2NCZA

Solution nmr structures of brd4 et domain in complex with nsd3_1 peptide
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
83
structure length
83
Chain Sequence
SEEEDKCKPMSYEEKRQLSLDINKLPGEKLGRVVHIIQSREPSLKNSNPDEIEIDFETLKPSTLRELERYVTSCLRKKRKPQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bromodomain-containing protein 4
publication title Structural Mechanism of Transcriptional Regulator NSD3 Recognition by the ET Domain of BRD4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/transferase
total genus 25
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2016-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17035 BET Bromodomain extra-terminal - transcription regulation
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.220 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 2nczA01
2ND0A 2ND1A 2NCZA 2N3KA 2JNSA
chains in the Genus database with same CATH superfamily
2Q13A 4AZ5A 2WYHA 4PO2A 3QNIA 3BUBA 4EZUA 1OAOA 4JWIA 4IWPA 4JWDA 4D8JA 2YI9A 4JWEA 3BUQA 3T47A 4FZPA 4AZIA 4EZXA 3ACOA 3BVXA 4AZCB 3ER8C 4KIKA 3O3MB 3BVWA 3CZNA 3BVVA 3D2EA 2YIBA 4EZNA 2Z8YA 3O3NB 3BUIA 4DCNC 1SU8A 2X3WA 3A98A 4FZSA 4IM2A 1QWUA 5FLEX 3I04A 3M3WA 2LXYA 2F7QA 1R5EA 3QWEA 4E3CA 4HR1B 3L3PA 2F18A 4F00A 1HWWA 3DPOA 3VEBA 4AZ7A 4EZPA 3UITA 3RV0A 3VKHA 4WPEA 4WPCA 1OA1A 3I2WA 3DYTA 3D50A 4R5JA 1Y2OA 4HY9A 4IM0A 1I49A 3OK8A 1TQTA 2F7OA 3I01A 3EJUA 2OBMA 2ELBA 4H6IA 2OW7A 4EZOA 3EJRA 3FD9A 2O0I1 3OHXM 2RAIA 4M0MA 2OZNB 1HXKA 3G9GA 2GA9D 1R33A 2YL5A 4JL9A 2WYIA 3I39X 4EZZA 3B53X 1WDZA 3T49A 2Z0OA 1UPXA 4IWQA 5E84A 1ZWWA 3F7WA 2QKWA 3BLBA 3CZSA 1O7DB 3OWGA 2YLLA 4IW0A 4JN4A 4AZGA 3D51A 3CVRA 4R5IA 3EJSA 1TQWA 3LMFA 1U00A 4NSWA 3ERCC 4R5GA 2EFKA 1GNLA 1QWNA 2FYVA 3SOGA 1TQVA 4FM3A 3CKDA 4IM3A 4H8SA 4I1QA 4H6HA 3Q84A 2F7RA 1E1DA 4JWCA 4AZHA 5C5BA 4JLCA 3B52X 4G6QA 4B9QA 4E81A 1ZYLA 2JNSA 4KIKB 2NCZA 2PY6A 2Q12A 4JNEA 2D1LA 4FZOA 5TKYA 4EZSA 1I4LA 2D4CA 2F1AA 3B51X 2YKTA 4DYLA 4F01A 2F7PA 3KAVA 3SYVA 1DKXA 1SUFA 1X03A 4R5LA 4EZVA 4ATMA 2OW6A 1OA0A 3KAWA 3ABHA 3EJTA 2GF4A 2N3KA 4EZYA 2V0OA 4EZWA 4BNEA 3QA8A 4HYBA 2EWFA 2QXLA 3DDGA 3ER9B 3ZEDA 3C7NA 3DPQA 2YL6A 3RV1A 2ALWA 2KHOA 2EX3B 2YIVX 2LM0A 3DDFA 2GAFD 4EZQA 3T48A 2EFLA 5FIGA 3VEAA 2MI7A 4AZCA 1DKZA 3DPPA 2Z0NA 1TQUA 1URUA 4NPHA 2YI8A 2X3VA 3QNJA 4JNFA 4AVMA 4AKVA 2FICA 4EZRA 3HAJA 3KDRA 4AZ6A 2C08A 3BUDA 3EJQA 4AZBA 4HR1A 1SU6A 1E2UA 2YIAA 1O7DC 1QX1A 3BVUA 3DX3A 3GI7A 1I4TA 4UDXX 1E9VA 4UDYX 3PLTA 2YL8A 1DKYA 2JNKA 3BVTA 2OBLA 2Z0VA 1I4DA 1TQSA 4IWOA 3D4ZA 3O3OB 3CAZA 3EJPA 1SU7A 3DX4A 3DX1A 2X5CA 1HTYA 2RT6A 1W9MA 3T4AG 3DX0A 4R5KA 5C5BB 3RPMA 1GN9A 2X3XA 3T46A 3LVTA 2ND1A 2WINM 2YLAA 4NQIA 4EZTA 3DX2A 3BUPA 3D4YA 1MJGA 5KBPA 2ZXQA 2OO2A 1R34A 1PS3A 3D2FA 2F1BA 2ND0A 3CV5A 3HAHA 3HAIA 1GNTA 2QFFA 2RAJA 2PMRA 1LQ7A 3L3OM 2YL9A 3LLLA 3QE6A 1YWMA 3Q0KA 1X04A 3D52A 2RAKA 1JQKA
chains in the Genus database with same CATH topology
3FD9A 1SU6A 3OHXM 1E2UA 4JNEA 5TKYA 4EZSA 2YIAA 3B51X 4M0MA 4F01A 3GI7A 3KAVA 4PO2A 4UDXX 1E9VA 4EZUA 1DKXA 1OAOA 4JWIA 1SUFA 4IWPA 4UDYX 4R5LA 4JWDA 1DKYA 4EZVA 2GA9D 2OBLA 4D8JA 4IWOA 4JL9A 2YI9A 1OA0A 3O3OB 3KAWA 3I39X 4EZZA 3B53X 1SU7A 4JWEA 3T47A 3T49A 4EZXA 2N3KA 1UPXA 2X5CA 4EZYA 4IWQA 5E84A 3ER8C 2RT6A 4EZWA 3F7WA 1W9MA 4KIKA 3O3MB 3QA8A 4HYBA 2EWFA 3D2EA 3T4AG 2YIBA 4EZNA 3OWGA 2Z8YA 3O3NB 4IW0A 4JN4A 1SU8A 2QXLA 4R5KA 3A98A 1GN9A 4IM2A 3ER9B 5FLEX 3ZEDA 3I04A 4R5IA 3C7NA 3T46A 3DPQA 3LMFA 3RV1A 1U00A 2KHOA 4E3CA 3ERCC 2EX3B 4HR1B 2ND1A 2WINM 4R5GA 1GNLA 2YIVX 2LM0A 4F00A 2GAFD 4EZQA 3T48A 3DPOA 3VEBA 4EZTA 5FIGA 4FM3A 1MJGA 3VEAA 4EZPA 3UITA 3RV0A 1DKZA 3DPPA 3VKHA 4IM3A 1OA1A 3D2FA 4H6HA 2ND0A 4NPHA 4R5JA 2YI8A 1GNTA 4HY9A 4IM0A 2QFFA 1E1DA 4JWCA 3I01A 4JLCA 3B52X 4G6QA 3L3OM 2OBMA 3QNJA 4JNFA 4B9QA 4E81A 1ZYLA 4H6IA 4EZRA 2JNSA 3KDRA 4KIKB 2NCZA 4EZOA 1JQKA 4HR1A 2PY6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ND0 A;  2ND1 A;  2NCZ A;  2N3K A;  2JNS A; 
#chains in the Genus database with same CATH topology
 2Q13 A;  4AZ5 A;  2WYH A;  4PO2 A;  3QNI A;  3BUB A;  4EZU A;  1OAO A;  4JWI A;  4IWP A;  4JWD A;  4D8J A;  2YI9 A;  4JWE A;  3BUQ A;  3T47 A;  4FZP A;  4AZI A;  4EZX A;  3ACO A;  3BVX A;  4AZC B;  3ER8 C;  4KIK A;  3O3M B;  3BVW A;  3CZN A;  3BVV A;  3D2E A;  2YIB A;  4EZN A;  2Z8Y A;  3O3N B;  3BUI A;  4DCN C;  1SU8 A;  2X3W A;  3A98 A;  4FZS A;  4IM2 A;  1QWU A;  5FLE X;  3I04 A;  3M3W A;  2LXY A;  2F7Q A;  1R5E A;  3QWE A;  4E3C A;  4HR1 B;  3L3P A;  2F18 A;  4F00 A;  1HWW A;  3DPO A;  3VEB A;  4AZ7 A;  4EZP A;  3UIT A;  3RV0 A;  3VKH A;  4WPE A;  4WPC A;  1OA1 A;  3I2W A;  3DYT A;  3D50 A;  4R5J A;  1Y2O A;  4HY9 A;  4IM0 A;  1I49 A;  3OK8 A;  1TQT A;  2F7O A;  3I01 A;  3EJU A;  2OBM A;  2ELB A;  4H6I A;  2OW7 A;  4EZO A;  3EJR A;  3FD9 A;  2O0I 1;  3OHX M;  2RAI A;  4M0M A;  2OZN B;  1HXK A;  3G9G A;  2GA9 D;  1R33 A;  2YL5 A;  4JL9 A;  2WYI A;  3I39 X;  4EZZ A;  3B53 X;  1WDZ A;  3T49 A;  2Z0O A;  1UPX A;  4IWQ A;  5E84 A;  1ZWW A;  3F7W A;  2QKW A;  3BLB A;  3CZS A;  1O7D B;  3OWG A;  2YLL A;  4IW0 A;  4JN4 A;  4AZG A;  3D51 A;  3CVR A;  4R5I A;  3EJS A;  1TQW A;  3LMF A;  1U00 A;  4NSW A;  3ERC C;  4R5G A;  2EFK A;  1GNL A;  1QWN A;  2FYV A;  3SOG A;  1TQV A;  4FM3 A;  3CKD A;  4IM3 A;  4H8S A;  4I1Q A;  4H6H A;  3Q84 A;  2F7R A;  1E1D A;  4JWC A;  4AZH A;  5C5B A;  4JLC A;  3B52 X;  4G6Q A;  4B9Q A;  4E81 A;  1ZYL A;  2JNS A;  4KIK B;  2NCZ A;  2PY6 A;  2Q12 A;  4JNE A;  2D1L A;  4FZO A;  5TKY A;  4EZS A;  1I4L A;  2D4C A;  2F1A A;  3B51 X;  2YKT A;  4DYL A;  4F01 A;  2F7P A;  3KAV A;  3SYV A;  1DKX A;  1SUF A;  1X03 A;  4R5L A;  4EZV A;  4ATM A;  2OW6 A;  1OA0 A;  3KAW A;  3ABH A;  3EJT A;  2GF4 A;  2N3K A;  4EZY A;  2V0O A;  4EZW A;  4BNE A;  3QA8 A;  4HYB A;  2EWF A;  2QXL A;  3DDG A;  3ER9 B;  3ZED A;  3C7N A;  3DPQ A;  2YL6 A;  3RV1 A;  2ALW A;  2KHO A;  2EX3 B;  2YIV X;  2LM0 A;  3DDF A;  2GAF D;  4EZQ A;  3T48 A;  2EFL A;  5FIG A;  3VEA A;  2MI7 A;  4AZC A;  1DKZ A;  3DPP A;  2Z0N A;  1TQU A;  1URU A;  4NPH A;  2YI8 A;  2X3V A;  3QNJ A;  4JNF A;  4AVM A;  4AKV A;  2FIC A;  4EZR A;  3HAJ A;  3KDR A;  4AZ6 A;  2C08 A;  3BUD A;  3EJQ A;  4AZB A;  4HR1 A;  1SU6 A;  1E2U A;  2YIA A;  1O7D C;  1QX1 A;  3BVU A;  3DX3 A;  3GI7 A;  1I4T A;  4UDX X;  1E9V A;  4UDY X;  3PLT A;  2YL8 A;  1DKY A;  2JNK A;  3BVT A;  2OBL A;  2Z0V A;  1I4D A;  1TQS A;  4IWO A;  3D4Z A;  3O3O B;  3CAZ A;  3EJP A;  1SU7 A;  3DX4 A;  3DX1 A;  2X5C A;  1HTY A;  2RT6 A;  1W9M A;  3T4A G;  3DX0 A;  4R5K A;  5C5B B;  3RPM A;  1GN9 A;  2X3X A;  3T46 A;  3LVT A;  2ND1 A;  2WIN M;  2YLA A;  4NQI A;  4EZT A;  3DX2 A;  3BUP A;  3D4Y A;  1MJG A;  5KBP A;  2ZXQ A;  2OO2 A;  1R34 A;  1PS3 A;  3D2F A;  2F1B A;  2ND0 A;  3CV5 A;  3HAH A;  3HAI A;  1GNT A;  2QFF A;  2RAJ A;  2PMR A;  1LQ7 A;  3L3O M;  2YL9 A;  3LLL A;  3QE6 A;  1YWM A;  3Q0K A;  1X04 A;  3D52 A;  2RAK A;  1JQK A; 
#chains in the Genus database with same CATH homology
 3FD9 A;  1SU6 A;  3OHX M;  1E2U A;  4JNE A;  5TKY A;  4EZS A;  2YIA A;  3B51 X;  4M0M A;  4F01 A;  3GI7 A;  3KAV A;  4PO2 A;  4UDX X;  1E9V A;  4EZU A;  1DKX A;  1OAO A;  4JWI A;  1SUF A;  4IWP A;  4UDY X;  4R5L A;  4JWD A;  1DKY A;  4EZV A;  2GA9 D;  2OBL A;  4D8J A;  4IWO A;  4JL9 A;  2YI9 A;  1OA0 A;  3O3O B;  3KAW A;  3I39 X;  4EZZ A;  3B53 X;  1SU7 A;  4JWE A;  3T47 A;  3T49 A;  4EZX A;  2N3K A;  1UPX A;  2X5C A;  4EZY A;  4IWQ A;  5E84 A;  3ER8 C;  2RT6 A;  4EZW A;  3F7W A;  1W9M A;  4KIK A;  3O3M B;  3QA8 A;  4HYB A;  2EWF A;  3D2E A;  3T4A G;  2YIB A;  4EZN A;  3OWG A;  2Z8Y A;  3O3N B;  4IW0 A;  4JN4 A;  1SU8 A;  2QXL A;  4R5K A;  3A98 A;  1GN9 A;  4IM2 A;  3ER9 B;  5FLE X;  3ZED A;  3I04 A;  4R5I A;  3C7N A;  3T46 A;  3DPQ A;  3LMF A;  3RV1 A;  1U00 A;  2KHO A;  4E3C A;  3ERC C;  2EX3 B;  4HR1 B;  2ND1 A;  2WIN M;  4R5G A;  1GNL A;  2YIV X;  2LM0 A;  4F00 A;  2GAF D;  4EZQ A;  3T48 A;  3DPO A;  3VEB A;  4EZT A;  5FIG A;  4FM3 A;  1MJG A;  3VEA A;  4EZP A;  3UIT A;  3RV0 A;  1DKZ A;  3DPP A;  3VKH A;  4IM3 A;  1OA1 A;  3D2F A;  4H6H A;  2ND0 A;  4NPH A;  4R5J A;  2YI8 A;  1GNT A;  4HY9 A;  4IM0 A;  2QFF A;  1E1D A;  4JWC A;  3I01 A;  4JLC A;  3B52 X;  4G6Q A;  3L3O M;  2OBM A;  3QNJ A;  4JNF A;  4B9Q A;  4E81 A;  1ZYL A;  4H6I A;  4EZR A;  2JNS A;  3KDR A;  4KIK B;  2NCZ A;  4EZO A;  1JQK A;  4HR1 A;  2PY6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...