 4H8SA 2Y6ZA 4JNYA 3RCMA 1GVFA 2IKHA 3W75A 4U2ZA 4TX6A 4MB3A 3KUMA 4L4MA 1ECQA 4UQBA 2J24A 5FESA 2V68A 3E0FA 2E67A 4Z17A 3QMRA 1ZS2A 2V8ZA 3W7KA 2OEKA 2JKAA 1JFHA 1A53A 3QPYA 3QA8A 1MRQA 2HDJA 1EJ7L 4GGBA 1BXNA 4EX4A 4O4VA 5DT7A 4Q8UA 1GVRA 4CNPA 2X1IA 1MW0A 1LUCB 3BVWA 3WD4A 2O9RA 3WLSA 1HO4A 3CZGA 3DI1A 1GGOA 4LW7A 1XGZA 1LRTA 3S2NA 3NQFA 2OTDA 4EZVA 5EFDA 3C2YA 3HQPA 3G1YA 3VGFA 3SIZA 3PBGA 3SJNA 4CEXC 2I5IA 2VC6A 3DDMA 3FLUA 3RCYA 5ECVA 4EF8A 1A0CA 2QCLA 4KCVA 1P4CA 1UZDA 3B03A 3DFOA 1W54A 2G3FA 3DN5A 1LORA 4S3GA 4DJEA 2WBGA 3O6CA 1SMDA 3FN9A 4BI7A 2V0OA 4ZXLA 3OIXA 3QVQA 3QWEA 4DQWA 4DZIA 1OHLA 3W1NA 3AIBA 1EGVA 4PMNA 3HGSA 4N4QA 3W3OA 5BU6A 4AQLA 1TQSA 4NAFA 3BWWA 2E3ZA 4QR6A 3S42A 1LZOA 3SO7A 1F4HA 1NIUA 1S3HA 4R7OA 4OOUA 3RF9A 4LUJA 4QSHA 2CESA 4DI8A 1EP1A 3GNOA 3HN3A 3I4KA 3FGCB 2EJ1A 4OHQA 2L5HA 4ZCWA 4UUIA 3WF2A 1TTPA 4MLJA 1P6WA 4H7ZA 4Z0JA 3URAA 4HA3A 2WMIB 1GVIA 3VZZA 4EZOA 1A4LA 3TP4A 3WUFA 1VRXA 1KCLA 3UWVA 3IK2A 1QNSA 2PDJA 3PTMA 3RCNA 5FEXA 1XWYA 4E81A 1E56A 3PG9A 2WSKA 3TYDA 1ZSXA 1KCXA 4PUUA 5C8BB 3GU2A 3AHZA 3GDKA 2DT2A 1R3SA 1TPEA 2NUXA 4CN1A 3RRXA 4W86A 4PTXA 4N7QA 2OKOA 4L56A 3Q4DA 1OX4B 1LL6A 3LCHA 1PZ1A 2JGQA 2E25A 1O1ZA 3LV6A 3TKFA 3MKVA 5KETA 2OW6A 2XISA 5MKGA 3LMYA 2ZRWA 5D2WA 1R30A 4PC8A 5CLWA 4QEHA 2W79A 3RXZA 4QNWA 5IDIA 2X1SA 4PMVA 3ABOA 3WN6A 3WEOA 4KFOA 3Q2DA 3DEQA 3JU2A 3SCQA 1V3HA 3N6QA 1WPCA 4X22A 3L12A 5DLCA 4MY9A 2BLEA 2PI6A 3BW3A 4ADSA 1T7LA 2ZDSA 4IP5A 3WQEA 2AQVA 4S1FA 1PZ3A 1DJNA 2J7DA 3W1TA 7TAAA 3K13A 3MSGA 1TWSA 1S2UA 4H9UA 2VZUA 1FCQA 2NWRA 3M5YA 1R86A 4A22A 1Q8JA 2GQ9A 5I3JA 4FI4A 4JIRA 2HK1A 4PUWA 2AL2B 3VDGA 4I5RA 3S5OA 3UESA 1Q85A 4GACA 4C6FA 3RMEA 4F9DA 3M6YA 4PMRA 5L9FA 4E3VA 1W31A 4GWEA 3M41A 2Y62A 1Y65A 1XIIA 4E8CA 2YB4A 2BVTA 4UR9A 4GKLA 2X5CA 4Y9OA 5I3HA 1BRLA 3EKLA 2G3NA 1UASA 3M0YA 1U2YA 4NYUA 4GNVA 3GY1A 1FWDC 3HOJA 1HP4A 1F05A 3WQPA 9XIMA 5E93A 4YYFA 3H21A 1C8XA 1X96A 2XGIA 3MP4A 4L1WA 4RE0A 3NCOA 4DF0A 4MMWA 2RDUA 3HZ3A 2Z27A 4KCUA 2PCEA 1JZ8A 1B3OA 3VTRA 4K2SA 3TFCA 3MWCA 2BMBA 3AI0A 4J9JA 1TR1A 1O60A 4N6FA 4IIDA 4UCGA 2ZYFA 5G2IA 3ARRA 2WSPA 2PFHA 2EG7A 1EL3A 4IPIA 4YS1A 5BWFA 4TV5A 2GOUA 4K39A 1DP0A 4RKAA 3TC6A 2HK0A 2NXHA 4AEFA 2NX1A 1P1MA 3U0HA 3IUHA 2QGYA 5G1TA 4J2MA 3GNNA 3ER9B 1W9DM 2YZ5A 2E9BA 2AKMA 1SU5A 2XTKA 3HG2A 1ALDA 3G6LA 4QJ1A 1EGZA 3SR7A 4I8DA 5BRPA 4Q33A 1Z7AA 3OG3A 2GJLA 1ZPTA 1EC7A 3HMJG 1WV2A 4BEUA 2YI9A 1KLZA 4CU6A 3K2GA 3W26A 1R47A 4PFHA 2VRKA 4E2BA 6TIMA 2PDKA 1OQFA 5J5RA 3SYVA 3W71A 3LHZA 4FP1A 3ZJ6A 4D9PA 5KZ6A 4L6OA 4Q4QA 5DBUA 2Y5SA 3RX3A 1XBZA 4XTIA 3NAVA 1NWRA 3CZNA 1YTKA 1FVPA 1J5SA 2QF7A 2Z2UA 2EKGA 1W3TA 2WMFA 1BFNA 1RD6A 3XISA 3GD6A 3DGBA 4LVFA 1W2VA 1PKYA 2OLHA 3NSMA 1ADDA 1S5VA 1PKNA 5HANA 2X7VA 2Y8KA 1ZWWA 5IRPA 4FNPA 3TN4A 3VIMA 4N0RA 2Z2BA 3W4RA 4LANA 1OX5A 3ISIX 5C2XA 1W3NA 3LRMA 3K5XA 1D9EA 1GOMA 1FWIC 1YNYA 4K38A 4DRSA 1R33A 2QZRA 3OWGA 1E0VA 4AEEA 2GAFD 4W7VA 3SM0A 1W3HA 1VC4A 2VURA 4GXWA 3TTQA 2R14A 1ITCA 4S3AA 1Z89A 4ZO6A 1DTNA 1MO0A 5CG7A 3LBMA 2CXGA 1NSJA 2BV9A 3BDKA 3DFPA 7REQB 1K7FA 3NIYA 3LLDA 4GYPA 5BU9A 4PMQA 3ANUA 1GOOA 4WPEA 2E4TA 3DESA 4I90A 4J40A 4L7ZA 5BMWA 5G2HA 3UJ2A 4JAWA 2B7PA 2QDEA 2CZ5A 3WQ4A 1JNEA 1E51A 5JUVA 4KW2A 3B9DA 3AHTA 3WF3A 4IMAA 5LIXX 2XM1A 4HMCA 3IIVA 4UFKA 2HBVA 3WLJA 7CGTA 1B3XA 2W67A 4FXSA 5FL1A 1DV7A 4HTYA 3DX2A 2BY2A 3U4AA 1O6IA 4KEZA 1FQ0A 1Q6FA 2VGFA 1DIKA 2OYMA 2PBOA 1OINA 2DGAA 4AC1X 4XZHA 1JCXA 1V7YA 4LF2A 4YWIA 3O1NA 1DJWA 5M5DA 3IJIA 2PDIA 4NXSA 3AXHA 5HMDA 2NV1A 2VI0A 2B0MA 1E5NA 3WQCA 1XYBA 3W1XA 2ZXQA 2I9EA 3KRZA 5AFDA 2Y8UA 5TD4A 2DH3A 1M6JA 2GF4A 3VKDA 2DZSA 3FS2A 4XK2A 4GNKB 1AZ2A 1NF0A 3IJ9A 1EGMA 3LK6A 3W7GA 3PWAA 5KZDA 5KBPA 2DT0A 3JZEA 1O94A 1C9WA 2EJAA 4INFA 4UNKA 3M0JA 3T55A 2QW5A 4J3UA 3UWEA 1ZENA 4LCSA 1DVJA 2REQB 3PHAA 2F9RA 2WKLA 2OT0A 4QCEA 5TNVA 2YL8A 2IUZA 3HMCA 6REQA 3B8UA 1DWIM 1LL4A 1MSSA 2V81A 1B4KA 4D8LA 4JTIA 1RK5A 1SQ7A 3UR7A 1K4HA 1ZJHA 2WVVB 3A5FA 3A4JA 4JN6A 3L67A 3F7WA 3N19B 1FH9A 2W3ZA 4GO8A 4F0MA 4XZBA 3WFAA 2CC0A 1PE1A 4NI8A 2Z1WA 3FDKA 4N4PA 3UVIA 1G6CA 1Q7MA 3R0UA 2XH7A 1TMLA 2X1TA 4QAIA 2J8TA 3TNOA 4ATLA 1SGJA 4C6QA 1FX6A 3JW7A 4DWSB 1R3TA 2PP3A 2IPGA 1J01A 5C0QA 1EJVC 2C16A 1ISXA 1KFCA 5C9XA 3L9CA 1J96A 5AHEA 1HNYA 3I3EA 2ESCA 4US5A 5I00A 4GZ7A 1J0JA 4ZQPA 4GA8A 5HUPA 3RPTA 4AVMA 3E0WA 1P6CA 1D3CA 3GR4A 1RQHA 2OPJA 1PCWA 1E40A 3URBA 4CU7A 1US3A 3N18A 3KEHA 1W3KA 4AX6A 7XIMA 5RUBA 2R94A 4S23A 1PX4A 1I6NA 2WMGA 3H2EA 2ZWYA 1MDLA 4EANA 3MSDA 2ZADA 4FMVA 4LAZA 1OD0A 2VO5A 2DSUA 4DO4A 3NXFA 3KOFA 1UWUA 3K8KA 5DANA 1ME8A 4ZEPA 4J4KA 2HXTA 2WMKA 3SZ8A 1KXQA 4DYKA 2PDBA 4N9EA 4A05A 1EF3A 1NOWA 1ISWA 4R5KA 3MHGA 1I0DA 2PB1A 4HNTA 1GW1A 3BW2A 8XIMA 1VPYA 5CEWA 3SSZA 4RDVA 3BAJA 3M3WA 4EZPA 3P3BA 4X2RA 3ARYA 1H2JA 2CBIA 4LUIA 1LWHA 1OYCA 4EP8C 3EWDA 3T4WA 4YIWA 2Q3RA 4HOWA 5CBIA 2QCGA 4WDTA 3GDTA 2E5DA 4CNSA 2ZXBA 3E9AA 1PXGA 5CSYA 1PO9A 4IJCA 1URUA 5AYXA 1VIZA 3VUPA 4GC3A 1ONEA 1AW2A 5DQPA 3DERA 2O0I1 1VLIA 4EOUA 1JRBA 2V2DA 1TIWA 1GQLA 4C6BA 4RX0A 3BJSA 5KEZA 3I7SA 3A4AA 1A47A 3TMQA 1H5YA 5JU6A 1CGWA 1XICA 1DEDA 2J8GA 4M6UA 1J6PA 1GKQA 3B9AA 3F7JA 3H12A 1FA2A 2QJIA 4R53A 3BZJA 3W38A 1X6UA 1TIMA 2CZVA 5ENLA 3C8NA 3B8WA 3M0LA 3L3PA 2GVGA 1FWEC 4HYVA 5HWNA 4BQ4A 4Q8OA 3PUEA 3QNJA 3AUOA 4IOTA 3H26A 1HJSA 4R9XA 2FH8A 1I75A 3L2LA 3KZPA 4M56A 3IGUA 4CLMA 4FNTA 3F4WA 1EX1A 3SUVA 4BEQA 3CHDA 4DHGA 3CPUA 3ZXWA 3LOTA 8A3HA 3V7PA 3HAIA 3OLDA 1XPYA 4QSFA 2QHAA 3LTPA 1KQZA 4XBJA 4K36A 2E6AA 3NURA 5KINA 2ZZ1A 2OB3A 2JNKA 3UZZA 1KFLA 4M6PA 5HMFA 3AMCA 4P8WA 3ATYA 3VX0A 4GQBA 3QV7A 1HJUA 3P8IA 2OJPA 1Q2RA 3APTA 3I3BA 5FJOA 1EEPA 4K8EA 4MB4A 1WDRA 1GOIA 3NSXA 1SYTA 3UJRA 3FEQA 1G7UA 1X8FA 2V67A 2TODA 3MWAA 4KRZA 2PDLA 3V5CA 1HT6A 4YPJA 2Y8VA 3OP2A 1KNWA 2VOMA 2QJNA 1JGIA 1SO4A 2WOQA 1XX1A 3KM8A 3QV8A 3LU2A 2X16A 4O0QA 2ABBA 2WCAA 4C7GA 3BMWA 1MYRA 1AH3A 4KGLA 1EOMA 1FY6A 2HVNA 3DYMA 4ZE5A 2DU2A 3O0KA 3N2TA 2J7EA 4J3TA 3UY8A 4XSMA 5CC5A 4IH3A 3WLQA 1KQYA 1X6NA 2QXWA 4KT2A 2Z1VA 4JTUA 4AWUA 1QOQA 2PY6A 3TJLA 1YBQA 1J4EA 4PUKA 3L23A 4PA8A 3UG3A 1CLVA 4WDWA 4X2PA 2WVSA 4QDMA 2DZWA 4RE2A 2VGGA 3DFTA 1SM9A 3UA4A 1QK2A 1MVYA 2J13A 3N12A 2CETA 3RLGA 2F84A 2HQAA 5FF3A 1XPGA 4WHBA 4JX4A 1F73A 3MCMA 4LAKA 1MFUA 3PZ9A 3K4AA 1G67A 1S39A 3P93A 3CWOX 1S2AA 1W9MA 1NDZA 2F7QA 2FTWA 2NWSA 2X7WA 3QHOA 1H41A 2Z1KA 1DYSA 4HIBA 3OA3A 4UXDA 1O12A 3IGHX 4P7QA 3UXAA 1HVXA 3NPUA 3AU2A 3GXPA 5D4YA 2W9MA 4FHAA 3QLLA 3VNDA 7TIMA 2OSXA 4A4AA 4NNBA 1TPUA 2QVNA 2X2YA 3W74A 1SZNA 4J7RA 2ATMA 5DX7A 3S2MA 5FKYA 5JIWA 1VZWA 2E1WA 5AYYA 3VA8A 3M07A 5LNUA 3WQ6A 1XG3A 2DSWA 4EVZA 1FWBC 1B3ZA 1UWTA 3R1ZA 1EIXA 2QULA 2Y88A 4IUGA 4ZFMA 3M6DA 3FYYA 2BOEX 4XAGA 5IHSA 2VZTA 5KTLA 5LGXA 2RGLA 1K8ZA 4XVDA 4TV6A 1HJWA 3KBMA 4E0CA 4JPGA 1X98A 3HU7A 1T8XA 3F2CA 1J9YA 3TYZA 2QKWA 1BYCA 1W5OA 2BHUA 3PNZA 2D3LA 3ARVA 3TVAA 1G4PA 3SCOA 1VJZA 3DECA 4IM0A 4D1IA 5KZMA 3GU9A 3T05A 2PDQA 1KC7A 4MPQA 4S2BA 2OSYA 2A4AA 3D5HA 1BWKA 2OXNA 1H0GA 1CWYA 1I4LA 4HB7A 3PBMA 1B9BA 3F1QA 4Y6GA 4RXGA 1VFMA 3PK7A 3EEGA 1KM6A 7PTDA 3N25A 4GIEA 1WOBA 1E4IA 2WHJA 3PB2A 5CJ5A 3C0JA 3I3DA 1JQXA 1QW9A 3QYQA 3CWNA 1VCFA 5EBUA 5CZSA 2WJZA 4KMQA 3GAKA 3NXLA 2AQWA 3W81A 3LTYA 2BNJA 5GVJA 5LKYA 1PHWA 4DXKA 1H7NA 1NQ6A 2EPOA 2WQPA 4JQAA 1UD5A 1ISYA 3RU6A 2VEGA 2DVUA 1DJHA 3QHMA 4JFTA 1POJA 4JNEA 2XFFA 1FHUA 1QO2A 1Q8AA 1HJXA 3R0DA 4EKJA 3COTA 4IFRA 4RK8A 4PGLA 4FR1A 1RJRA 4OTKA 5FJUA 3OYXA 4D6GA 3LTSA 5DBTA 3QY7A 1A5LC 1JDAA 3PZNA 2OW7A 3W76A 2ZA1A 2QXLA 2HSAA 4V1YA 2EO7A 3VM7A 3NQCA 4A35A 1XD1A 4QGCA 5AB3A 1LROA 1RD5A 4C6JA 1X7IA 3SRKA 2OYKA 2ONEA 4NL1A 4X9SA 3WIJA 2W66A 2QMJA 1IQ8A 4FX6M 3VOCA 5HQLA 3EJTA 5DEZA 4ZENA 4PN2A 5C5BB 3EA1A 3CT2A 3AS0A 1CT5A 4A29A 4WQ6A 3TTOA 2ZQ0A 1Q7QA 4MFEA 4TUFA 4IXHA 4A3YA 4PCPA 5KZEA 1BG4A 4HZ6A 5D33A 2WSRA 1LOQA 2R91A 4W93A 1R0MA 1RLCL 3I2WA 3W2JA 2O7SA 3MPGA 4Q6XA 1MXSA 4F01A 1JI2A 5HWJA 3SGZA 1QPOA 5K2ZA 2GSHA 5C71A 1L6SA 1X1OA 1NDYA 1X38A 2XZ7A 1HWWA 3ONBA 1D8WA 1XLDA 4C7DA 3SSJA 4QLJA 4TMBA 2CLPA 3ABHA 1FTXA 3MJMA 1N2VA 4O1CA 3PANA 2BTMA 1GYMA 1VIWA 4FZOA 1QPNA 4LXFA 3BQ5A 4IM3A 1L9WA 4JQ2A 2ZX7A 3ID7A 2QVHA 4AHPA 3SW6A 4HPNA 3BLBA 1GVYA 3E49A 3C4UA 4EK7A 1V79A 2P8CA 3TLQA 4PR4A 5BXTA 4IPJA 5IBXC 4OECA 3S9ZA 2Z2AA 3B4YA 2BVDA 3PAOA 3F4CA 4RE3A 3WNPA 2PRHA 1EC8A 1E0XA 2Y4SA 4REQA 4L5ZA 1H3GA 2EGZA 3SCNA 2AMGA 2YYUA 1YXDA 3TA9A 2NXGA 4S2CA 3G77A 1DJGA 1QJWA 4KEUA 2F1BA 1F6YA 4Q8PA 2PURA 1MUCA 3TDFA 1QNQA 4HHLA 3IIXA 2GA9D 2EPKX 2R1PA 3DFSA 2DORA 1MJGA 3KBVA 3RG6A 4YTQA 1QFEA 4AZ7A 1I2NA 3GDRA 4QITA 5ABFB 1MQRA 3CK5A 1GN9A 5EMYA 1H7XA 4FNRA 4IGNA 5J5DA 3T42A 4ATWA 3RK8A 1E6ZA 4OQVA 1QHZA 1AJZA 3OLIA 5HPOA 3CV6A 3D2FA 3H4XA 3CWHA 1XH1A 2FMNA 2JKEA 3WDHA 3GHSA 2ZX8A 4GMEA 2H90A 2VEFA 3TQVA 1UUMA 4E4FA 4MHBA 1VYPX 5M2FX 4R5IA 3M4HA 4HNNA 4ATMA 3H4WA 8XIAA 1FWAC 3DX5A 4ZB5A 3GIPA 1AA1B 1M03A 2VGIA 3C0QA 2Z25A 4AKVA 2C15A 2VZOA 1UPPA 5I24A 4NQIA 4KWUA 1CXKA 3AYRA 1DE5A 3KHJA 1JYXA 3TWBA 3IJDA 1B3VA 2FYVA 1RJQA 2WCGA 3MHUA 3G2GA 1W17A 1XD0A 4B5UA 2Y7FA 3OGSA 5LGZA 3UEQA 2IPWA 1YXYA 1U83A 3TX9A 3H2FA 3CAVA 1XDJA 3NZGA 1S3TC 4M7TA 1UMLA 3GH4A 2WB5A 3RJXA 1SVDA 1T6MA 2GDVA 2B7OA 2VXNA 1FWHC 3OK8A 2P50A 3QFWA 1OG0A 3LXAA 4R88A 3CHFA 1WZAA 4EZNA 4AVNA 3RLUA 1K8XA 2XN1A 1QNOA 4LS0A 1AG1O 9XIAA 3VC5A 2J6VA 3H55A 5CC7A 1X1ZA 2BZNA 3U57A 1DWAM 1KD0A 3HPSA 1ENUA 5DRCA 3C56A 2RDWA 5U7SA 3M5VA 4QQUA 1HGYA 1Q6DA 4QEEA 1XIBA 1RLDA 3TK7A 1ZNNA 4RW5A 4DEFA 4JTGA 2EG8A 4DYEA 3C2OA 1JDEA 3A13A 2WVTA 3ARZA 4KS0A 5CLTA 2PLMA 5F2GA 4BR1A 4QE5A 3FJ6A 4CN4A 3IIOA 3EJSA 4Q8VA 4B3ZA 3E2QA 3GNXA 3PUDA 5LYRA 2YBVA 3ZT6A 3FK4A 3ITYA 2C0AA 4RPQA 1EIBA 3GG7A 3BC9A 3ZYZA 2IW0A 1E9VA 2XWDA 2FVKA 1YXCA 1L2UA 5AY7A 1JUBA 1W0MA 1WQ5A 1P1XA 1H11A 4JTHA 1AW1A 3WUEA 3S83A 1KRBC 3STCA 1VBHA 2BHZA 2ZDRA 3AXKA 3TXVA 4DBEA 3E5PA 3SEPA 1V3MA 3PWGA 3ANYA 4P8XA 2FZ9A 2A85A 3G1HA 4D8JA 4ZR8A 4QTGA 3VDCA 1YWMA 3NZ1A 4K1WA 2PA6A 4XBKA 2OOGA 3WMSA 2F61A 4IFKB 3KOWA 1BLIA 1N8FA 3DKLA 4NKCA 2NV2A 1JQVA 3AIQA 3U2OA 1K8CA 3INPA 1E4NA 3LGGA 3QZEA 3KOXA 4GY7A 4LNYA 2V3DA 2C13A 3VI2A 1LBMA 3UITA 3P5YA 1W9VA 1WUEA 1WE5A 5B7ZA 1TYGA 3S3GA 2FZBA 2XSBA 3U9IA 4A3QA 4PO2A 1VD6A 3OVRA 5A1AA 1C29A 3BJTA 4ACZA 1X1NA 3W2NA 5CXPA 3HIJA 1MZRA 4XVEA 1K6WA 1RCOB 3D6NA 2RAIA 3PZQA 5CAHA 1XKJA 3W7JA 4B3KA 3H2CA 2X3WA 5EMUA 1JGMA 3PSWA 3AIVA 4AD4A 2VC5A 1J11A 3L4YA 1K7EA 4JTLA 5A69A 4O1BA 3WQ5A 3LPOA 4JNMA 2TAAA 2QUUA 4DF2A 3LGDA 3AALA 3SJ3A 2OCZA 1XYCA 3E2RA 5HR6A 3GIQA 3GDMA 5FF7A 3HJZA 4BNEA 3TE9A 1LF1A 3ARUA 4IQJA 1CLXA 2H9AB 3QQ0A 3MT1A 4WF7A 2AGKA 3ALGA 3HURA 3HF3A 3KLKA 1I2RA 1JXJA 3QM3A 3BAWA 4EXBA 5E70A 3S1WA 2YXGA 4ZGYA 2DH2A 1H50A 3KL3A 3T09A 1V3IA 4FOJA 4PTDA 3L4ZA 1GNTA 4Z2KA 4IPNB 3RJYA 5REQA 1TV3A 4UMAA 4CQAA 1A5OC 3BMVA 2CWXA 4HSOA 4PL2A 2RGMA 1IT0A 3VNZA 1W6TA 3T2QA 1UB3A 1UWQA 4HU4A 5M1TA 4AMAA 1WKYA 3HO8A 3WLKX 1U00A 1C91A 1GZ1A 1IGWA 2R9RA 4IPLA 1TE1A 2HISA 4RV8A 1TPFA 1TCDA 2E40A 4TVUA 5A6LA 3EX6A 3BGJA 3Q94A 4Q7IA 4V27A 3URNA 3TQ0A 1MW1A 4IICA 4AG0A 2VFEA 2D2OA 1DQXA 1HVQA 4J5NA 3N9SA 3CS2A 4M80A 4YVVA 3KW3A 1SU6A 1X8CA 1FDYA 3ABRA 1UPMB 3OHMB 3WBWA 3P60A 1T0OA 3SFWA 2WKJA 1W9PA 2GWNA 3CPRA 3DPQA 1NDWA 4HNOA 1JJKA 1BSLA 1TX2A 1E6NA 3LM3A 2CERA 5DO8A 1GPWA 2W0UA 3KVMA 3IIZA 4Q7BA 3C6CA 3HV9A 1A0EA 4W5UA 5DCBA 3N3TA 2RDXA 2VMFA 2YB1A 2VENA 1QI3A 4ZFCA 3FW6A 2NCZA 5BXSA 4U2YA 3VIGA 2UBPC 3N2CA 4LFYA 4HOZA 2JQXA 4JTCA 3HM7A 5FF4A 1G1YA 4FS9A 2Y63A 2YCEA 4ZBCA 2R24A 1K9DA 1NY1A 2MUCA 3EOOA 2DSVA 1PAMA 4H19A 3UZXA 4Z2HA 3VM5A 1IXOA 3SUWA 5CSUA 2CLEA 2ELBA 3BQ6A 3NNTA 3QOMA 4HHPA 3PC0A 4G7EB 3NQ2A 4E2DA 3KP0A 3BO9A 1VAHA 1TQWA 3FXGA 4M6QA 3APYA 5FSDC 1AMKA 1XSIA 3WF1A 4TX9A 2EQDA 4M24A 2PCQA 2FFCA 4C6IA 1VBJA 4GQRA 5TQLA 3BVTA 4LT9A 3M0HA 2OVLA 1KCKA 4RZ4A 3FA4A 3WDPP 2H6RA 2PLJA 2F6XA 4AIOA 2H8ZA 3YPIA 4PRRA 3IEBA 4L4OA 3O9NA 2ZA2A 3L0NA 4H8NA 2G41A 1Y5VA 3WLLA 1G4EA 3VOHA 3NDZA 4IUOA 3NQ6A 3LCIA 1PIIA 2J7GA 4IPPA 3EDDA 3PN8A 3U5YA 4PRTA 3VOGA 4AC7C 4K8GA 2F18A 4DJEC 2F1AA 3H4GA 3TFXA 4RL3A 4WLCA 2A7PA 1LWJA 5FJRA 2XYLA 4QJ3B 2EWFA 2JF6A 1RCXB 1SFJA 4FX8A 2IQ0A 1PKLA 5GJMA 3ZOAA 1J0YA 1Q6GA 2V0TA 4Q3MA 1GVSA 4O0KA 1LL7A 3DHFA 1SZRA 3D4ZA 5HMEA 1EYEA 1LQAA 3EWZA 3ZJ8A 1RK6A 4ZXOA 2VKZG 3VKKA 3E2SA 3E1F1 2DW7A 3FSUA 3OYZA 2ON3A 1JZ3A 3MHFA 1QHPA 2I5QA 5LA2A 1XS2A 3P5ZA 3UCQA 1R85A 1BYBA 3MQTA 1E1DA 3GHTA 5CZJA 1ONRA 1CECA 4UFLA 3EPOA 3NPWA 2EPHA 2WZTA 3ORWA 2ZE0A 3A23A 2X3XA 1QR7A 3B8SA 4P7NA 4GY1A 1KBKA 2G3MA 2HPMA 3F5JA 2V63A 3GKAA 1OFBA 5BNKA 3STPA 2Q8XA 6CGTA 3AMGA 2Z6JA 4HCDA 3PJTA 2PP0A 1BVNP 1JEZA 5CKSA 1U33A 2ZRZA 1A5SA 3N2BA 3WD0A 3KBWA 3AIUA 3W1UA 4EZRA 1R5EA 4KFNA 5JBDA 2DVTA 5A6KA 2DT1A 3MKCA 4QBXA 6ALDA 2HNHA 3S2JA 3SUTA 4IT1A 3IGXA 3JZUA 4UTFA 2CZEA 1EEXA 1PPIA 3ZVHA 2WINM 3IUIA 2EHHA 1O7DC 2PTDA 3P0XA 5EPDA 2DP3A 3ABZA 3TSDA 3W24A 2OX4A 3RITA 3ECQA 1IF2A 5FACA 1C90A 3LRLA 1TR9A 3T8QA 3CBWA 3VIIA 5AKQA 1FWFC 3T0AA 1E1EA 4O10A 4WSJA 1K4GA 2WYSA 4N6EA 3KP1A 2PDGA 1Q4WA 3OZPA 3HPFA 1ZUAX 1V0LA 1I4DA 2OZNB 1O68A 3EDEA 3WMCA 4M19A 1XYMA 1TQUA 3H24A 4PB3A 3B51X 1EYWA 4E4UA 2Y70A 3EDJA 1MEWA 3GZ3A 3PF3A 3GW3A 4GE8A 2CLLA 1IR1A 3R43A 4GBDA 4U33A 1I2PA 1JYNA 4C6MA 2NV9A 4JKKA 4CD4A 1WKFA 3C2FA 2P0OA 4IQLA 2OODA 3ME3A 4H00A 4UQAA 4HU3A 1YTDA 4Y8FA 1LOSA 3AMKA 2P5NA 5B7YA 4DYLA 3G6MA 3REQB 1TJRA 1ZY9A 1FHVA 2QV4A 1SUXA 1J93A 1W9XA 5C2CA 1YHTA 4EPDC 1XCFA 3UCDA 4EZYA 3FKKA 1VFHA 1HTYA 3KRUA 1DJQA 3AUJA 4W5ZA 3UWWA 1XSKA 3GNDA 3P2VA 4WVXA 1RBOB 3U2ZA 2RFGA 1DHKA 5BOOA 1MUMA 3ZM8A 4EZUA 3TYCA 1NAL1 3MUAA 1GJPA 3O3MB 5H1WA 3CB3A 2YJQA 3N2XA 2OMAA 4MGGA 5HINA 1O66A 3E5BA 2JEQA 3AS2A 4UBPC 3MBFA 1NEYA 2QKFA 2QCNA 4MG4A 3L5LA 4ZB0A 1R6WA 3I10A 1LQ2A 4DUVA 2CW6A 2Z0NA 2GDQA 4JCLA 2GJNA 4LX4A 2WWCA 1M5WA 2Z0OA 3OTRA 4HSNA 2PDXA 2JALA 4EZSA 4JX5A 4R9OA 5LHEA 3SOGA 1WXYA 2E6YA 4R5GA 3W27A 2ZKMX 2POZA 4HZMA 3QNIA 1KFWA 1SJCA 3BXWA 2C08A 2QAPA 3N6JA 3QOKA 2C14A 2J78A 1JZ5A 1S1RA 2QNEA 2FQIA 1P0EA 4K6AA 4ENLA 1S5MA 3CEPA 2J62A 5AOUA 4W8LA 2PP1A 3ZLFA 2Y2WA 5M03A 2DUAA 3ARSA 1XHGA 3VD4A 1GOWA 4JCMA 4HYWA 3THDA 1GYNA 3LCXA 5E6ZA 2XDFA 3DFYA 4KERA 2CNCA 1SFTA 3W82A 3E38A 3TTYA 1QNPA 3MS8A 1QW7A 4LUTB 2E5BA 4GH3A 2OO6A 2WPBA 2J9YA 4B5TA 1KCZA 4B2DA 1U1JA 2ZRYA 4G9PA 4PTVA 2HTMA 2AAAA 3RAOA 4ACYA 2QCFA 1OYBA 1R87A 4OFCA 4OKDA 3LS9A 1OCJA 4EIVA 4AZCA 1LRQA 4WDUA 3QPEA 5CPMA 5F4SA 3WH6A 5AHFA 3NA8A 3PJUA 4F48A 1UUQA 2FZDA 1HL8A 1NFGA 2YIAA 1ZBCA 4O54A 3WL1A 3DKJA 4IG2A 3IUDA 4O28A 3OVGA 4NG3A 2GVLA 1BPLB 1QPKA 4L64A 1X39A 2V5CA 1QAPA 4NHVA 3THCA 3HGOA 3TW7A 3M46A 3N13A 3TZNA 3PR2A 1J18A 3VO0A 3RIKA 4IGMA 2FZMA 4U5IA 4C60A 4AZ5A 5A6BA 2G4FA 3BICA 5D2XA 4URIA 1SFLA 5AVHA 3E74A 2YBUA 4DUWA 3PBVA 3OQEA 4I9TA 3TW6A 4FF7A 1Z69A 1FDZA 3CVRA 4KF1A 4Q8NA 1QHOA 4GQGA 1TZ7A 3O2LA 3KLLA 2VYOA 1DJYA 4B91A 2WBKA 3VEAA 4MJZA 3CU2A 1NF7A 3OU8A 4WXZA 3W84A 4EXAA 5TKYA 1TE6A 5G5IA 1CW2A 3VGDA 1TJ1A 5IM51 3B8VA 1I49A 1FH8A 3N9KA 1YTEA 3WDQA 1AL7A 1NH6A 2ZVRA 1Q65A 2INFA 1TVLA 3PFMA 4KIKA 2J4GA 4MDOA 2WHMA 2DIKA 2PF8A 3TAKA 1PS9A 1UKTA 2DEPA 2Y0FA 1HXJA 1V51A 4XD5A 2PLCA 3MTWA 4HCLA 4B90A 4WSHA 1VPXA 3UGRA 3H8AA 4LYRA 4I5XA 1FWTA 1FHDA 3RLHA 6XIMA 4AUBA 1NWTA 4F40A 1VQTA 1YDOA 2E6DA 3G24A 2DVXA 1OK6A 3SGUA 1OF6A 3NGJA 1HF6A 4ZZ9A 1DKZA 4LYQA 3CAKA 4I9JA 1MEHA 4QJ5B 3QW4B 4Q8QA 2Y89A 3IVTA 2DJLA 4B9YA 4P7OA 1XIMA 1RALA 1E2UA 1IXNA 2HRWA 1V3KA 3U48A 1ICSA 1TMHA 4G56A 4AWSA 1ZFJA 4XD4A 2O92A 3TWAA 3L66A 2OLAA 4H9ZA 3CUGA 1JL8A 1AK5A 4O18A 5I03A 4DJDA 2G8ZA 4H04A 3OA5A 2QIWA 2R1MA 3ICJA 3CZEA 4AHOA 5B80A 3WLTA 3W2UA 5FAJA 1XH2A 4XG1A 1LG2A 1P48A 4FK9A 5IBXA 1AVAA 3HBLA 1UROA 3AYTA 4Q4SA 1GJUA 5EBAA 1I1WA 4PCTA 4A8LA 4FZPA 1UR1A 1OC6A 3PZGA 1ZALA 4U3AA 3M9YA 3STFA 3O0FA 4LB4A 3ZSSA 4PUEA 4O8RA 3GTIA 1FWGC 1BVZA 3NQDA 2XIMA 1OF8A 3KWXA 5A6TC 4NAFB 2YSWA 4WY0B 1GNLA 2GQ3A 1IHIA 1ZJAA 1UWSA 3QSRA 4FSAA 4HPGA 8RUCA 3TC7A 3WQVA 1VRDA 4Q7NA 2GK1A 5LXXA 3RN6A 2A3LA 1TA3A 3GHUA 2E0PA 4S39A 5E84A 3RM4A 2G4JA 4PTNA 1UR3M 2QCEA 3VNMA 1WDPA 4GKTA 1UUOA 4J3XA 3FDGA 2NQ9A 1G9HA 3V35A 4AY8A 4IFOA 2ZTKA 1FXPA 2D22A 3BOFA 1W9UA 2JF7A 5FLEX 1EO7A 4MNJA 2KZHA 3KCJA 5C70A 2UY2A 4LNCA 4RNJA 4JWIA 2KAUC 1OFEA 3J7HA 4GHRA 1W8GA 4GQ0A 1JCMP 3S5ZA 5AHLA 2Z24A 3M64A 2GSEA 1ESWA 3PZOA 2QJMA 1XBYA 4FA3A 2BGNE 2E1DA 4IM4A 2PMQA 4IMCA 2N3KA 1GVEA 1UKPA 1UH4A 5MKGB 1L8NA 4GBUA 3GW0A 2V2HA 4Z2GA 2VR4A 1XW8A 3AC0A 1KTBA 5T91A 3MCNA 1E70M 3L3OM 1HKWA 1RQEA 3STEA 1V02E 4EAYA 1QDSA 1QW8A 2NT0A 3AMDA 4PMDA 5CPNA 4L4PA 3A9BA 3LHYA 1AD4A 1PEZA 1EA0A 1VH7A 1K70A 1LQ7A 4W8BA 4B16A 1E1FA 1PL9A 2Q8LA 4H2CA 1DIOA 4C1NA 2D24A 3DHUA 3VNIA 3V18A 5GPRA 4OWGA 3EMCA 5CPQA 1ZCOA 4JXCA 3ABXA 1UD6A 4PL1A 1Q6EA 4AB4A 4IM2A 1W1YA 3ZEDA 1OSEA 2PTXA 1WO2A 4HPHA 3VGBA 2W62A 4PRWA 3KTCA 3GFYA 3LGEA 3D52A 1E9YB 2WLYA 4AZ6A 5CGTA 5F4WA 2YIHA 2QCCA 3W73A 1BRLB 1AJ2A 4LB3A 5LIUX 3OZMA 3W23A 4S38A 2AQOA 4PB4A 1Q6CA 3PTKA 1OFRA 2F6UA 3M43A 3GNPA 1P0DA 4W8AA 3AS3A 3ZT5A 1R3YA 2VZVA 2J9ZA 2I1OA 1TUXA 3VKCA 4A3UA 2ODOA 4JKLA 3VNKA 3KAWA 5G1YA 2XFYA 2VWTA 2X3VA 3R2GA 3UYIA 2ZVIA 3N2MA 1ICPA 1TV2A 4XZMX 2V38A 3TW9A 2R82A 4N02A 2J75A 3TR9A 2FGZA 2HZGA 3OQ8A 4C6EA 2J7BA 1U5HA 4WSKA 1XGDA 2XINA 2WQDA 1JYWA 3QZ6A 3GK0A 4BF5A 1PTDA 2HWGA 1V77A 4IIEA 4DJFA 2EG6A 5AZ0A 1CLKA 3BANA 4C6CA 3A9IA 4PE8A 2A3AA 3TOPA 2YFOA 2XHYA 4JWEA 2Y5EA 1Z44A 3UJSA 3CZKA 4GIAA 3VIFA 1KRAC 4HVXA 4MUZA 1E9LA 5EMKA 3R0KA 4F9JA 1FP8A 4CN6A 1JDDA 4M5PA 3CUFA 3ITTA 5HBFA 2Z29A 1BEUA 4KBXA 4FNUA 1UD3A 3UXDA 3NQVA 4GIRA 3WBYA 4AFYA 2O56A 3M5ZA 3GR8A 2AAMA 2E77A 3CLMA 3HB9A 1TTIA 1JCJA 3WNNA 3SQMA 1UWAA 3GZAA 3C2EA 2W91A 1XI3A 2IQDA 4QQ3A 3V1PA 3PBWA 4Q32A 2X0YA 2PWDA 4ROQA 1ZRQA 2F6KA 3AHYA 4FIQA 2BB0A 2D2JA 1SFSA 3WUGA 5D03A 3WNLA 2YL5A 4BKNA 2IPJA 4E8GA 3BOXA 4MJ2A 2C8NA 3NSNA 2CKSA 2E8ZA 1V02A 1K9FA 3R8GA 4B5VA 4JNFA 1XFBA 3KRBA 5GNZA 1WAUA 3WSUA 3EWBX 2G5WA 3TCEA 4BHYA 2ZOXA 3VOJA 3JRKA 3LSCA 1EDTA 3GC2A 1VPQA 3WELA 1UZ4A 3RM9A 3LNMA 3B9OA 4NZJA 3AHXA 1MW3A 2OBLA 2QUVA 1RZMA 1R3WA 1IV8A 4AXKA 4B2DD 1XLEA 4GJIA 3MYOA 1FCVA 3TJIA 4NUWA 3VD7A 3AJXA 2OR2A 1QUMA 1YX1A 2CLOA 1XIJA 3LM7A 3N1AA 2B81A 3UXKA 3ZWSA 3P74A 3NFUA 4UR7A 3A3HA 2BVYA 1P0BA 4IIBA 1W1A1 1OFAA 3P0WA 4IF2A 4GYKA 4LVDA 1SMAA 5FJIA 1R5YA 3VVGA 4Y2WA 2G0WA 1VFLA 4L9XA 1FWRA 2VR2A 5BYWA 2WNZA 1OY0A 1XUUA 3BCJA 2YLAA 1ML1A 5I7GA 1NELA 4DBSA 4GRSA 5GNYA 1T99A 4HHMA 4QRNA 4WOQA 4LCRA 2YDSA 4Y7EA 3TQKA 1Y8BA 5ABEA 1REQA 3GXMA 3O63A 5ABTA 3CV2A 5A6SA 1I2QA 3NL2A 4AIBA 1GUVA 3S8HA 2UWFA 4UB9A 2NQZA 3WBAA 4FXFA 2ALRA 4JY9A 3BUIA 2PWVA 2IPFA 4ZODA 3OLGA 3GUWA 4QJ4B 2AOSA 5H8PA 2FJUB 4DF1A 1V3LA 4UTUA 3GH5A 2PMRA 1XV8A 2XVGA 1R9ZA 2P1FA 5G1MA 2VC7A 1VEPA 3GG1A 4IWWA 1Q3NA 2RAKA 3W25A 4E38A 1QOXA 3H53A 5DN1A 4GZIA 4JTQA 2RHGA 3DX0A 5DT5A 3BLIA 2J77A 3GFZA 3PP7A 1MW2A 2NVDA 2OGYA 4HOXA 4D8AA 4RNIA 3QBUA 1R34A 1CYGA 4PSRA 2QLYA 1EWDA 2BHYA 2FH6A 2V5DA 3VZXA 1V8EA 3C2RA 3QR0A 1UKSA 1M41A