2NCZA

Solution nmr structures of brd4 et domain in complex with nsd3_1 peptide
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
83
structure length
83
Chain Sequence
SEEEDKCKPMSYEEKRQLSLDINKLPGEKLGRVVHIIQSREPSLKNSNPDEIEIDFETLKPSTLRELERYVTSCLRKKRKPQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/transferase
molecule keywords Bromodomain-containing protein 4
publication title Structural Mechanism of Transcriptional Regulator NSD3 Recognition by the ET Domain of BRD4.
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2016-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17035 BET Bromodomain extra-terminal - transcription regulation
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.220 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 2nczA01
2ND0A 2N3KA 2ND1A 2JNSA 2NCZA
chains in the Genus database with same CATH superfamily
4AZ7A 3VEAA 2F18A 4EZPA 1I4LA 4AZGA 3T46A 2YL8A 3DDFA 2F7PA 3G9GA 3QNJA 2ND0A 3HAJA 1OAOA 1HWWA 1QWUA 2LM0A 3D4YA 4IWQA 2GA9D 2YL5A 2RT6A 5TKYA 3CKDA 4EZOA 2QFFA 1PS3A 2Z8YA 2ZXQA 1SU8A 2F7OA 2EWFA 3KAWA 3EJRA 4EZTA 2YL9A 4B9QA 4JLCA 1TQVA 2X3WA 4JL9A 2EX3B 3I2WA 4IWPA 1HXKA 3D2EA 1R5EA 3F7WA 3L3OM 4AZIA 2OW7A 4DYLA 3KDRA 4HR1A 4AZ6A 3CVRA 1GNTA 3DX2A 4KIKA 2FICA 2EFKA 2RAIA 3FD9A 4G6QA 4EZXA 2Q13A 4IM3A 5C5BB 4JWIA 4FZOA 2JNKA 3ER9B 4EZSA 4NQIA 4H6HA 1O7DC 2F1AA 4AZCB 2YIVX 2N3KA 3BUPA 3ACOA 4D8JA 3RPMA 4IW0A 2F7RA 3DPQA 3DX1A 3ER8C 3D50A 3DDGA 4JWEA 1I4DA 1UPXA 1ZYLA 1GNLA 3D51A 1TQWA 3PLTA 3T4AG 3CZNA 4FZPA 4IM2A 3BVTA 3CAZA 1SUFA 2PY6A 3QA8A 5FLEX 3VKHA 4EZVA 2Q12A 4NSWA 4HYBA 1DKZA 3HAHA 4R5IA 5E84A 1HTYA 2EFLA 3DX3A 4BNEA 1R33A 3SYVA 3EJQA 1OA1A 3Q0KA 3O3MB 4E81A 4H8SA 4AZHA 2OZNB 1DKYA 5C5BA 2JNSA 4F00A 3HAIA 4I1QA 2ALWA 1W9MA 2RAKA 3BVUA 3EJPA 3DX4A 4FM3A 3D52A 3T48A 1E1DA 2Z0OA 3RV0A 3I01A 3EJTA 2PMRA 4EZNA 3BVWA 4AZ5A 1SU6A 4WPCA 4EZRA 1TQUA 3EJSA 4ATMA 2C08A 1QX1A 3C7NA 3ZEDA 4FZSA 1I4TA 4EZQA 2ELBA 4EZYA 3BUQA 1OA0A 3BUDA 4R5JA 4H6IA 1I49A 4HY9A 1SU7A 3QNIA 3M3WA 3OHXM 1E9VA 1TQTA 3CV5A 1YWMA 3ABHA 3QE6A 4JWCA 4NPHA 1X03A 4EZWA 2YL6A 4EZZA 3BLBA 2F7QA 3B52X 4E3CA 3BUIA 2FYVA 4R5LA 3DYTA 4UDYX 2YIBA 3VEBA 1GN9A 3RV1A 2QXLA 2OW6A 4AVMA 3T47A 2OBLA 3KAVA 1E2UA 3LLLA 4M0MA 5KBPA 3OWGA 3DPOA 4EZUA 4JN4A 2Z0VA 2GAFD 2WINM 2RAJA 3I04A 1Y2OA 2NCZA 1X04A 4WPEA 3B53X 1URUA 3ERCC 2YLLA 1QWNA 2F1BA 1R34A 2YIAA 3O3OB 3D2FA 1O7DB 2X3VA 2LXYA 2YKTA 4JNFA 2D1LA 4R5GA 1DKXA 2V0OA 3BVXA 4AZCA 2O0I1 3BVVA 2X5CA 2MI7A 4DCNC 3T49A 2GF4A 4F01A 1TQSA 4PO2A 2YI9A 3LVTA 4IM0A 3CZSA 2YLAA 3OK8A 3B51X 2Z0NA 2WYIA 3L3PA 2X3XA 3BUBA 1ZWWA 1MJGA 2ND1A 3A98A 3EJUA 3DX0A 2WYHA 2QKWA 3O3NB 3QWEA 3SOGA 1U00A 2OBMA 4AZBA 2OO2A 4IWOA 3GI7A 2KHOA 5FIGA 4AKVA 4JNEA 3I39X 2YI8A 4UDXX 3DPPA 1JQKA 3Q84A 4JWDA 2D4CA 3UITA 4HR1B 3D4ZA 1LQ7A 1WDZA 3LMFA 4R5KA 4KIKB
chains in the Genus database with same CATH topology
4JNFA 4EZRA 4H6HA 3VEAA 2YIVX 4EZPA 4R5GA 3T46A 1DKXA 3C7NA 2N3KA 3ZEDA 4EZQA 2X5CA 4EZSA 4D8JA 3QNJA 3T49A 2ND0A 4EZYA 4F01A 1OAOA 4IW0A 3DPQA 1OA0A 3ER8C 2LM0A 4PO2A 4IWQA 4JWEA 4R5JA 2YI9A 2GA9D 1UPXA 4H6IA 4HY9A 1ZYLA 1GNLA 1SU7A 2RT6A 4IM0A 3OHXM 3T4AG 1E9VA 5TKYA 4EZOA 3B51X 4IM2A 2QFFA 2Z8YA 1SU8A 1SUFA 2PY6A 3QA8A 2EWFA 5FLEX 4JWCA 3KAWA 3VKHA 4NPHA 4EZWA 4EZZA 4EZVA 4HYBA 1DKZA 4R5IA 4EZTA 4B9QA 3B52X 4JLCA 4E3CA 4JL9A 5E84A 2EX3B 4IWPA 3D2EA 4R5LA 1MJGA 4UDYX 3F7WA 3L3OM 2YIBA 3VEBA 1GN9A 3RV1A 2QXLA 2ND1A 1OA1A 3A98A 3O3NB 3O3MB 1U00A 2OBMA 4E81A 4IWOA 3GI7A 1DKYA 3T47A 2OBLA 2JNSA 3KAVA 4F00A 3KDRA 2KHOA 4HR1A 1E2UA 4M0MA 3OWGA 1W9MA 3DPOA 4EZUA 4JN4A 5FIGA 1GNTA 4KIKA 2GAFD 4JNEA 3I39X 2WINM 2YI8A 4UDXX 4FM3A 3I04A 3T48A 1E1DA 2NCZA 3RV0A 3FD9A 3DPPA 4G6QA 4EZXA 1JQKA 3B53X 3I01A 4IM3A 4JWDA 3ERCC 4EZNA 4JWIA 2YIAA 3UITA 4HR1B 3O3OB 3D2FA 3ER9B 1SU6A 4R5KA 3LMFA 4KIKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ND0 A;  2N3K A;  2ND1 A;  2JNS A;  2NCZ A; 
#chains in the Genus database with same CATH topology
 4AZ7 A;  3VEA A;  2F18 A;  4EZP A;  1I4L A;  4AZG A;  3T46 A;  2YL8 A;  3DDF A;  2F7P A;  3G9G A;  3QNJ A;  2ND0 A;  3HAJ A;  1OAO A;  1HWW A;  1QWU A;  2LM0 A;  3D4Y A;  4IWQ A;  2GA9 D;  2YL5 A;  2RT6 A;  5TKY A;  3CKD A;  4EZO A;  2QFF A;  1PS3 A;  2Z8Y A;  2ZXQ A;  1SU8 A;  2F7O A;  2EWF A;  3KAW A;  3EJR A;  4EZT A;  2YL9 A;  4B9Q A;  4JLC A;  1TQV A;  2X3W A;  4JL9 A;  2EX3 B;  3I2W A;  4IWP A;  1HXK A;  3D2E A;  1R5E A;  3F7W A;  3L3O M;  4AZI A;  2OW7 A;  4DYL A;  3KDR A;  4HR1 A;  4AZ6 A;  3CVR A;  1GNT A;  3DX2 A;  4KIK A;  2FIC A;  2EFK A;  2RAI A;  3FD9 A;  4G6Q A;  4EZX A;  2Q13 A;  4IM3 A;  5C5B B;  4JWI A;  4FZO A;  2JNK A;  3ER9 B;  4EZS A;  4NQI A;  4H6H A;  1O7D C;  2F1A A;  4AZC B;  2YIV X;  2N3K A;  3BUP A;  3ACO A;  4D8J A;  3RPM A;  4IW0 A;  2F7R A;  3DPQ A;  3DX1 A;  3ER8 C;  3D50 A;  3DDG A;  4JWE A;  1I4D A;  1UPX A;  1ZYL A;  1GNL A;  3D51 A;  1TQW A;  3PLT A;  3T4A G;  3CZN A;  4FZP A;  4IM2 A;  3BVT A;  3CAZ A;  1SUF A;  2PY6 A;  3QA8 A;  5FLE X;  3VKH A;  4EZV A;  2Q12 A;  4NSW A;  4HYB A;  1DKZ A;  3HAH A;  4R5I A;  5E84 A;  1HTY A;  2EFL A;  3DX3 A;  4BNE A;  1R33 A;  3SYV A;  3EJQ A;  1OA1 A;  3Q0K A;  3O3M B;  4E81 A;  4H8S A;  4AZH A;  2OZN B;  1DKY A;  5C5B A;  2JNS A;  4F00 A;  3HAI A;  4I1Q A;  2ALW A;  1W9M A;  2RAK A;  3BVU A;  3EJP A;  3DX4 A;  4FM3 A;  3D52 A;  3T48 A;  1E1D A;  2Z0O A;  3RV0 A;  3I01 A;  3EJT A;  2PMR A;  4EZN A;  3BVW A;  4AZ5 A;  1SU6 A;  4WPC A;  4EZR A;  1TQU A;  3EJS A;  4ATM A;  2C08 A;  1QX1 A;  3C7N A;  3ZED A;  4FZS A;  1I4T A;  4EZQ A;  2ELB A;  4EZY A;  3BUQ A;  1OA0 A;  3BUD A;  4R5J A;  4H6I A;  1I49 A;  4HY9 A;  1SU7 A;  3QNI A;  3M3W A;  3OHX M;  1E9V A;  1TQT A;  3CV5 A;  1YWM A;  3ABH A;  3QE6 A;  4JWC A;  4NPH A;  1X03 A;  4EZW A;  2YL6 A;  4EZZ A;  3BLB A;  2F7Q A;  3B52 X;  4E3C A;  3BUI A;  2FYV A;  4R5L A;  3DYT A;  4UDY X;  2YIB A;  3VEB A;  1GN9 A;  3RV1 A;  2QXL A;  2OW6 A;  4AVM A;  3T47 A;  2OBL A;  3KAV A;  1E2U A;  3LLL A;  4M0M A;  5KBP A;  3OWG A;  3DPO A;  4EZU A;  4JN4 A;  2Z0V A;  2GAF D;  2WIN M;  2RAJ A;  3I04 A;  1Y2O A;  2NCZ A;  1X04 A;  4WPE A;  3B53 X;  1URU A;  3ERC C;  2YLL A;  1QWN A;  2F1B A;  1R34 A;  2YIA A;  3O3O B;  3D2F A;  1O7D B;  2X3V A;  2LXY A;  2YKT A;  4JNF A;  2D1L A;  4R5G A;  1DKX A;  2V0O A;  3BVX A;  4AZC A;  2O0I 1;  3BVV A;  2X5C A;  2MI7 A;  4DCN C;  3T49 A;  2GF4 A;  4F01 A;  1TQS A;  4PO2 A;  2YI9 A;  3LVT A;  4IM0 A;  3CZS A;  2YLA A;  3OK8 A;  3B51 X;  2Z0N A;  2WYI A;  3L3P A;  2X3X A;  3BUB A;  1ZWW A;  1MJG A;  2ND1 A;  3A98 A;  3EJU A;  3DX0 A;  2WYH A;  2QKW A;  3O3N B;  3QWE A;  3SOG A;  1U00 A;  2OBM A;  4AZB A;  2OO2 A;  4IWO A;  3GI7 A;  2KHO A;  5FIG A;  4AKV A;  4JNE A;  3I39 X;  2YI8 A;  4UDX X;  3DPP A;  1JQK A;  3Q84 A;  4JWD A;  2D4C A;  3UIT A;  4HR1 B;  3D4Z A;  1LQ7 A;  1WDZ A;  3LMF A;  4R5K A;  4KIK B; 
#chains in the Genus database with same CATH homology
 4JNF A;  4EZR A;  4H6H A;  3VEA A;  2YIV X;  4EZP A;  4R5G A;  3T46 A;  1DKX A;  3C7N A;  2N3K A;  3ZED A;  4EZQ A;  2X5C A;  4EZS A;  4D8J A;  3QNJ A;  3T49 A;  2ND0 A;  4EZY A;  4F01 A;  1OAO A;  4IW0 A;  3DPQ A;  1OA0 A;  3ER8 C;  2LM0 A;  4PO2 A;  4IWQ A;  4JWE A;  4R5J A;  2YI9 A;  2GA9 D;  1UPX A;  4H6I A;  4HY9 A;  1ZYL A;  1GNL A;  1SU7 A;  2RT6 A;  4IM0 A;  3OHX M;  3T4A G;  1E9V A;  5TKY A;  4EZO A;  3B51 X;  4IM2 A;  2QFF A;  2Z8Y A;  1SU8 A;  1SUF A;  2PY6 A;  3QA8 A;  2EWF A;  5FLE X;  4JWC A;  3KAW A;  3VKH A;  4NPH A;  4EZW A;  4EZZ A;  4EZV A;  4HYB A;  1DKZ A;  4R5I A;  4EZT A;  4B9Q A;  3B52 X;  4JLC A;  4E3C A;  4JL9 A;  5E84 A;  2EX3 B;  4IWP A;  3D2E A;  4R5L A;  1MJG A;  4UDY X;  3F7W A;  3L3O M;  2YIB A;  3VEB A;  1GN9 A;  3RV1 A;  2QXL A;  2ND1 A;  1OA1 A;  3A98 A;  3O3N B;  3O3M B;  1U00 A;  2OBM A;  4E81 A;  4IWO A;  3GI7 A;  1DKY A;  3T47 A;  2OBL A;  2JNS A;  3KAV A;  4F00 A;  3KDR A;  2KHO A;  4HR1 A;  1E2U A;  4M0M A;  3OWG A;  1W9M A;  3DPO A;  4EZU A;  4JN4 A;  5FIG A;  1GNT A;  4KIK A;  2GAF D;  4JNE A;  3I39 X;  2WIN M;  2YI8 A;  4UDX X;  4FM3 A;  3I04 A;  3T48 A;  1E1D A;  2NCZ A;  3RV0 A;  3FD9 A;  3DPP A;  4G6Q A;  4EZX A;  1JQK A;  3B53 X;  3I01 A;  4IM3 A;  4JWD A;  3ERC C;  4EZN A;  4JWI A;  2YIA A;  3UIT A;  4HR1 B;  3O3O B;  3D2F A;  3ER9 B;  1SU6 A;  4R5K A;  3LMF A;  4KIK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...