4AZ6A

Differential inhibition of the tandem gh20 catalytic modules in the pneumococcal exo-beta-d-n-acetylglucosaminidase, strh
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
435
structure length
435
Chain Sequence
SHNEKLAKKKIVSIDAGRKYFSPEQLKEIIDKAKHYGYTDLHLLVGNDGLRFMLDDMSITANGKTYASDDVKRAIEKGTNDYYNDPNGNHLTESQMTDLINYAKDKGIGLIPTVNSPGHMDAILNAMKELGIQNPNFSYFGKKSARTVDLDNEQAVAFTKALIDKYAAYFAKKTEIFNIGLDEYANDATDAKGWSVLQADKYYPNEGYPVKGYEKFIAYANDLARIVKSHGLKPMAFNDGIYYNSDTSFGSFDKDIIVSMWTGGWGGYDVASSKLLAEKGHQILNTNDAWYYVLGRNADGQGWYNLDQGLNGIKNTPITSVPKTEGADIPIIGGMVAAWADTPSARYSPSRLFKLMRHFANANAEYFAADYESAEQALNEVPKDLNRYTAESVTAVKEAEKAIRSLDSNLSRAQQDTIDQAIAKLQETVNNLTLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-N-ACETYLHEXOSAMINIDASE
publication title Inhibition of the Family 20 Glycoside Hydrolase Catalytic Modules in the Streptococcus Pneumoniae Exo-Beta-D-N-Acetylglucosaminidase, Strh.
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 175
structure length 435
sequence length 435
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2012-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.90 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 AF1782-like 4az6A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4az6A01
4WKFA 1NOWA 1TCMA 2PF0A 4QLJA 6A3HA 2ZUSA 2GVYA 3VKKA 2MANA 2WLYA 3IANA 2JIWA 2X0YA 2VX5A 4JFTA 1EO7A 1WZMA 3EDFA 3PTQA 1E0VA 1JFXA 3AHZA 4Z2GA 2XM1A 3N12A 5D8WA 1CIUA 1DEDA 1B3VA 4AW7A 3VGEA 1V6VA 4OOUA 1GQKA 2OLHA 1C7SA 1JDCA 4F9DA 3L4ZA 4UQEA 3OLEA 1E6PA 3K1DA 3AXIA 2W62A 3N11A 4HA3A 2WKGA 2ZWZA 1HL9A 4P7OA 1KCKA 4TTUA 2ZX8A 2WVTA 4JCMA 1W3KA 1W32A 4UZUA 3FW6A 4J3WA 2ZUUA 3W4RA 2Y8KA 5FIPA 4AD2A 3BCFA 4PN2A 3W26A 3WH8A 5BWFA 1RP9A 1BYDA 1D3CA 2VMFA 4D1JA 1N82A 3QR3A 2ZE0A 5E0FA 1BFNA 3CZKA 1FFQA 2QLYA 1OIFA 5KZ6A 2YDQA 3RMEA 3AZTA 3L4VA 3IJ7A 4HOXA 3EMZA 4W7VA 1ISYA 3NSMA 2E3ZA 2V38A 2PWDA 1ESWA 3MV01 5E9AA 4DWSC 3EYPA 5AY7A 5HOSA 4WF7A 5AC4A 3WD0A 5M03A 3FNDA 3WDHA 2XJ7A 4BF7A 3A3HA 4K68A 3RO8A 3ZIZA 2VZSA 3VTRA 4QDMA 2EXOA 1EHNA 2DEPA 4UZSA 3W81A 2UY5A 1W2VA 2J77A 4MB5A 4UOZA 1Q6DA 2ZXDA 1VFFA 1WP6A 2XUCA 2XVNA 1UG6A 3CHEA 5DFAA 1ISXA 2G4FA 3TONA 2EBNA 1TA3A 2X1IA 1KGUA 3BAJA 5EBAA 3CMJA 1UH4A 3CUFA 3DYOA 2VX6A 5I6SA 2G8ZA 4MDOA 4CKQA 1JIBA 5JBDA 2J75A 1NWTA 2VCAA 5CJ5A 2BXYA 1PPIA 5CGMA 2J7DA 1V3IA 1F4AA 2ZWYA 4V2XA 3AIWA 4H8UA 1VBRA 2OYKA 3WDRA 3M6DA 3DC0A 1J0HA 1QBBA 4AZ7A 1UR0A 4MNMA 4W88A 2J79A 4L4OA 5BXRA 1UWQA 3N18A 2J7BA 3WF2A 1QI5A 3SCWA 1E3XA 2ZX7A 2XVGA 4WKAA 3PZUA 3GXDA 2IUZA 3EDJA 3MSDA 4IPLA 4M8UA 3GTNA 2ZXBA 4W85A 1BAGA 1E73M 5I5RA 4XZWA 1K9TA 1OD0A 1NM9A 4AZGA 2DSKA 3MUAA 6TAAA 2CPUA 2JALA 1UQZA 1G1YA 1VFUA 4LXFA 4D6HA 1E5JA 2C7FA 3AMCA 1R85A 1ZBVA 7CGTA 4FZPA 3UG3A 4AD3A 8A3HA 4PTMA 3WH6A 3VMNA 3IAQA 3QOKA 2EPOA 5CZKA 4CN1A 4QLLA 3BLPX 4AC1X 1EQPA 3RM4A 1XSKA 3L4XA 1XV8A 3VIJA 2QPUA 5A6AA 1R87A 2JNKA 3OLGA 4PEEA 3RILA 3N1AA 1U30A 3WH9A 4KH2A 3D5HA 1GJWA 1EHAA 2VZOA 5A6JA 1HF6A 2QMKA 2CITA 1S46A 3CBWA 2WCGA 2WC7A 4EANA 2Z1SA 3FAXA 1MW0A 4Z2IA 1KGWA 3AIVA 4CN4A 2WVSA 2G3NA 3A47A 3CTTA 2WSPA 5D9MA 1E15A 2X09A 1OM0A 2PC8A 3TP4A 1VIWA 3GNPA 3WFZA 4EAMA 1H3GA 2DT2A 3MUY1 1SMAA 5M17A 2F8QA 4M1RA 3EBVA 3WQ6A 5A6SA 2VR5A 1DWJM 4EKJA 2D0HA 4UQDA 5ABEA 2FH8A 3OGVA 4GXPA 1B3XA 2DT3A 2D24A 1HKIA 1RD6A 1XH2A 4W8LA 3DYMA 1QHZA 3GZAA 1PX3A 5IHSA 3CPUA 4AZBA 4RE2A 3A6OA 5GNYA 4D6CA 3OZPA 3PZMA 4EK7A 3GXFA 4C7DA 3W28A 2XVLA 2CBUA 1KXTA 3VIMA 2PWEA 5A69A 4MJ2A 2RGLA 4MNLA 3GH7A 4V27A 4GZJA 3TOPA 3SCPA 5BRPA 1EDTA 1WPCA 1H2JA 1J18A 1OSEA 5DT7A 1QW9A 1W9PA 2YLAA 3ZQ9A 2BVTA 2WMIB 3T0AA 2VRQA 2ZXAA 3CMGA 1GOKA 2BHZA 3W0KA 3CZJA 1K9FA 3PZOA 1OCQA 5FCZA 1HX0A 8CGTA 1ZBKA 2WMIA 4HOZA 1JD9A 3WQVA 1W9UA 2A3EA 1TFVA 4GI6A 4R27A 3WUFA 4PSPA 4CU8A 2V3EA 1M01A 4JFUA 4TTGA 4X9YA 1FH9A 2JF7A 3D3AA 4HPGA 1BQCA 1OINA 1WE5A 4P7RA 2HISA 2BVYA 1UWIA 2WBGA 4MNKA 4CD4A 3W53A 5M3WA 1V3LA 1RH9A 4TUFA 5CLTA 4BQ4A 1QPKA 2E9MA 2DIJA 3APGA 4XV0A 3WH5A 4AEFA 3T0BA 4PSRA 2VOTA 4CVWA 2YL5A 1G01A 3QHNA 4IPNB 1I1XA 2E0PA 2W61A 1PZ3A 4AISA 3EMQA 3RJXA 3PZQA 1E4MM 1E4NA 2BNJA 2E9BA 1GZJA 1FHDA 4AZIA 2CCRA 3WUGA 3II1A 1V6WA 1V3KA 2OYMA 3WEZA 2J7FA 1XSIA 2W92A 2WMGA 3AZRA 1E6ZA 4J3TA 4HU0A 2VRJA 3CZGA 4W89A 2YLLA 3LPGA 5CXPA 3W29A 5CSUA 4JL2A 3W24A 2X0HA 1Z32X 4UFLA 1HJSA 5JBEA 4AD1A 4JAWA 4P7LA 4ZXOA 4NRSA 4HZ8A 2HVMA 2VJXA 2DH2A 2YL6A 1KGXA 4OJYA 3WFLA 5EFDA 2DH3A 4D6FA 4AIOA 1ZS2A 4ATDA 1G9HA 4X0NA 2ZUWA 3MUZ1 4PMRA 1LL7A 3VNZA 2J4GA 3CUGA 4NSBA 1ZBCA 1OWQA 1W9DM 2CIPA 1U2YA 4P8WA 2WZHA 5D8ZA 2YA1A 4GQQA 2VL4A 3UG5A 1DP0A 3UETA 1YQ2A 1FA2A 1IZKA 3SCVA 2J7HA 3ZSSA 3S6TA 3GNRA 2GJPA 2J7EA 5A6BA 1V3HA 4MB4A 4AZ6A 1CXLA 3WKZA 5GNZA 3VPLA 3MANA 3ARTA 1K9DA 4ACZA 3OIHA 2WKLA 1XCXA 1F4HA 1JXKA 3LPFA 4W5ZA 3CUHA 4DWSD 3HU7A 4JL1A 5I23A 3WQWA 2WVUA 1DWAM 1NOFA 3BCDA 2WMKA 4FLSA 3VD4A 2TAAA 1XYFA 2G3JA 2E8YA 2CKRA 3TTSA 4URIA 1HKJA 4L4PA 1CXFA 1W3HA 3WMBA 1QHPA 4Z2JA 1OBAA 1UWSA 5AYBA 4S3KA 4UFHA 3K8KA 1Q6GA 3PZVA 3MO4A 2CNCA 1FH7A 1PZ2A 1W9XA 4Q22A 3UR8A 1H0IA 3ALGA 3L4UA 2J78A 1WDRA 5E70A 1CECA 1KXQA 1H09A 3MS8A 2QV4A 3AYSA 3AS3A 3CZLA 4PMQA 4ZXLA 1P6WA 3W25A 2VZTA 1E9LA 1B3WA 3VDCA 4UR9A 1ISWA 3VDAA 4YHGA 4ZE5A 5BYWA 3IJ8A 3RIKA 1GW1A 3W82A 4CD7A 5TD4A 4PCTA 3THCA 2BV9A 3ZJ7A 2CXGA 1QI4A 4WK9A 4C7FA 1VEPA 3GBDA 3ZT6A 4JKKA 1R7OA 4E8DA 3K8MA 5IXEA 2XHYA 2AOSA 3AZSA 3ZR5A 4OOZA 1LL4A 1MVYA 4B3LA 1M7XA 5ABGA 1CXKA 3WNPA 1W1PA 2DPEA 2J62A 2WWCA 3PTKA 1X6LA 4P7NA 1J01A 1ODZA 1MW1A 1XGZA 4KGLA 3CZEA 1GJUA 4B9ZA 2WK2A 4A3YA 2OYLA 2E8ZA 1UR9A 4W7WA 3N13A 1H0GA 3I3BA 5EMYA 1EDQA 3AIRA 3OB8A 2D0FA 2WZEA 3FN9A 2XYLA 3ECQA 2Q8XA 1ZU8A 1TZ7A 4AIEA 4PYSA 3WL1A 1JZ6A 5M5DA 4HZ6A 3VUPA 2UY4A 3ARQA 2D20A 3I3DA 3CLWA 5D9PA 4U2YA 1CYGA 1UD3A 4HOWA 4KRTA 3UCQA 3ZJKA 4P8UA 3GH4A 2D2OA 3IJ9A 2XIIA 4PMNA 1WB0A 4LPCA 4RE4A 1OGBA 2JF6A 1TVPA 1QBAA 1CDGA 4KMQA 9CGTA 1NWRA 4M80A 2A3BA 1V3MA 3QHMA 1US2A 2DT1A 4GZEA 3SUUA 2D0GA 3AQUA 3AS2A 5BRQA 2Y4SA 1C92A 2UY3A 4BCEA 4M81A 2X05A 4UQAA 1J0YA 3KL3A 4MNJA 2ESCA 4HMEA 3QGVA 4W87A 2O9PA 3OGSA 4NI3A 2XGIA 5CG0A 1JNDA 3WL0A 1TR1A 4CD8A 1BYAA 2ZUTA 3SEPA 1UWUA 5FKYA 1NWSA 2OSXA 2NW0A 3RM9A 5HBFA 4D71A 2GDUA 5LYRA 2VO5A 3KL5A 4WIWA 1L0PA 1QVBA 3VD9A 1UKOA 4LYRA 5DT5A 2J8GA 4YN5A 3VGFA 2VUYA 3SUTA 3HMCA 4F9JA 2EQDA 1GORA 1CGWA 1CGUA 3TTOA 3N9KA 1U33A 3PZGA 1EXPA 2CBVA 2WPGA 4UQCA 4Z2KA 1QNRA 2WHLA 1EO5A 1HNYA 1DWIM 2WMFA 4AXNA 1WZLA 1V08A 3G6LA 3PTMA 4TXEA 3RDKA 5EB8A 1BGAA 1C8XA 1OB0A 1WNOA 1XHGA 1HKMA 5LA1A 3EDDA 4D72A 5A8PA 1V6UA 3M07A 4XUYA 4MJ4A 2RGMA 3ARVA 4BS0A 5BXTA 2CEQA 4HMDA 2UY2A 2A3CA 1TUXA 3GNOA 3WD1A 1HN1A 4P7QA 7A3HA 2G41A 1CPUA 1AQHA 3G6MA 1WCGA 2ZX9A 1BLIA 3GM8A 5IHRA 4PRWA 2CKSA 2WBKA 1OIMA 3A4WA 3S2CA 1W1VA 3VM5A 3ARPA 1Q6EA 3NDYA 4ZENA 2QHAA 5IFPA 1JXJA 2FGLA 5E6YA 4PMUA 3A4XA 5HDRA 3BAKA 4CVUA 1NARA 3SUWA 4DM1A 2WNWA 4MDPA 3KZSA 2XFYA 3AS1A 2XG9A 1X6NA 5A6MA 4HZ7A 4KWUA 1UD4A 2WSKA 3AROA 1M04A 4A3HA 5BCAA 2ZUVA 2WCSA 4GIAA 3WH7A 2OO2A 1E1EA 2Y5EA 4JHZA 5A2BA 1B31A 2W66A 4U33A 2YA0A 3HN3A 2D1ZA 1GPFA 4XZBA 2OWXA 3MKKA 1R86A 1UKPA 3WNKA 4JFWA 1Q6FA 3BAIA 2BY3A 1MWOA 1UD6A 4Q7NA 4A4AA 1W2PA 4J27A 3F5LA 4JZ5A 2A3HA 3U7BA 1CGVA 1VEOA 3N04A 1W9VA 1BSIA 3O9NA 4YHEA 4WSJA 3RCNA 3TTYA 2YA2A 2W67A 4M29A 4U3AA 1JI1A 4HU8A 2D3NA 3ZOAA 3ARSA 5I3DA 1E5NA 5I77A 3GYCA 3SIMA 1YHTA 1PX8A 1KR0A 5DO8A 3T0DA 1J0ZA 4JHOA 4D6IA 1CZ1A 1HL8A 1K6AA 3OLDA 3POCA 5HPCA 1C93A 5HNNA 1ZJAA 1LQ0A 1PIFA 2Y24A 3AJ7A 1UR1A 1E0WA 3AI0A 3RJYA 3AXXA 1I75A 1J12A 2GK1B 3DECA 3O2LA 3WNOA 1H5VA 1MXDA 1HJXA 3PN8A 1XSJA 4HA4A 2BVDA 3VIGA 1B1YA 5E6ZA 1BVNP 5GQBA 2ZX5A 3BAWA 2GK1A 3CGTA 1PIGA 4J3SA 1JNEA 5I78A 1BPLB 1LG1A 4OBSA 4UTFA 1VENA 3WMCA 2XIBA 4FLOA 1OT1A 1UA3A 4Z2LA 4CGTA 4ZEPA 1XD1A 1LWHA 4LGXA 4N42A 1X1NA 3F4VA 1XCWA 3B8SA 1JZ3A 4TOQA 4LYPA 3PBGA 1B3ZA 1M53A 4PMXA 1B9ZA 3ARZA 3EDEA 5CPTA 1E40A 2BY1A 3VD7A 3WQ4A 5A6LA 3WSUA 4CCDA 1D7FA 2PWGA 3THDA 4W7UA 2VCBA 2VTFA 3N15A 2DQXA 1V03A 3TA9A 1SMDA 4OIFA 1L8NA 3BH4A 3NYDA 3M46A 2O9TA 3SCRA 4BQ3A 2IXVA 1AMYA 1CTNA 1FP8A 1TMQA 3NIYA 2VZUA 5A2AA 1EH9A 1DWFM 1MQPA 1O7AA 5A8OA 1B3YA 1E70M 3AMDA 3VIOA 1KWGA 3U57A 4AMCA 3O6AA 1XRVA 3IK2A 2XFFA 3WEOA 1CGXA 3ZSTA 3AYRA 3WQ5A 5HPOA 5FOOA 4PMOA 1WO2A 1W1YA 3K8LA 3WDIA 4HMCA 1SR0A 3CH9A 4WJXA 4WSKA 3E1F1 1BYBA 2VVSA 4MPKA 1BYCA 1GHSA 4GQRA 1MFUA 3FAWA 1VFOA 2OZNB 4ACYA 2PMRA 2WZIA 2YKKA 3VD3A 4UQBA 3ARUA 1H1NA 1NQ6A 5BXSA 3OG2A 3HJEA 4PTWA 1ISVA 2CETA 2WC4A 1AQMA 1V3JA 1W3LA 2QPSA 4XX6A 3MMUA 2G3MA 4S3JA 4TVCA 2OSWA 3BSGA 3WF4A 1WAWA 1MW3A 1QOXA 3GXIA 1CXEA 1E72M 3W37A 5AYIA 2WW5A 3CO4A 3AOFA 2VI0A 3U7VA 4U31A 3AMKA 2D22A 3VOCA 4BA0A 1ITXA 1H41A 3FHAA 1SFSA 1GQIA 4GO9A 2VRKA 5I2UA 5A6KA 1JZ7A 4CD5A 1C90A 1GQJA 4H8HA 2WXDM 3VGGA 1ISZA 2ZXQA 5BXPA 3W38A 2CERA 3SCTA 3NSNA 1NOUA 2QF8A 2YIHA 2W63A 3U5UA 3WDQA 2A3AA 1J0IA 4U5IA 1EQCA 2FDMA 4H04A 4GKLA 3AIQA 2ZICA 5JUVA 1CEOA 3LPPA 4AZHA 4CU6A 2VX7A 2BHUA 5JIPA 3AIUA 2XVKA 4JKMA 4PCSA 2W5FA 5LA2A 3NJ3A 1HJWA 1WDSA 4AD0A 3CHCA 1KQYA 1LWJA 4GPNA 2EPNA 3KWXA 3W27A 3WNNA 1IT0A 4UQ9A 1E6RA 1SYTA 3GXMA 2BFGA 2JIEA 1GHRA 1HJQA 1OD8A 5DEZA 3FHQA 1HKKA 4W5UA 1E3ZA 4AY1A 3T09A 1E4LA 1FH8A 5I24A 3MSGA 3AIEA 4BZYA 3AICA 5KEZA 2OWWA 1GOOA 3L4TA 1Y7VA 1UZ4A 1US3A 4HTYA 1QW8A 5ABHA 2J7CA 1VB9A 3GH5A 4UNIA 1G0CA 1TVNA 2CHNA 1J0KA 1GOQA 2WCAA 4CCCA 4CN6A 2YL8A 2BY0A 3AMLA 4E8CA 1UH2A 1DTUA 2XTKA 3WDPP 4GI8A 1H4PA 3QOMA 3WBEA 5CQ1A 1OGGA 5CSYA 1CGTA 3A4AA 4QCEA 2FGZA 2WM0A 2PI6A 1H11A 4TVDA 1DHKA 4NF7A 2V5CA 5JBFA 1EOKA 2NT1A 5A95A 1DWGM 2XWEA 3K4AA 5I79A 3VGDA 4GINA 1UWTA 1KBKA 2Z1KA 4Y7EA 1KR1A 2GDVA 1QI3A 1UZ1A 3NUKA 3VO0A 4KRUA 1UYQA 1GOIA 2XM2A 2D3LA 3MU7A 1UH3A 3VIFA 2J74A 5A1AA 4QCFA 1Q6CA 2WMJA 2C8NA 1RPKA 1JYNA 2VNCA 3WEMA 1JL8A 4E2OA 1UWRA 1ZBWA 1HXJA 1XD0A 4ZE4A 1I1WA 2X2YA 2PBGA 4UFKA 3WDJA 4NRRA 3L2LA 1BGGA 2B31A 5GNXA 3CHFA 4PMYA 3F5JA 3WELA 2VR4A 4UOJA 3F5KA 1E0XA 4OKDA 4IISA 4B16A 4DUWA 4D6DA 5E09A 3ZJ8A 4F66A 2Y8VA 4JIEA 1G94A 4P8VA 5A8MA 3N17A 4N0RA 3J7HA 3WIJA 1W9BM 2O92A 4MADA 3LPOA 2YJQA 1M03A 3AHYA 4IUGA 4AWEA 5E0CA 5A8QA 1PBGA 2WB5A 2XSAA 1JYVA 2DIEA 1JZ5A 3QHOA 1EDGA 2XGBA 3EDKA 1GUVA 2EJ1A 3AISA 3NDZA 1NH6A 4TVUA 3UG4A 2JE8A 1HVQA 3CUJA 5A8NA 3ALFA 3L2MA 1LG2A 1CGYA 4CD6A 4W84A 1HVXA 1BTCA 3VIKA 2DSVA 3VIHA 1LL6A 3VD5A 1GOWA 1VFMA 1A47A 4J3UA 2ZUMA 1OGSA 1V6YA 1XC6A 4JFSA 4M24A 2DSUA 2BS9A 4J28A 4CU7A 4U3CA 2VURA 4B15A 3UESA 5A94A 3K4DA 1VAHA 2W4XA 2G3IA 3BXWA 1BG9A 3U5YA 1UR8A 1ZB5A 4LQ1A 4LX4A 4PUEA 1B0IA 1E1FA 3UERA 1AVAA 4DUXA 4W86A 3AHVA 1WKYA 1UD2A 4GZIA 2AAAA 2FHFA 3ARWA 1EIBA 4QAWA 1JYXA 2VCCA 4OUEA 1QI0A 1TA3B 1UA7A 1VEMA 1JI2A 5D9NA 1KXVA 1J9YA 7TAAA 2WHMA 4D6JA 2DGAA 3RM8A 1VJZA 3WN6A 1GQLA 1QNOA 2ZOXA 1JG9A 4D6GA 5CLWA 4AZCB 3SCNA 2FH6A 1E56A 1C8YA 2VT0A 2YOCA 2BXZA 3MMDA 3SCQA 1JDAA 1KXHA 4B3KA 4AZCA 5FL0A 2GJXB 4AEEA 2NSXA 1UQYA 2EEXA 1JZ4A 3WNMA 3VMOA 5A6BD 1C8QA 4TX6A 1HJUA 1IZJA 3ZT7A 2CHOA 1UKQA 1JDDA 2GJXA 1JYWA 3PHAA 1KWKA 3BAYA 4DWSB 1C7TA 5F7UA 3W6MA 2V5DA 2PB1A 2WYSA 2OSYA 4ML4A 3T08A 2YDRA 2CYGA 3VX1A 1FFRA 2J8FA 2BY2A 3CUIA 4DWSA 3KE0A 4PBGA 3AFBA 2JFEX 4F79A 1DWHM 3ARRA 3VMPA 4AIUA 2PWHA 2WC3A 2X8RA 5C70A 5I0DA 2WMHA 2VVNA 1PEZA 3LMYA 3FY1A 1BG4A 3ZMRA 3B9EA 2ZX6A 4FF5A 2CBJA 2E4TA 2QMJA 2GFTA 1V0LA 4QP0A 4ATLA 3GBEA 4AD4A 1JD7A 2WAGA 3VDBA 1V0KA 4F8XA 1E71M 2BHYA 4MB3A 1UD5A 1CLXA 3JUGA 5FL1A 4Z2HA 3EMCA 1QHOA 2JEPA 1JAKA 4MB1A 2NT0A 2V3FA 1E6NA 3BC9A 1NP0A 5CPSA 1KBBA 3L4WA 3WNLA 1MW2A 1WZAA 3DHPA 4ZFMA 1C3FA 4J3XA 3AS0A 3ZJ6A 4GO8A 3CZ8A 1GOMA 2EO7A 1WDQA 1B2YA 1NWUA 2WHJA 3BAXA 4FMVA 3B9AA 1GONA 1HP5A 2JEQA 1CNVA 4HP5A 2PWFA 4B9YA 4FLQA 5EFFA 3T2QA 2C0HA 2EPMX 1MYRA 3SCOA 1UD8A 3WY1A 1JAEA 3DHUA 1K9EA 3WD2A 3WUBA 2YL9A 2CESA 3I3EA 4R5EA 4UOQA 2D23A 3SURA 1E55A 5AC5A 2WVVB 2IXUA 3VDHA 1G5AA 3AMGA 4RL3A 4W93A 1V0MA 1VRXA 2YBTA 4FK9A 4TX8A 3WBAA 1TG7A 3BMWA 2O9OA 1FOBA 2EPLX 2WVVA 5D4YA 3VIIA 3VVGA 4MAZA 1UUQA 3VIPA 5C71A 1J10A 1NP2A 4M56A 5C8BB 4W8AA 3TTQA 3CIVA 2YBUA 3W6LA 1V6XA 4C7GA 4PMVA 1J0JA 4HPHA 3NSXA 4OZOA 4PUDA 3BLKA 4UFMA 4M82A 1GVYA 2FHCA 1FP9A 1R8LA 3SUVA 4RE3A 2WHKA 3AHTA 1JGIA 3BSHA 3PZ9A 3T2OA 2EPKX 4JCLA 2J7GA 5CGTA 2XPKA 5CPQA 4P8XA 3NCOA 3WENA 1XH1A 3PZNA 5D9OA 4WKHA 1KQZA 1UOKA 3RPMA 4UCFA 1TE1A 3OBAA 3WUEA 3WQ8A 1EGZA 1FHLA 1C91A 3WMSA 3PZIA 4PMDA 4U2ZA 4X0VA 3SUSA 4D1IA 2XVPA 5HXMA 1HT6A 3SCSA 3SCUA 2ZIDA 1B30A 5FD0A 3WF1A 1E43A 2J47A 3GDBA 1ODUA 1V0NA 1JZ2A 4BQ5A 3ARYA 1CWYA 3BMVA 2UWFA 1UKSA 2PBOA 1MXGA 1JF5A 1H49A 5ABFB 1UHVA 1JFHA 3M7SA 1CXHA 2ZUNA 4J3VA 3OZOA 4AD5A 1W3JA 2F2HA 2J25A 1CLVA 3T2PA 1O6IA 5ABFA 3OLIA 3MMWA 5BROA 4UFIA 1E6QM 1VJSA 3KEHA 3UR7A 4JFVA 5DMYA 1VF8A 1UR4A 4PTXA 1PAMA 1XH0A 2F61A 3ZM8A 3VINA 2WANA 3K46A 2WLZA 1V02E 3MV11 4BQ2A 5JIWA 1HJVA 3VM7A 4E4PA 4WLCA 4H2CA 1UKTA 5ECUA 2XFRA 3ZO9A 4YPJA 1IV8A 1BVZA 1B90A 2O9RA 1WDPA 1E6SM 1LLOA 2OWCA 4ACZB 5GPRA 4FZOA 1MQRA 4FLRA 3VILA 4PMZA 4KGJA 4OBRA 1GVIA 3CHDA 2XSBA 6CGTA 4AZ5A 5IFTA 2E9LA 2VC9A 1QNPA 1CXIA 2GJRA 3WF0A 1HIZA 1R7AA 2VX4A 2W91A 5A3HA 1GCYA 3WF3A 1CBGA 1GNXA 1KB3A 2WWDA 1PX4A 4DM2A 1VBUA 2GSJA 3ARXA 1ZL1A 1BHGA 3VGHA 4LYQA 5DF0A 2FHBA 3VX0A 1UR2A 1AQ0A 4NZCA 3VU2A 3ZR6A 2DDXA 3DYPA 1D2KA 1JZ8A 1MQQA 1Q4NX 4QFUA 1EOMA 3MUIA 4DUVA 1V02A 1A3HA 3KL0A 2GUYA 4PTVA 3WD3A 1KFWA 2YDSA 2DSZA 2XWDA 2VZVA 5IDIA 1XYZA 2AMGA 2DT0A 4H7VA 4HA1A 4D6EA 1ITCA 3PZTA 3AHXA 4CUCA 3OGRA 3OA5A 2DSWA 1WZKA 1RP8A 3POHA 4JKLA 3WD4A 1CENA 3FXYA 1E4IA 1E6XM 1HP4A 1QNSA 3ZT5A 1J11A 2VQTA 4XB3A 3B9DA 2Y2WA 4U5KA 1W91A 4MTVA 5A2CA 3BGAA 3UEQA 1EA9C 4UFJA 2V3GA 4QLKA 4H8VA 1LF1A 1QNQA 1W1TA 4H41A 1ECEA 2CBIA 4CCEA 2E40A 1PJ9A 4MAVA 1JF6A 3AXHA 4EE9A 4IM4A 3AIBA 4J7RA 1LJYA 3L4YA 2V3DA 4V28A 1QI2A 3IAPA 1KCLA 1MFVA 1BF2A 1ZJBA 5LA0A 1OT2A 2VQUA 4AYSA 4W8BA 3VNYA 3VGBA 4ATWA 4GI9A
chains in the Genus database with same CATH superfamily
1G7UA 4WKFA 5HATA 4HB7A 1LRQA 4ORIA 5C9XA 2PMQA 3DFYA 3VKKA 2WLYA 3LA4A 2CLKA 4HVXA 2X0YA 1GKRA 1VYRA 3G0XA 4HA0A 3G1AA 3PTQA 3NL2A 4GXMA 4DJFA 3JR2A 2GWGA 1U00A 3VGEA 1GQKA 1K1DA 2FZBA 1FDYA 5I02A 4NJHA 4F9DA 1A49A 2Z8YA 1FUYA 3SN1A 3VC6A 3AXIA 2X41A 6ENLA 4H6KA 3WQEA 4NJIA 1ZGDA 2WKGA 4FXRA 5ENLA 3F2BA 4TTUA 4JN7A 4XZMX 3W4RA 3WLMA 4BEUA 5FIPA 4AD2A 4DHGA 3WH8A 5BWFA 3EOLA 1KRCC 2A1YA 2VMFA 4DRSA 5AFDA 2ZE0A 1A50A 2QLYA 2ZZ6A 2YDQA 3UR2A 3IJ7A 1KM1A 3EWZA 4J3ZA 1ISYA 4UC5A 2V38A 4LV4A 2D69A 4KIEA 5E9AA 1J2BA 5AY7A 3TN6A 3V75A 5AC4A 3FNDA 2RH9A 4GYFA 4XWUA 4HYBA 2DZSA 2XJ7A 3ZIZA 2VZSA 3LCLA 1TPVA 4ZB2A 3VTRA 1VFTA 3SQLA 4JQ4A 2EXOA 1HZYA 4ZQNA 1EHNA 3CQJA 4Z1AA 4MB5A 2A7RA 2QAPA 3BLLA 2Z1XA 4XAGA 4UOZA 1VFFA 4JX6A 2XUCA 1P0NA 3JW7A 2XVNA 1IEQA 3CHEA 4FOKA 1OY0A 3TQPA 4XZNX 2X1IA 2NLIA 5EBAA 2BGQA 3MSRA 1UH4A 3B06A 3DYOA 5I6SA 2PGRA 1H7WA 2OB3A 2E77A 4MDOA 4AY7A 2BXYA 5J5RA 1GKQA 4YIWA 3VFLA 5CGMA 4Q33A 2YCEA 3VKHA 3TCEA 2ZVIA 4Q32A 4V2XA 4RXFA 4H8UA 1BVWA 3WDRA 5ABTA 4LUYA 1ZAHA 2ACSA 4Q8WA 3N4FA 4UNKA 5HAOA 3DX1A 1HGYA 3N18A 3MJYA 3WF2A 3B53X 1QI5A 2GL5A 4US5A 3PZUA 4L1XA 3GXDA 1OX6A 2ZRUA 2ONEA 4C60A 4GH3A 4O0KA 1JUKA 1BD0A 1L9WA 5T26A 1OD0A 2FPVA 2Z7GA 3MUAA 3W1PA 4O52A 2CPUA 3MZ2A 4HU3A 1BXCA 4LFYA 3I4KA 4ZOAA 5DY3A 4O8AA 4JTRA 3UW6A 5FJUA 3LSCA 1IXQA 4FZPA 1TTQA 1XLEA 4OUIA 2R14A 4C6MA 3QOKA 4LAMA 4PR4A 4AC1X 3VIJA 4LC6A 5A6AA 5T91A 3GE7A 1NELA 2WZTA 3LRLA 4R7OA 5A6JA 1HF6A 3NL5A 2WC7A 1OF8A 1TV8A 3IVTA 2Z1SA 3FAXA 2FB3A 1MW0A 1KGWA 4LCSA 3HM7A 2WVSA 3W7HA 4HGXA 3RRXA 1AK5A 5G1TA 1E15A 2X09A 2Y88A 3N34A 2PDYA 3GNPA 3WFZA 1H3GA 3SRFA 4GA8A 2PLKA 1JCYA 3UZZA 1XYBA 3MUY1 4CNUA 3QFEA 4PODA 1DTNA 2F8QA 1W3IA 3IVUA 3WQ6A 2VR5A 3BLDA 4EKJA 4UQDA 3KOFA 1UC4A 4GXPA 5DCDA 3VNDA 1B3XA 1LUCB 2DT3A 4GRSA 1E9IA 3F4NA 5LIKX 1AW2A 1K7XA 4AHQA 3DYMA 1QHZA 3GZAA 3WJWA 3A6OA 4D6CA 3BLEA 1HO4A 5EKYA 3C2RA 5D33A 3W28A 2CBUA 3ATYA 5GVJA 4QRNA 3PJWA 3ONCA 4GZJA 5BRPA 2G96A 1H2JA 1OSEA 3W73A 4GVGA 5LGZA 2WMIB 3CMGA 4IPPA 2Z6JA 2R6OA 3W0KA 1ZWWA 3VNJA 8CGTA 2ZRYA 5JVLA 5I7GA 3HJZA 2Z24A 1I2OA 2NX1A 2A3EA 1EF3A 4ZB5A 5FEXA 3T1GA 4GI6A 2V3EA 1I0BA 2QGYA 1PB0A 1KFEA 4JFUA 3HAHA 1FWGC 2X40A 4HPGA 1YDVA 4K36A 1KKRA 2OT0A 1BQCA 3TX9A 4UDXX 1RY0A 1UWIA 4CD4A 3VEBA 3MCOA 1NDWA 1RH9A 1RALA 5CLTA 4L9ZA 1S1RA 2TMDA 4WOQA 1QPKA 3MSYA 1SJBA 3H2CA 2A2IA 3T0BA 4C90A 1DQWA 3OO2A 4ZO8A 1E4NA 4IM0A 1FHDA 3WUGA 1M65A 1V6WA 2OYMA 5T8GA 5HR7A 1L6YA 1E6ZA 4HU0A 2Q13A 2VRJA 3CZGA 3LPGA 1F3XA 4LBRA 3W29A 3JVAA 3HGOA 2OQYA 1JCTA 3XIMA 4NJGA 1Z32X 1X6UA 2NSOA 4NIRA 4AD1A 3TVAA 1VLIA 1ZENA 4NRSA 2VJXA 2ZYFA 2DH2A 4IL0A 4C6KA 4A21A 4IIHA 5D03A 3KTSA 4HIBA 3V5OA 4ATDA 1G9HA 4E6MA 3QA8A 2ZUWA 3MUZ1 1LL7A 5FAJA 5AYXA 2HS6A 3DEQA 1REQA 2JBMA 2ZZ1A 4ZBCA 4NSBA 4MUPA 1ZBCA 4A3UA 2HTMA 1AJ2A 4P8WA 2WZHA 2VEKA 4BEQA 1FDZA 3FV9A 4LC8A 2VL4A 1XPYA 4REQA 3SCVA 2UZ9A 4US6A 3PJXA 1H7OA 3U2OA 2ZZ4A 3USBA 3P80A 1FCUA 2GJPA 5REQA 3GVQA 1CXLA 4O1FA 5GNZA 3MANA 4ACZA 2GVLA 1F4HA 4KCVA 3CUHA 1OFOA 2G97A 4QGCA 3RR1A 1NOFA 1YNPA 3E0LA 2I9UA 4GVFA 1JCXA 4J2MA 3S1XA 4UR8A 1V93A 1EZ2A 1B54A 3W1RA 4IF2A 1OBAA 1UWSA 2QCEA 4ECLA 4O8RA 5AYBA 4S3KA 1H1YA 1QX1A 3PJUA 3K8KA 3M7WA 3EKGA 4O50A 4NAEA 1JPDX 1H0IA 5E70A 1CECA 3MJMA 1H09A 4XVDA 4PFHA 5H1WA 3AS3A 4EZWA 1R6WA 2X3VA 2O0TA 1YYAA 2V68A 4PMQA 5AYZA 4DQWA 2C13A 4ZXLA 1P6WA 3W25A 4LV9A 1E9LA 3QGKC 5HUOA 2O7QA 4FX6M 5AZ1A 4O13A 5BYWA 3W7RA 1FHUA 2YR1A 1A3WA 5I3JA 3V35A 1PL9A 4JTIA 1GKPA 2C3ZA 1QI4A 4WK9A 4C7FA 1VEPA 5LHFA 4JKKA 1MSSA 4PEKA 2DZXA 2XHYA 1G69A 1QXLA 3MW7A 1KA9F 4OOZA 2YCIX 2ISVA 4DLMA 3M0XA 4MUZA 2DPEA 2J62A 3G24A 3G1RA 1J01A 4GXWA 1ODZA 1PVNA 2OYLA 2E8ZA 1YE4A 1GN9A 5AHLA 1H0GA 3I3BA 1A3XA 3AIRA 4ZOBA 3NOEA 3SYVA 2WZEA 4O14A 4CQBA 1LORA 1TZ7A 1H61A 4XUGA 3I04A 4C6PA 5EGRA 1Q13A 4L6HA 3A9BA 1S1PA 2D20A 2AL2A 4XO7A 4U2YA 3P14A 3PAJA 3DH7A 1K8XA 4ZTYA 5K2ZA 3ZJKA 3W7QA 4R5JA 3TYDA 1AD4A 3IJ9A 5HNUA 2XIIA 1C9WA 4PMNA 4WOZA 3P60A 4LPCA 2YW4A 2PS2A 1OGBA 4MZ1A 3G18A 3E6EA 3T6CA 5AECA 2J27A 2X42A 3N2MA 1GQNA 5FF0A 4L80A 1EXBA 4IWOA 3WLHA 1DIDA 4X9SA 4L9XA 3M5XA 3WQFA 4G6CA 1PIIA 1S2AA 3AQUA 3EWBX 2F7RA 2Y4SA 1JPKA 4GH1A 1SW0A 3CT7A 3UJFA 4HMEA 5J5DA 4UMBA 2C1IA 1DHPA 1VHNA 3PVFA 5FKYA 2OSXA 1W56A 2W9MA 3P3BA 2NV1A 4GD0A 2PDQA 1L0PA 1QVBA 2J8GA 3E0FA 3SUTA 3HMCA 3HFYA 2EQDA 4ENLA 1CGUA 3TTOA 5FF3A 3PZGA 1EXPA 4BI6A 1SU6A 4DJDD 2ZQ0A 3PBWA 4UQCA 3D4YA 1AW5A 2VKZG 3BVUA 3DOPA 5CH9A 4JNZA 1EO5A 2WMFA 4HPJA 3TW7A 4AXNA 5HJYA 1XLBA 4TXEA 4IIBA 1BGAA 1PXGA 1IXNA 2R1NA 1OB0A 1HKMA 3UWZA 3LI1A 3EDDA 3O07A 5LZLA 3N2OA 4XUYA 3I7RA 4XAPA 3CB3A 5BXTA 3L9CA 2YCLB 4MWAD 1IIHA 2QUUA 2DUAA 2DZVA 4P7QA 3URAA 3KBNA 4UB9A 5K7JA 1XIBA 3G6MA 1WCGA 1DXEA 4WJEA 3ZLGA 5IHRA 2CKSA 3KS5A 1XP3A 1TJ1A 1W1VA 2YIAA 4LUIA 3TIMA 3PPHA 4PMUA 1ITQA 4DBSA 1KV5A 3OW1A 4QSHA 4GVHA 5HDRA 1ZTVA 3BAKA 1NARA 3SUWA 3B4UA 1THFD 4ZODA 4DM1A 4MDPA 1TV4A 2XFYA 4AIBA 3T7VA 3TYEA 3NQAA 1H7NA 1F8MA 3LM3A 3CC1A 3H4GA 4JQ3A 4KWUA 3WO8A 2OCZA 2OGYA 2KAUC 4MYAA 4KCWA 3B8WA 3EXTA 2WCSA 3S5OA 4JHZA 1E1EA 2P0IA 2FTPA 1B31A 2W66A 4U33A 3W3OA 4LNCA 1UMYA 4F48A 5A6TC 1BWKA 1R86A 1IR2A 1UKPA 2VFEA 3LERA 4JFWA 4J9JA 1FY6A 3SRKA 4POCA 4Y9AA 3NOYA 3U7BA 3QYSA 4HKPA 5I09A 3TTYA 2YA2A 2W67A 1M41A 4U3AA 4WHBA 4NJJA 5CG7A 5I3DA 4HJFA 2D2JA 3CWHA 3M44A 1KR0A 5DO8A 4JHOA 3POCA 3OLDA 1C93A 1KRMA 4KEMA 3U6WA 3UWUA 2Y24A 1TJPA 4RZ6A 4HTBA 1G7VA 1UR1A 3P81A 3MDUA 1VKFA 1XDMA 1I75A 3S47A 2KZHA 2EG7A 4YS1A 1HJXA 1M7JA 1AD1A 3DDFA 2NXHA 5E6ZA 2ZX5A 3BAWA 3SW6A 2IPJA 4JTHA 4J3SA 2DW6A 1NDZA 4OBSA 2ZZ7A 5M1TA 5CPMA 3WMCA 3VDGA 4JNEA 1RBLA 1SM9A 4LGXA 1LWHA 3LBMA 4AF0B 3NXLA 5CPLA 3F4VA 2I56A 3SO7A 2NWRA 1XCWA 4LYPA 3A98A 4GG9A 5LXXA 4PMXA 4DJDC 1B9ZA 2JGYA 2I9EA 1DJWA 1TQWA 3EDEA 1TQTA 1XIHA 2BY1A 1R33A 3H2FA 3WQ4A 5FAGA 3QGAC 4H6RA 3H8AA 2GLKA 2ICSA 3GDTA 2VTFA 3N15A 2DQXA 3TA9A 3LX9A 4OIFA 3W02A 4ZO7A 1RR2A 3Q4DA 4LUSA 1UZHA 4LBSA 2VZUA 1Z7AA 2QVHA 3N4EA 1YDOA 2NQ9A 4IJRA 3TOYA 3BQ5A 2ND1A 4MWAC 2DUZA 2Y89A 1NJJA 1KWGA 3F4DA 2XINA 1NIUA 3FFSA 2JKEA 1VP5A 4C6FA 3DG7A 4YL2A 1W1YA 3FCPA 3UPWA 3QSTA 3K8LA 3CH9A 4WJXA 4R3UA 3DX2A 2WYHA 3M1ZA 4K2SA 4QTGA 4GQRA 1LT7A 1VFOA 2ISFA 1S39A 3FKRA 2WZIA 2YKKA 1I4DA 1VCGA 3WBWA 2V6AA 1H1NA 3CNYA 3VXGA 2ASHA 3OG2A 3RUBL 3HJEA 3WZ0E 2E6YA 2ALRA 1AQMA 1V3JA 1GK8A 3G0SA 3C86A 3R8HA 2ZA2A 2G3MA 3C3UA 3RX4A 4UWMA 3BSGA 4LF1A 1MW3A 4CNNA 2XH4A 2OZ0A 2ND0A 2Y8UA 3LCHA 1SZNA 2WW5A 1P7TB 2J24A 1EUNA 1PS3A 3U7VA 3MPGA 3W2KA 4EIVA 2WJDA 2PD9A 4IIDA 4HNUA 4KESA 3E0VA 5A6KA 2HXTA 5G2IA 3VI2A 1QO2A 3SQMA 3THQA 4GYKA 3D2FA 1C90A 1RCQA 4RW5A 1Y0EA 4O16A 2B7NA 4N6FA 5D2TA 3WLJA 5BXPA 2CERA 1Q6LA 4FAMA 3TW9A 3U48A 2P88A 2YIHA 2B81A 2F9RA 4O4WA 1J0IA 3BV7A 2NVAA 1K77A 1OC5A 1QTWA 4IMDA 1IEXA 3GB6A 2QDHA 4GKLA 4H04A 5HNRA 1JEZA 2Z26A 4HR1B 4F40A 3EX3A 1DJXA 1LP6A 2PTDA 4DN1A 1Q7MA 1UR3M 5DBUA 2ZTKA 5LA2A 1WDSA 2PY6A 1Q4WA 3E2SA 1VJIA 5AHMA 1AL8A 4R85A 3WNNA 4L64A 4BK9A 1SYTA 5LHEA 2PURA 3FHQA 2PP1A 4JICA 3ANUA 3Q65A 1E4LA 3MSGA 4H8NA 3LVTA 3NPUA 3W00A 3HV8A 3S5NA 2DZPA 4DLFA 1UZ4A 2VEPA 1US3A 1QW8A 2Z7KA 5ABHA 4N4PA 1EWDA 3GR7A 2A7PA 4UNIA 1G0CA 3JU2A 4PB4A 4L4LA 2QUMA 4PBFA 2CHNA 3ES8A 4ZQMA 2WCAA 4CCCA 2DZBA 4CN6A 2YL8A 4ML9A 3SY1A 2XTKA 2F7QA 1AJZA 9RUBA 4ICNA 4RW3A 1H4PA 1V51A 4IL2A 1X96A 5CQ1A 5CSYA 1MI3A 3PR2A 2H9AA 3BL3A 3B0VC 5MF5A 1J96A 2QCNA 1L2UA 2V82A 4XK2A 1DBTA 3SECA 1I2RA 1EOKA 1X8CA 4K7YA 2Z1KA 2OELA 3GW3A 5C54A 3GWQA 2NQ5A 4HHLA 1UZ1A 1VHCA 3NVDA 3QV8A 3GDMA 2J74A 5FJPA 4NXSA 4NX5A 1RPKA 4GYJA 3EA3A 4UTTC 1JL8A 4NKCA 5CPNA 3ONBA 1UWRA 3CQKA 1LQ7A 2BLEA 4IUOA 1I1WA 2FVKA 2X2YA 3WDJA 3C52A 4HJWA 4ATMA 2REQB 1EF2A 2LM0A 1BGGA 4K7VA 3TAOA 3AUOA 3QV7A 3F5KA 2VDGA 3OHIA 2PP0A 1SZRA 3PF3A 4WZHA 3ZJ8A 3WX7A 3LHUA 3S83A 4JIEA 3L0GA 4P8VA 5A8MA 3J7HA 3DBNA 1K02A 1M03A 1J6OA 4UTMA 4O0QA 5A8QA 4GOAA 1PBGA 3B52X 2WB5A 2PU0A 3O16A 2DIEA 1JZ5A 1EDGA 3QV6A 4TR9A 2XGBA 3EDKA 1D8CA 1GUVA 3AISA 4Q4KA 4RZ4A 1HVQA 4PTNA 4ICCX 5BMXA 1LG2A 5FEWA 1OF6A 3MWAA 3FJ6A 1SO3A 1BTCA 2TSYA 3JS3A 3UXLA 2WM1A 4NILA 1VC4A 2ISDA 4X60A 4DYLA 1VFMA 2NUWA 4BWLA 2ZUMA 4TV5A 2TYSA 1GVEA 4JY9A 3E49A 4L61A 1Z44A 1HO1A 4WDXA 4LAKA 1OAOA 4L6DA 4UCGA 4E4FA 4J28A 5EL1A 3DGBA 4CU7A 1V79A 1O12A 1T0OA 5A94A 3HQOA 4XQ6A 3T8QA 4E4UA 3A5FA 1M9HA 4NJKA 1JJKA 1TJ0A 4O18A 3DFQA 2Y70A 1YPIA 1UR8A 3WLSA 3BZJA 3TXVA 1DE5A 2A5HA 3M0HA 4XTIA 3W2LA 3UNDA 1LOSA 1B0IA 4Q8MA 5CC7A 3UERA 3S0CA 4W86A 3AHVA 3CL7A 1UD2A 3PJTA 4ZQOA 2AAAA 2FHFA 4QAWA 2YYUA 1JYXA 1CB2A 2PTWA 4NSWA 1QASA 1JI2A 4Y9OA 5D9NA 3RNDA 3PSVA 3PUDA 4H7ZA 3R13A 4ZOCA 4D6JA 3TNBA 1ZCCA 4RDWA 3RM8A 1F6KA 3U8GA 3IRSA 4NYYA 2FH6A 2O7SA 2WSYA 3PUGA 5CSRA 3BPWA 4K8EA 2GJXB 1MDLA 2VFDA 2NSXA 4AEOA 3WNMA 1C8QA 1QK0A 1RV8A 4GCXA 4X63A 1EL3A 1VBJA 1JDDA 4S1FA 1RBOB 1PYMA 1K7FA 5F7UA 4NVTA 4N02A 4ML4A 4EZTA 4M5PA 2J9ZA 2CYGA 1EPVA 1FHVA 1FFRA 3P6LA 3AFBA 2JFEX 3SI9A 5FI8A 3VMPA 4AIUA 2WC3A 1RCXB 1XIIA 5D2VA 2Z28A 3GFYA 3ZMRA 5DN1A 3FA4A 4GKTA 1ZRQA 2CBJA 1J2WA 2GFTA 1ITUA 2SFPA 3R0DA 3RLUA 3LXCA 1EJWC 3B8IA 4NZ5A 2OU4A 4FIQA 3IIPA 3KRUA 4GGBA 5FL1A 2HV5A 3NM1A 1FBAA 3BLIA 1WA3A 3UD6A 1QWUA 1NTHA 3GSMA 1XCFA 2V3FA 1E6NA 3BC9A 3EEGA 4I7WA 1P43A 1WZAA 3DHPA 3ITCA 1DJGA 3KCOA 5CCZA 3ZZ1A 1HQTA 1GOMA 5DY2A 3F7WA 3DU0A 1WDQA 1B2YA 1QMLA 1YRRA 4ZZ9A 1LROA 3B9AA 1GONA 4UTLA 1CNVA 2E7FA 1F07A 3FGCA 2HZGA 4ZQRA 4I9AA 1MYRA 4LW7A 3SCOA 1UD8A 1K9EA 3N4AA 2HDJA 3IGXA 1M7OA 3WUBA 3I3EA 1JUBA 4LUTB 1E55A 3ACOA 1KCXA 1TV2A 4UTJA 3AMGA 4RL3A 1VRXA 4FK9A 1TRIA 4R9XA 2ABBA 4YWSA 2EPLX 4R7JA 3M3WA 4U4MA 1IT7A 1UWAA 3BOLA 3PWIA 4DJED 4MAZA 1L8PA 1UUQA 2BOFX 3MO7A 2RFGA 3R0UA 1SW7A 1IEWA 3SBFA 1DJYA 4FALA 3A23A 3EX4A 3PP7A 1XBZA 1TPH1 1W5QA 4MZ8A 4DCNC 1UC5A 5CZ0A 3HPAA 3TWBA 1J0JA 4X22A 4B5VA 4HPHA 5D09A 1KO0A 3NSXA 3CEPA 3OQ8A 4QJ3B 3BLKA 1BQGA 4JXCA 1R8LA 3NZGA 2WHKA 3AHTA 3OWGA 4RDYA 3BSHA 3RFAA 3L5LA 4JCLA 2XPKA 4P8XA 3NCOA 3WENA 1P0KA 3PZNA 2ODOA 3DKLA 1I9CB 1J93A 1KQZA 3RPMA 1YMYA 3WUEA 3WQ8A 1EGZA 1OZQA 1C91A 1TJRA 4U2ZA 4DO7A 3UITA 4AWUA 1POJA 4R9OA 1HT6A 3SCSA 2FTWA 2ZIDA 3WF1A 5BW6A 4NI8A 3CQHA 1EEPA 1ODUA 3IGUA 4BQ5A 4IPJA 3G5EA 5G5IA 1ZCOA 5TIMA 3I6RA 1H49A 3DC8A 3L66A 5ABFB 3WQPA 4HBKA 1ICSA 1JFHA 1CXHA 4MVAA 3ABXA 1ML1A 2F2HA 4FZIA 1E9YB 1NDVA 3VCRA 4DJDA 1S3HA 3MMWA 2FICA 2BGSA 4UFIA 1PYFA 3S6DA 1YKWA 3DBPA 1VF8A 4HMNA 1UR4A 5LKYA 4XAYA 3ZM8A 1KTBA 2WANA 4F4RA 2WLZA 1T6MA 2OBMA 1KNWA 4BQ2A 4IIGA 3T4CA 2XSXA 4E4PA 4H2CA 5ECUA 3KOXA 4B90A 4PUUA 4XZLX 3UXIA 9XIMA 1B90A 1XX1A 4MWAA 2Y7FA 5BOOA 1LLOA 4FS9A 4HR1A 3GTIA 3TJXA 3BTNA 3R7MA 3PWGA 3P74A 1MQRA 3W2JA 4A8NA 2J66A 4PMZA 3G1VA 4EPEC 2GAFD 3W7JA 1IQ8A 5IFTA 3W9ZA 1CXIA 2QNEA 1R3SA 1R7AA 4M0XA 3WF3A 1CBGA 1GNXA 1KB3A 4H2HA 1TIMA 1PX4A 3BUVA 5XIMA 1ZL1A 4GLEA 1AQ0A 3B9NA 2XISA 1TRDA 3V18A 4RE0A 4Y9NA 2QVNA 2JNSA 4QFUA 3MUIA 4Q4OA 5CBJA 2RDUA 1V02A 2PODA 1A3HA 3KL0A 4DJEC 3LG3A 4ZSUA 5HINA 1VS1A 3VKCA 2DSZA 2XWDA 1PKLA 2VEMA 2ZZ5A 1XYZA 2DT0A 1I45A 3W84A 2PGWA 3QMSA 3C2FA 4NY2A 4HA1A 3PZTA 3OGRA 5HJXA 5J8LA 3TW6A 3W76A 3D52A 3GU9A 3H2EA 3SJ3A 4Z1CA 1CENA 4A6GA 2N3KA 1HP4A 1QNSA 3HQ1A 4WEVX 3ZT5A 3UYIA 1KM2A 2VQTA 3B9DA 1R3VA 3M0VA 3GVRA 3BGGA 1HXKA 4MTVA 4FR6A 4AVFA 5A2CA 4QQ3A 4DBUA 5BNKA 4IFRA 4J2PA 1ECEA 2PGEA 3SB0A 2V9DA 1TX0A 3DYTA 4MAVA 3AXHA 4QS5A 4EE9A 3HO8A 5D2YA 3UJ2A 3L4YA 2PWVA 2VQUA 2VD8A 2RT6A 2QJHA 3CKDA 4ATWA 1PDZA 1XGEA 1L6WA 1NOWA 1TCMA 4QLJA 6A3HA 2ZUSA 5C5BA 2GVYA 2MANA 4Q3MA 2EJAA 3C4UA 6REQB 4WUIA 2VX5A 3WK2A 1TJ2A 3GDKA 4KEUA 3EDFA 1E0VA 1JFXA 4K8GA 3AHZA 4DVOA 5KZDA 3T0TA 1CIUA 4E3VA 1B3VA 1V6VA 3E12A 1TSIA 3LHYA 1C7SA 3KDRA 4WXYA 3V3WA 3T78A 2PUZA 1PSCA 1E6PA 5LNUA 5AHEA 4HA3A 1DV7A 4DNMA 4E0CA 4MY9A 3W7LA 5T9BG 1ALDA 2PDWA 3WJXA 1EC8A 1W3KA 1F3WA 4WY0A 3D2EA 2Y8KA 3AALA 3BCFA 3F1QA 4PN2A 3W26A 4IIEA 1RP9A 1BYDA 1D3CA 5EY5A 3KVMA 1GYMA 4JWCA 4YNGA 4Z42C 3QR3A 5E0FA 3CZKA 3WYZA 2GOKA 3BARA 4NQIA 3L4VA 5EMLA 4IP7A 3LRMA 5E93A 3EMZA 3TXZA 1V8EA 2J9YA 3EGJA 1FWDC 4L5ZA 3I68A 3MV01 4DWSC 1CW2A 3EYPA 1T7LA 3TNOA 2D2HA 4WF7A 5M03A 3R1ZA 3ZS4A 3A3HA 2QDEA 3RO8A 3QNJA 1TQXA 3L68A 4PRRA 2DEPA 4UZSA 4GVIA 3VNIA 1W2VA 4AWSA 5K9XA 1UOZA 3VNMA 3IACA 1UG6A 4Z1YA 5DFAA 1B5TA 1Q6RA 3TONA 3OIXA 1KGUA 4C6OA 1S2CA 2LLEA 1QATA 2VX6A 2GGHA 2X1RA 1JIBA 3EXRA 5M2FX 4DB7A 1V3IA 2PCEA 3W7DA 3N2XA 4LVFA 2QCGA 3AIWA 1VBRA 5C2CA 2OYKA 1I4NA 3M6DA 3CV7A 1UR0A 4MNMA 3GFXA 2J88A 3W2UA 4FI4A 3BJTA 2BXVA 4XBKA 3H2OA 3LLFA 4LANA 1WKEA 3GTNA 3K13A 1XM3A 1JPIA 5I5RA 2PDPA 4AZGA 1XIDA 1O5XA 4B4FA 4HHMA 2JALA 5EU9A 2CZDA 3PBYA 3M4HA 3UWVA 3SIZA 3EKZA 4K37A 1E5JA 2C7FA 2WV8A 4L1GA 3W7PA 2QIIA 4I3GA 5TKYA 4XKYB 1EZWA 1ZBVA 2RDTA 4EXBA 1TR9A 3N25A 7CGTA 3UG3A 8A3HA 3T05A 3WH6A 3UJRA 2PFHA 4QLLA 4LTSA 1R3YA 3OQEA 5FLEX 3ELFA 2INFA 1XGDA 1XV8A 3FEQA 3OYXA 2PSNA 1HTIA 1Z8AA 4NPHA 3OLGA 4PEEA 5B7YA 1M1BA 3KOZA 3KBJA 3RILA 1URUA 3E3HA 3WH9A 1ENUA 1GG0A 1KFKA 1EHAA 2VZOA 5CSSA 2OEKA 4DXXA 3EX1A 4EANA 3STFA 2XFWA 4CN4A 2G3NA 4PFMA 2YB1A 4H9YA 3W88A 2WSPA 4EAMA 4L1WA 6PTDA 1N8FA 4RZBA 2H8XA 1A80A 4BF5A 1SO5A 4DUOA 4RXGA 1SMAA 4LCQA 5M17A 1AL7A 1SSDA 4QE5A 4WCJA 4TV6A 3N19B 5A6SA 1XUZA 1SJDA 2HJPA 3OGVA 1CX9A 4QJ1A 3VNKA 2E1WA 1A5SA 3W72A 1PE1A 4RPQA 1HKIA 3W1QA 4GE8A 2MNRA 1RD6A 1XH2A 4W8LA 3KRBA 5IHSA 2J6VA 5PTDA 4RE2A 1K8CA 2VP8A 3CVRA 1BRLB 5GNYA 3T40A 3CXOA 1WUFA 2FMOA 2XVLA 4Q8OA 3VIMA 2PWEA 3WFAA 3T42A 2XIJA 4MNLA 4YVVA 3SCPA 1UCWA 3KOYA 1H1ZA 1J18A 3U0HA 1TPWA 3CWOX 2BVTA 3DFPA 2ZXAA 3W1AA 2ATSA 1K9FA 2Y6ZA 1O95A 4QDWA 1WDWA 3LCXA 3R25A 3KM8A 4HOZA 1LRNA 4QXIA 3WQVA 4NZ4A 2O0I1 3WUFA 5DMLA 4TTGA 4X9YA 3REQA 3TMLA 4UTIA 1WE5A 5CC3A 3IIVA 5D38A 1ME8A 6XIMA 4GJJA 3TN4A 3ABRA 4KIKA 1K6WA 2E09A 2Y63A 2E9MA 3WH5A 4RDVA 4IMFA 4Z1DA 2HS8A 2J13A 3NQBA 2VOTA 3QHNA 1TQVA 1G01A 4GC3A 1PZ3A 3BUDA 2WOQA 1QCWA 3PZQA 2E9BA 4MWAE 2EF9A 2CCRA 3II1A 4KPLA 1OQFA 3WEZA 3C8FA 4FIRA 2PTZA 1ZNNA 4J3TA 4CNSA 1MUMA 4JL2A 1Q6OA 2C19A 3FX4A 3EWDA 4FNUA 5LIWX 1PHQA 1HJSA 2BBFA 1KFJA 4I5UA 3CZNA 2WNNA 1JQXA 2E68A 4LALA 2BOEX 3SR7A 3UFYA 4DZHA 1KBIA 2YL6A 4OJYA 1TPUA 3VABA 4NAFA 3UXAA 5EFDA 1TTPA 2Z00A 2DH3A 4H6EA 4AIOA 1G4SA 2FZ9A 2EAWA 3O3NB 3W1TA 3FSUA 3VNZA 1O7DC 1CT5A 1TCDA 1YXYA 3CUGA 4KBXA 1ZAIA 3A24A 1OWQA 4YTUA 1U2YA 3QZAA 1EJRC 2HNEA 3OA3A 4PTDA 5AHFA 3I7SA 3QQ0A 3EOUA 4D2JA 1SZEA 3QZEA 3S6TA 1IT8A 3CH0A 1JQKA 1V3HA 3EPNA 4AZ6A 2WINM 1K9DA 1XLHA 1MUWA 2CW6A 2CZEA 3B97A 2OO6A 3AU6A 2WKLA 3EA2A 1XCXA 1JXKA 1TTIA 3ABHA 4W9TA 4JL1A 5HNTA 3GZ3A 2WVUA 2WMKA 4FLSA 2OZ3A 3HV9A 4B2DD 4PC8A 5I07A 3ZFHA 3DG6A 5D02A 3VKAA 3N6QA 4JTAA 4MLRA 3E38A 3GXPA 3B40A 4AVOA 1RAKA 3G3DA 4Z2JA 4KFOA 3MP4A 3A12A 4JQAA 2QJMA 3UXDA 4HHPA 4Q22A 1EEXA 3QW3A 4ADSA 2R91A 1KXQA 3ICJA 2RHGA 1XC4A 3AYSA 1GZGA 4GQGA 4DBEA 3BE7A 4XD4A 4F0KA 4WGHA 5G2HA 4D8ZA 3DXIA 1LLWA 1B3WA 3KTXA 1OCJA 2F6KA 4FA3A 2W0UA 5I3KA 1W31A 5KTLA 1XLJA 3IJ8A 1GW1A 1EP3A 3W82A 5TD4A 1TTJA 4G7EB 1JCLA 4KKXA 2BV9A 4PCTA 3THCA 4JIHA 4A8LA 3ZLHA 3TROA 2CXGA 5I3GA 4F01A 1ZPTA 3N9RA 2FJKA 2VYOA 1UBPC 4LB4A 4PL1A 4E8DA 1O94A 5IXEA 4KEZA 3NQ7A 4S3AA 5EBUA 4PUNA 1LL4A 5HQEA 5D37A 1CXKA 3WNPA 4Q8PA 1C9DA 3KP1A 3BVXA 1HWWA 5IBXA 4P7NA 5KBPA 1MW1A 3CEUA 3BUQA 4KGLA 1A5BA 3V7PA 3LRKA 3W7GA 1PWLA 3W75A 1VYPX 3FVDA 4JBRA 1UR9A 2V5JA 2YGYA 3N13A 4MJMA 4W7WA 3LCGA 5I3IA 4DI8A 4DELA 3C61A 3FN9A 1AZ2A 1TPB1 4Q8UA 3UY7A 2XYLA 3ERPA 3N2BA 5CZTA 2Q8XA 2J8TA 1ZU8A 2IQTA 1UUOA 4AIEA 3WL1A 3TSMA 4YCOA 4JYEA 3KDNA 2WQPA 3NL6A 3WLLA 1UP2A 5AN7A 4HZ6A 2ZRWA 3S2NA 2UY4A 3CLWA 3ES7A 4DJEA 2BMBA 3EXSA 3EJRA 3GH4A 3KBMA 3KLKA 2D2OA 3BZGA 1AG1O 2GYIA 5F2MA 1YWMA 1CI1A 3S1WA 2ON3A 2QQ6A 1AODA 1N8IA 2QYGA 4FR1A 1JGMA 1CDGA 4KMQA 4M80A 2A3BA 4A2RA 1YEYA 1V3MA 3QHMA 4MFEA 1SR9A 4DO6A 1XLLA 2DT1A 4GZEA 3LGEA 2YZ5A 2ZFAA 3APTA 4HHHA 4M6QA 1YBQA 2B4GA 3WQDA 4IX2A 3BWWA 3BVWA 1J0YA 4XBSA 3QGVA 4B4HA 3OGSA 4LRSA 1Z41A 2XGIA 5CG0A 1JNDA 3LBOA 5LIXX 3G1DA 2ZUTA 1UWUA 1NWSA 2NW0A 3RM9A 3R8GA 3L67A 2GQ8A 3D0CA 1ZQ5A 1Q3NA 3WQGA 5HMDA 5TAOA 3O3MB 3AU2A 1UKOA 5DT5A 3VGFA 5FF7A 1WBJA 4V1XA 1CGWA 4Q4QA 4JIRA 2CBVA 4QG6A 2WPGA 1EBGA 3W83A 4JWDA 3F7JA 1XISA 2I5QA 1DWIM 3OBKA 2VFFA 3G6LA 3PTMA 5FESA 1FCQA 4ZVJA 4ZTXA 5I06A 3L7RA 3UF9A 1WNOA 1OADA 1EJXC 1GNLA 5LA1A 1SGJA 2V2CA 3G1FA 4Q8QA 2RUSA 2ZRXA 4MJ4A 2RGMA 3OJGA 3W7OA 5C9UA 4HMDA 1XYAA 2UY2A 1UIOA 4YCPA 2YI9A 1B9BA 2G41A 1HTYA 3VKDA 2VXNA 1FWSA 4HD5A 2PA6A 3GM8A 4JIPA 3QY6A 2HBXA 1WQ5A 3WK1A 4AVNA 4M19A 3W6YA 4H4IA 1VPYA 3IJLA 3NVTA 2WNWA 3L3OM 1E1DA 1VD6A 4E2BA 4IPIA 4Y8FA 3AS1A 1X6NA 1SFTA 3OEXA 4HSNA 3WQOA 5MKGA 1UD4A 3G2GA 4MMWA 3AROA 4GCAA 2OX4A 1QUMA 2PLJA 4K39A 3NQEA 2MI7A 5BCAA 1KV8A 2ZUVA 4GIAA 4XKYA 2Q3OA 4ZL1A 4IXXA 2D1ZA 1GPFA 1NDYA 1QOQA 2L5HA 4XZBA 4EP8C 1UW9A 4XAZA 2BY3A 3BVJA 1EB3A 4JEQA 1UD6A 1W2PA 1SUFA 1K4HA 4JZ5A 2A3HA 3R12A 1CGVA 4C1NA 3THAA 2FDSA 2E6DA 3ZEDA 3U2EA 4HU8A 2D3NA 2OODA 3GG7A 3ARSA 3NQ2A 5I77A 1PX8A 1J0ZA 4D6IA 2QXLA 1ZJAA 2A79A 3PG9A 1LQ0A 5CZJA 3AJ7A 3RJYA 1XJBA 3DHDA 1J12A 3O2LA 1H7RA 4HYVA 1MXDA 3INPA 3GR8A 2BVDA 1KRBC 1B1YA 3VIGA 1OFQA 3E2VA 5GQBA 4YJ5A 2UV8G 2GK1A 3NA8A 1JNEA 1BPLB 4RCXA 1LG1A 3EJUA 1B4EA 3GUGA 4UTFA 4FLOA 1W37A 4X2PA 1OT1A 3KZPA 2IS7A 4Z2LA 1DPMA 1X1NA 3KBWA 1VYSX 3EX2A 2X7VA 3DUGA 5DMNA 3KS6A 4JR5A 3JRKA 5CPTA 1E40A 4MYXA 4QX4A 4S38A 5A6LA 2C14A 4I5XA 3ER9B 3WSUA 1D7FA 2PWGA 3THDA 1DVJA 1FWRA 2RJHA 2AQOA 4I7VA 1SMDA 1TB3A 1L8NA 3PFRA 2X2GA 2CC0A 4BQ3A 2NQLA 1AMYA 1CTNA 3FYOA 1TMQA 2R1LA 2E6AA 3BV4A 1MQPA 3DG3A 1O7AA 5A8OA 2PDUA 4JN8A 4WR3A 3U57A 1SVDA 4AMCA 1XRVA 3IK2A 1CGXA 3AYRA 2V5BA 1GVFA 5FOOA 4RKAA 3CUZA 4AB4A 3WDIA 4CNPA 4MPKA 1BYCA 1GHSA 3M0ZA 1ECQA 3LV6A 1BWVA 2AKZA 2ZRZA 4XZIA 4HK5A 3VD3A 4UQBA 3DENA 1NQ6A 1Z48A 2YCJA 1ADSA 4PTWA 3IEBA 2CETA 2WC4A 1OYAA 2BOGX 2E5CA 2QPSA 4XX6A 3NDOA 1HFBA 4TVCA 4GY1A 4ALDA 1OA0A 1QOXA 3SGGA 1W5MA 5RUBA 1CXEA 1E72M 4Y90A 1H62A 4JTKA 4MGGA 5IM51 2VI0A 1XYMA 3TN5A 4Y96A 5CPOA 4U31A 3AMKA 1JRCA 3TZFA 2HQAA 2C71A 1GQIA 1R30A 4LWWA 2Y85A 3MP5A 2VRKA 1QU4A 4H8HA 1GQJA 2NVDA 3E0WA 2WXDM 3GVVA 2NWSA 1ZZMA 3GD6A 3I7QA 3W38A 1GNTA 2A3LA 3NSNA 3OZMA 1FWNA 4GBUA 2W63A 3U5UA 3WDQA 4U5IA 1RVKA 3ERCC 3I6EA 2FDMA 1SO6A 5HMEA 5CKSA 1EA0A 4FXJA 1DJIA 1K8ZA 5HA7A 1OK4A 3JZUA 3ITLA 5D2XA 3CHCA 2J6XA 3F4WA 4LSBA 1O68A 1TWWA 4GPNA 5BRBA 2EPNA 3HQPA 2QUVA 1FVPA 4CNOA 2QKFA 3N6JA 4UQ9A 1E6RA 2KX9A 3H4XA 4XTDA 3GXMA 4S39A 2JIEA 3EOOA 1GHRA 3GG1A 3NPWA 1LCOA 3SSZA 3BUIA 1HKKA 3TSBA 4DPQA 4LU0A 4AY1A 3CV5A 3T09A 1FH8A 5I24A 4TMBA 3O6DA 3CUXA 4OV9A 5KEZA 2OWWA 4PBEA 3L4TA 1Y7VA 3E5BA 4O1DA 5TQLA 3HGJA 3IGHX 4HTYA 1Q7QA 2JQXA 2J7CA 5F4WA 2DVXA 2JKAA 1K4GA 2YI8A 3FIGA 2YYTA 1NFGA 2Y7EA 4QJ5B 1GOQA 3SGUA 1JPMA 3QC3A 2P76A 1XKJA 2EX3B 4UBPC 1DTUA 2W3ZA 1QPQA 4E2DA 4GI8A 4DBWA 3WBEA 3WLIA 4DXVA 3PBMA 1OGGA 4KETA 5GJMA 3A4AA 2GQ9A 3A3XA 3GW0A 1DHKA 1E1CB 1F73A 1X8FA 1R2TA 3GXTA 5JBFA 3C56A 2XWEA 4I6VA 1TE6A 3K4AA 5I79A 4GINA 2PWUA 1UWTA 4E3CA 4GJ1A 4Y7EA 3O1NA 1KR1A 4KWVA 3NUKA 2GJLA 2NX9A 1XDJA 3RU6A 3I10A 2INEA 4EZQA 2D3LA 3MU7A 3VIFA 5A1AA 3UQNA 4I9JA 4O11A 3WLRA 2OQHA 4HK6A 2C8NA 5EYWA 5FSDC 3V0TA 1KLYA 3WEMA 3SGZA 4E2OA 3M16A 4IMCA 2PBGA 2NUYA 3L2LA 5GNXA 3UJEA 2QGHA 4OKDA 4NUWA 2VHLA 4DUWA 4FPSA 2PU1A 3DN5A 1S5VA 2GA9D 3N17A 1I0DA 2NLYA 4GYPC 3LPOA 5AHNA 3STPA 4DO4A 4IUGA 4AWEA 5E0CA 2XSAA 4U10A 2W79A 5A8GA 4LS1A 1Q5MA 4PCPA 1VCVA 3RYSA 2EJ1A 2WNZA 3NDZA 4EWJA 1NH6A 5AC7A 2XIMA 3UG4A 2JE8A 3CUJA 3VZZA 1P6CA 3QLLA 3VFCA 3HZ3A 1TZZA 1BSLA 4GI4A 2B7OA 4CD6A 1HVXA 2P8BA 5GJNA 2TPSA 3VIHA 2FFCA 4XSMA 3TKFA 1LL6A 7TIMA 4E5TA 3M6YA 3PSWA 6XIAA 1PHWA 1OGSA 5I3FA 4DPPA 2OOGA 4M24A 1OX4B 2DSUA 2BS9A 2ZC1A 3UGRA 4GQ0A 4JTEA 3SDOA 2VURA 3UESA 1U83A 5C5YA 3K4DA 2PDMA 4NYUA 4OHQA 2IMRA 1HW6A 2QV5A 3R0KA 2F1AA 4LQ1A 1A0CA 5BMWA 4PUEA 1E1FA 1OVDA 3MQTA 4N2YA 3OZYA 1TYGA 3CAVA 1WKYA 3TV8A 1DJZA 4AX7A 5C0QA 3ARWA 3CWNA 1QI0A 1PTGA 2GOUA 1UA7A 2FMNA 3KRZA 4YTQA 1GPWA 1ZP3A 2GGJA 4XISA 5I00A 1S3TC 1EX5A 2WHMA 4DXKA 5HQLA 4CNTA 5FF4A 4WDUA 1V77A 4PL2A 1VJZA 4GJIA 1X39A 4HNCA 3WN6A 4Q4MA 1JG9A 2Y61A 3SCNA 5KZEA 1E56A 2Z2BA 2VT0A 5HJLA 2BXZA 4G6QA 4EZPA 1R9XA 4JNMA 1KXHA 3HG4A 4AZCA 1EPXA 1QJWA 4XIAA 5A6BD 3DX3A 5D2WA 4ZCWA 3PAOA 4L6OA 1R3TA 1IZJA 3C0JA 3ZT7A 5E0KA 3HQNA 3CL6A 2IKIA 4YVPA 1MNZA 4C6LA 4DWSB 3W6MA 1JCJA 3QN3A 2YDRA 4UR7A 2BASA 2HEJA 3VX1A 3W86A 3CUIA 1XKYA 2BY2A 4IG2B 3ARRA 4GQBA 2FYMA 4E81A 4B2DA 1Y5XA 5C70A 2PDNA 3QKZA 1EFZA 4IFKA 1JCMP 3B9EA 1K03A 4HCLA 2CU0A 3BW2A 4FF5A 5TNVA 1GTHA 2E4TA 1YTKA 4IGMA 1V0LA 3G77A 3ZWSA 4ATLA 1UB3A 2OTDA 1QRQA 4LH8A 2WAGA 2ZTJA 5K4ZA 2J9XA 3VDBA 4F8XA 2YPIA 3CV6A 4MB3A 3IS4A 2VFIA 3MMTA 1QHOA 2QFFA 2JEPA 1GVSA 1JAKA 2NZLA 4MB1A 3BQ6A 1KM6A 3IWPA 2X1UA 3WNLA 3SSJA 4WVXA 2C0AA 4IQJA 4DEFA 3ZJ6A 2ACRA 3HPXA 5EA9A 2D4CA 1IE7C 2H8ZA 1DL3A 4H3DA 1NWUA 3C7NA 5D30A 4PGLA 2JEQA 2PWFA 4B9YA 2NQHA 5EFFA 2C0HA 3I4EA 3T47A 2QUTA 5HUPA 4MJZA 2OOFA 1QPRA 2YL9A 2CESA 4I8DA 5CBBA 4UOQA 2D23A 5AC5A 4M3PA 2IXUA 2FTYA 4LY4A 4W93A 4IX0A 3LCWA 4FB7A 1SZGA 2Z2UA 2WVVA 5D4YA 1RQBA 3A13A 2HPMA 3VVGA 5TF0A 3MI2A 1ADOA 3FA3A 3UNTA 4O17A 4LT9A 4M56A 3G1SA 5C8BB 4XKMA 3CIVA 2V8ZA 3RLVA 1VFSA 2YBUA 3W6LA 4UUIA 1SFLA 1XIFA 4C7GA 3CQ0A 3HAJA 3PG8A 4KWWA 4W4QA 1IHIA 1FCVA 2GUBA 4PUDA 5CJNA 2NXGA 5XINA 1TIWA 1FP9A 3SUVA 4CQDA 1F9CA 4RE3A 2WKJA 3PZ9A 2HK0A 3T48A 1XLKA 2QCDB 2J7GA 3TR9A 3LUTA 2A6LA 2CLFA 1XH1A 1PDYA 3LENA 1UOKA 1TE1A 5G4HC 4JTTA 3V16A 3PB0A 3WMSA 3PZIA 3H24A 1XLIA 3DFOA 3SCUA 5FD0A 2IW0A 3BJSA 4IQEA 1CWYA 3BMVA 2H3DA 3GG8A 2PBOA 2YW3A 1JF5A 3OPSA 3C2EA 4I9MA 4MY8A 3MCNA 3TAKA 2XDFA 2GVEA 1UHVA 2ZUNA 1I2PA 3OZOA 1W3JA 5D04C 1QNVA 5G2WA 1E6QM 1FWJC 1VJSA 3OHMB 3O6CA 4NNAA 4C1LA 3LM7A 4PTXA 1XLAA 2F61A 3VINA 3G0UA 1W17A 3LNPA 2HROA 1ADDA 1FWFC 1R9ZA 3GLCA 2Z0NA 3GTFA 1DYSA 3B05A 3S9ZA 5JIWA 1UP3A 4DX3A 1HJVA 3NQ6A 4YWIA 3S2JA 1YNQA 4EZVA 2QDGA 4C91A 4I1QA 1E6SM 4O28A 1FWEC 3EJPA 4M7SA 3CIXA 5GPRA 4FZOA 1D3GA 3VILA 2OEJA 4KGJA 4OBRA 3CHDA 1BXNA 6CGTA 4ADTA 4AZ5A 1F2JA 3W7NA 3TJLA 5EMMA 3G22A 4DO5A 4JQ1A 3PS7A 5A3HA 4FF7A 2WWDA 4EOUA 2GQ3A 1BHGA 2C16A 1ZAJA 5FSEC 4QAIA 3LLDA 5DF0A 2XGZA 4QR6A 3ZR6A 1VIZA 4Q8VA 1D2KA 1JR1A 1MQQA 3E02A 4H8SA 2HSAA 4NZJA 3IJQA 2GUYA 3E2QA 1OYBA 1KFWA 1O7DB 3XINA 3QZ6A 2VZVA 2V2HA 2CLMA 2G0WA 2DFAA 3S8HA 4JYFA 3IPWA 4H7VA 1FWHC 1AZ1A 4D6EA 4ROPA 1ITCA 1US0A 2WJFA 2DSWA 1WZKA 4UXDA 3U3HA 1TZ9A 1OFDA 1WV2A 4MKVA 3POHA 3QC0A 3H22A 4EXAA 4EZYA 4JHMA 4LF2A 1XBXA 2PDXA 2YXOA 3LXAA 2Y62A 3KXQA 4UMAA 3GTXA 3L5AA 2Y2WA 4BWLC 3W1MA 4DZAA 3RU8X 4N9DA 1EA9C 4J4KA 1ZSXA 1QNQA 3W7KA 4H41A 1S2UA 5DRIA 4CCEA 2FB2A 3T55A 2PDCA 3WLOA 3LTYA 3AIBA 4J7RA 1QI2A 1KCLA 1J5SA 1MFVA 4NASA 1ZJBA 1OT2A 4W8BA 2CXEA 1O5KA 4Z08A 3SZ8A 1VRDA 3AJXA 2NX3A 2PF0A 4KWOA 5AC6A 4BKNA 3IIOA 3HAIA 3IANA 2R94A 5AHIA 2O4QA 2XH0A 3PULA 1KC7A 3ENLA 2XM1A 1NFBA 2ZZ3A 3N12A 3CV1A 3RN6A 3PK7A 2VC6A 2OLHA 1X1ZA 3L4ZA 3CQIA 4IH3A 4UQEA 4AQLA 1A5MC 2ANUA 2CLHA 3HPFA 1QK2A 3N11A 2V63A 3PPCA 1V7YA 1KCKA 2VGBA 3KHDA 3RX2A 2ZX8A 3IIXA 2WVTA 1QAPA 4UZUA 3FW6A 4J3WA 3FS2A 2Q6ZA 1LM1A 3BG5A 2G50A 2O4MA 1N82A 3HG2A 2PTYA 1K3UA 2ZC8A 5HMSA 2VGFA 1BFNA 3CASA 1OIFA 3A64A 1RQHA 3RMEA 3ITTA 2E3ZA 3NSMA 3TC3A 1FTXA 3FLUA 1NY1A 4OTKA 3IGSA 2IKHA 3PBVA 3W74A 5HOSA 4FNQA 3WDHA 2D2GA 3TLQA 4MIMA 4YTSA 4B5TA 3IUHA 4QDPA 4GFSA 4MY1A 3LGDA 1W1B1 2YZRA 3W81A 1LBMA 3Q45A 1Q6DA 1W5OA 2ZXDA 5EMUA 4NQ1A 1YX1A 4ZA0A 1KW1A 4RNIA 4JTCA 3URBA 1M68A 3UU0A 3GAKA 4GYPA 1IEVA 4E38A 3QV9A 1AA1B 3CMJA 1I49A 4H6IA 3CUFA 1FWBC 2G8ZA 5JBDA 2YDAA 3NEHA 1NWTA 4IHCA 2HPIA 2PRHA 1PPIA 2J7DA 4F0RA 1F4AA 2ZWYA 3B0XA 4XD3A 4H6HA 1VBHA 1ZALA 7ODCA 3DC0A 1J0HA 1QBBA 1WBHA 3GFZA 4FO4A 3TR2A 2GVJA 4AZ7A 4J40A 4W88A 4RR4A 4L4OA 2PZNA 5BXRA 4GUJA 1UWQA 3VOHA 4S3DA 1A5CA 2J7BA 2OLSA 1L6FA 1E3XA 2ZX7A 4IOTA 2XVGA 4MG4A 4WKAA 1XWYA 1N2VA 1NSJA 1AH0A 3EDJA 4C6NA 2ZXBA 1BAGA 4XIMA 4XZWA 1K9TA 5LNWA 4N6EA 1Q66A 2EKGA 2PC4A 2GGEA 3HTWA 2DQWA 2P5NA 1G1YA 3GUWA 2QIWA 1R85A 4UMCA 4TO8A 2IQ0A 4PTMA 4CQ8A 3VMNA 4NX0A 3HG5A 5CZKA 4CN1A 3IV3A 3BLPX 2RJGA 1XL9A 1XF0A 4R7WA 3L4XA 4A2SA 2JNKA 5AZ0A 3UZJA 4UTHA 2IPFA 3W1NA 3CAZA 1U30A 4KH2A 1RHCA 1GJWA 2CLOA 4DY1A 2WCGA 4N9EA 4P5UA 4AY8A 4A05A 4LRTA 3A47A 3B04A 5F4SA 1OM0A 3C2YA 2R9RA 3PY2A 2EFKA 2GGIA 2DT2A 2O55A 1RXOB 4M1RA 2QCCA 3A4JA 1Q2RA 5TBOA 2D0HA 5ABEA 2FH8A 2OR2A 2D24A 3L65A 1AFSA 2V2DA 1PX3A 3CPUA 1RQEA 3SN4A 1O5QA 5T9CE 3OZPA 1LUCA 2NCZA 2QJJA 4C7DA 2DU2A 1KXTA 1S5NA 1J4EA 4ONVA 1EGMA 5A69A 4H9UA 3TOPA 1XLGA 2PEVA 1P0EA 2E6FA 4DZ5A 4JNYA 5DT7A 1Z9AA 1W9MA 2YLAA 3FOKA 3C2VA 1GOKA 3BANA 1EGVA 3SQSA 2OVLA 1OCQA 2AQWA 3VK5A 1ZBKA 1W0MA 2Q71A 2WMIA 1TQSA 4A3RA 1X04A 1W9UA 1TFVA 4R27A 4PSPA 1R0MA 4CU8A 2YIVX 1WAUA 1P0BA 1J5TA 1FH9A 3O63A 2JF7A 3RAOA 3GNNA 1Z42A 3CAKA 4P7RA 2HISA 2WSRA 5F2IA 4MNKA 4DF0A 3QQWA 1Y5VA 3LXBA 1JDFA 1V3LA 3FJ4A 4KERA 3VNLA 4TUFA 1DOSA 1QT1A 4RV3A 5HULA 3APGA 4AEFA 3MT1A 1PO9A 4PSRA 4CVWA 2YL5A 4IPNB 4XSLA 1PKYA 3MUCA 3UZXA 5HMFA 3MYPA 2PLMA 1EYEA 1U1JA 5G4WA 3UZYA 3ABZA 1XSIA 2VWTA 2WMGA 3RG6A 3CM4A 1Q63A 4W89A 1QDSA 3W24A 1GJPA 1K8YA 3T07A 2Y5JA 4Y6GA 4BF9A 2OQLA 4JAWA 3IVSA 1VPXA 4OECA 4ZXOA 2HVMA 3HMJG 1O60A 3GKFA 2D1LA 2Q12A 1RK5A 1A5OC 4A8RA 2QT3A 1REQB 3E74A 4HN8A 4F2UA 1TPDA 1RJRA 4BFAA 3AXKA 3H70A 4PMRA 3W7CA 3LHZA 1HG3A 1W9DM 4ZQCA 4EX4A 4REQB 1DIEA 1ZUAX 4TIMA 4ES4A 1B57A 3M0IA 1DP0A 3GIQA 4GUHA 5REQB 3UETA 1FA2A 1V6TA 1IZKA 4NG3A 2J7HA 4JIIX 4JYDA 2ZE3A 1F6YA 3GNRA 5IRPA 1KM0A 5A6BA 3WKZA 3VPLA 3TFXA 2V69A 3GU2A 1FKWA 2Y1HA 3OIHA 5CEWA 1XFCA 3LPFA 1PWMA 4W5ZA 2X1TA 1XRTA 3BDKA 1TQJA 1DWAM 4XD6A 1XYFA 3P82A 2E8YA 3FVMA 3TTSA 1HKJA 4NAEB 4L4PA 3KOWA 1CXFA 1W3HA 3H54A 3WMBA 1QHPA 1DXFA 4LS2A 2CZFA 3TLLA 3TYBA 2PDBA 1SJAA 3EWWA 1FH7A 3RK8A 1W9XA 5DCEA 3ALGA 2Z27A 1LLZA 1WDRA 4XZ9A 3MS8A 3TYAA 5EMJA 3M5ZA 4G1KA 3VAVA 3CZLA 4HSHA 2VZTA 4WPCA 2F6XA 4HT3A 3BCJA 3IJDA 2V5LA 2CLLA 1OZMA 3L2IA 3AXMA 3UP8A 1KTNA 4UR9A 1TWSA 1ISWA 3VDAA 4YHGA 4ZE5A 3GKAA 1RA0A 1XIMA 3RIKA 4FX7A 4CD7A 1OFBA 4GWEA 1A5LC 1R5YA 1W1ZA 3STCA 4IWPA 2QCHA 2AMXA 3GBDA 1R7OA 3FK4A 3K8MA 1ONWA 2AOSA 3FDGA 3GIPA 3OBEA 4IMGA 1Y2OA 3ZR5A 4N7QA 3VKBA 1MVYA 3P8JA 1M7XA 5ABGA 1DJQA 3CHVA 4QE1A 2CZVA 2WWCA 3PTKA 4A35A 4IFOA 4WDWA 1ICPA 2YXGA 3CZEA 3QQ1A 2PE4A 1GJUA 4EWND 3L21A 1EC7A 5C55A 2BX7A 3NQFA 1A0EA 4IP4A 4C6CA 3CPGA 1EDQA 3OB8A 2D0FA 1OCBA 2F7FA 1U22A 4F0HA 3ECQA 2AL2B 3UA4A 2P8CA 3BVTA 3NQ8A 3V4BA 3PTDA 3VUPA 4Y9PA 3ARQA 2R1MA 4GMEA 3SFWA 1Y65A 3UCDA 1CYGA 1UD3A 5E9XA 1LQ2A 3UCQA 1G4TA 1P4CA 3MC5A 4P8UA 3M0KA 2AL1A 1WOAA 1WB0A 5H8PA 4RE4A 1TV3A 4H83A 4ZGYA 2QPXA 2F84A 1KKOA 1QBAA 4F2BA 3CYJA 3W01A 1SW3A 4C6IA 2DZTA 4X3ZA 4JTGA 1US2A 1SU8A 3EWCA 1S2TA 2PDGA 1WKDA 1KM5A 2D0GA 2HVNA 3V5CA 3NM3A 1C92A 4PCNA 4BCEA 5C7VA 4M81A 2X05A 3ZWTA 2JK2A 3KL3A 4MNJA 4FXSA 2ESCA 4W87A 2QCLA 4EPKA 1LT8A 2ALWA 2EWFA 3WL0A 4RLIA 4M6UA 3SEPA 4JIQA 2DY3A 1XQLA 4PZVA 5HBFA 1W8GA 3RPDA 1TQUA 5LYRA 1P48A 4EVZA 4LYKA 3KL5A 4RNFA 3QY8A 4O1AA 3RCYA 4WIWA 3H2NA 3DX0A 3FSTA 3VD9A 4LYRA 4YN5A 2VUYA 4F9JA 1GORA 2E1DA 4YVXA 1W5PA 3N9KA 4INFA 4KCUA 2V30A 4Z2KA 4F2TA 3Q67A 2WHLA 2OGJA 2QJGA 3S9IA 2CLPA 4YYCA 1HNYA 1V08A 3DX5A 3RDKA 1C8XA 2OMAA 4WPEA 1XHGA 1TX2A 4CQCA 3W07A 4GFIA 4GX9A 4IXHA 3FJLA 2BP1A 4WD0A 3ARVA 3LOTA 2AGTA 3FDKA 3LY0A 2UBPC 3GIYA 1TUXA 4K6AA 1RJPA 1A5KC 1R2SA 1CPUA 1RUSA 1AQHA 2EG6A 1BLIA 3AAMA 3T81A 2YCLA 4PRWA 2WBKA 1OIMA 3A4WA 1G6CA 2XZ7A 3VM5A 3ARPA 4LEQA 3NDYA 4ZENA 3L0NA 1S5TA 2FGLA 5E6YA 3UVAA