4H6IA

Crystal structure of staphylococcal complement inhibitor scin-b
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
77
structure length
77
Chain Sequence
ESQFHDKRIAEELRTLLNKSNVYALAAGSLNPYYKRTIMMNEYRAKAALKKNDFVSMADAKVALEKIYKEIDEIINR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrinogen-binding protein
publication title A Structurally Dynamic N-terminal Helix Is a Key Functional Determinant in Staphylococcal Complement Inhibitor (SCIN) Proteins.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Immune system
total genus 25
structure length 77
sequence length 77
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-09-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4h6iA00
4EZQA 4EZTA 4JN4A 2KHOA 4F01A 2WINM 4B9QA 4EZNA 4EZWA 3OHXM 4JWEA 4EZRA 3T46A 1DKZA 3DPQA 2QXLA 5TKYA 3T48A 4R5GA 4EZOA 4JWCA 1U00A 4H6IA 4HYBA 4EZVA 3C7NA 4PO2A 3L3OM 4JNFA 4EZYA 4EZPA 3T47A 4H6HA 4EZSA 4EZUA 2QFFA 4JNEA 4R5JA 4F00A 3DPPA 3D2FA 1DKXA 1DKYA 4JWDA 3DPOA 4EZZA 3T4AG 4R5IA 4EZXA 5E84A 3D2EA 4R5LA 4HY9A 3QNJA 4R5KA 4JWIA 4E81A 3T49A
chains in the Genus database with same CATH superfamily
2Q12A 3T46A 3DYTA 4R5GA 2O0I1 1HWWA 4AZCA 2RAKA 2GA9D 3OK8A 4R5JA 3Q84A 2YKTA 2YL9A 4DCNC 2Z0NA 1QX1A 2YIAA 1UPXA 3LMFA 3OHXM 5KBPA 3BUDA 4H8SA 2YIVX 4KIKB 3L3OM 2GAFD 3DDGA 3EJPA 4EZYA 3HAJA 3VKHA 3D2FA 4EZZA 3T4AG 4AZCB 4AZIA 3L3PA 4IWQA 4NPHA 4R5LA 4R5KA 4HR1B 1R34A 4JWIA 3QA8A 2X3WA 4F01A 2QXLA 4DYLA 3B53X 1SUFA 3M3WA 3I2WA 3BVWA 1ZWWA 3QNJA 1X03A 4NQIA 3D50A 4WPEA 1E1DA 3QWEA 3LLLA 2F7RA 3T48A 2QKWA 2ELBA 1I4LA 2WYIA 3DDFA 4NSWA 1E9VA 2RT6A 2EFLA 4EZUA 4JNEA 1E2UA 4FM3A 3EJQA 2Z0OA 1GN9A 3D51A 1TQWA 3CZNA 1OA1A 3OWGA 4JWCA 4EZVA 3CAZA 4PO2A 3BLBA 1ZYLA 1PS3A 4ATMA 4H6HA 4EZSA 2YI9A 3DPPA 3DPOA 4AKVA 2OBLA 4HY9A 3ABHA 1DKZA 2C08A 2YI8A 2F7OA 3DX3A 1Y2OA 2QFFA 4FZPA 2D1LA 3D2EA 2WYHA 2FYVA 3KAWA 4E81A 4AZ6A 3EJUA 2NCZA 2N3KA 5FLEX 3ER9B 4JLCA 4EZNA 3DPQA 3DX1A 2X5CA 1MJGA 2ZXQA 1O7DC 4G6QA 3BVUA 3DX0A 3D4ZA 4IWPA 4M0MA 4B9QA 4EZWA 4JL9A 5TKYA 3VEAA 1GNTA 1JQKA 2F18A 2ND1A 3ACOA 3KAVA 2RAIA 2F7QA 1DKYA 4EZXA 4IM2A 4JN4A 1TQTA 4IM3A 5FIGA 3BVXA 3C7NA 4EZPA 4FZSA 5C5BA 2GF4A 2YL6A 3O3OB 4EZQA 2Q13A 4WPCA 4JWEA 3G9GA 4AZGA 2JNKA 2V0OA 3O3MB 1HTYA 2PMRA 3BUBA 3EJTA 1HXKA 1X04A 1I49A 4F00A 1O7DB 3GI7A 3O3NB 4AZ5A 3SYVA 2ND0A 2YLLA 2YL8A 1W9MA 3BVTA 3EJRA 3FD9A 4EZRA 2YLAA 3BUIA 3ER8C 4IW0A 1URUA 3CV5A 3D4YA 3F7WA 3I39X 2RAJA 2JNSA 3T49A 3ERCC 4E3CA 3RV0A 2WINM 2OZNB 1OAOA 4AZHA 1YWMA 2FICA 4HR1A 3Q0KA 3CVRA 3A98A 4UDYX 1TQSA 4IWOA 1R33A 4EZTA 3B52X 3HAIA 2Z8YA 1SU7A 3RV1A 1R5EA 1U00A 4IM0A 2YIBA 3QNIA 2D4CA 2PY6A 2X3VA 4AZ7A 2F1BA 3B51X 2F1AA 3BUPA 2KHOA 1I4DA 1QWUA 1TQUA 3HAHA 4BNEA 3BUQA 2YL5A 4I1QA 2ALWA 3CZSA 2OBMA 3T47A 2Z0VA 3UITA 1DKXA 2EWFA 2F7PA 5E84A 3DX2A 1SU8A 4EZOA 3EJSA 2OW6A 2EFKA 4AVMA 2OW7A 3LVTA 2LXYA 2EX3B 3KDRA 3QE6A 3PLTA 4JWDA 3ZEDA 2LM0A 1QWNA 3BVVA 2OO2A 4AZBA 3DX4A 3RPMA 1OA0A 3D52A 1I4TA 5C5BB 2MI7A 3CKDA 4FZOA 3VEBA 3I01A 3I04A 4D8JA 4H6IA 1WDZA 4HYBA 4UDXX 1GNLA 4JNFA 1SU6A 2X3XA 4R5IA 3SOGA 4KIKA 1TQVA 1LQ7A
chains in the Genus database with same CATH topology
4IM2A 4EZTA 4JN4A 3B52X 1OA1A 4IM3A 3T46A 5FIGA 2Z8YA 1SU7A 3OWGA 4R5GA 3RV1A 4JWCA 1U00A 4EZVA 3C7NA 4PO2A 4IM0A 2GA9D 2YIBA 1ZYLA 4EZPA 4H6HA 4EZSA 2PY6A 4R5JA 2YI9A 3DPPA 3DPOA 2OBLA 3B51X 4HY9A 3O3OB 4EZQA 2KHOA 2YIAA 1UPXA 3LMFA 3OHXM 4JWEA 1DKZA 3O3MB 2YIVX 4KIKB 2YI8A 3L3OM 2GAFD 2OBMA 4EZYA 3VKHA 3T47A 2QFFA 4F00A 3UITA 3D2FA 1DKXA 3GI7A 3O3NB 4EZZA 3T4AG 2EWFA 5E84A 3D2EA 4IWQA 4R5LA 4NPHA 3KAWA 4R5KA 4HR1B 4JWIA 4E81A 3QA8A 2ND0A 2NCZA 2N3KA 5FLEX 4F01A 3ER9B 4JLCA 1SU8A 4EZNA 1W9MA 4EZRA 3FD9A 3DPQA 2QXLA 4EZOA 3ER8C 3B53X 1SUFA 2X5CA 4IW0A 1MJGA 2EX3B 3KDRA 3F7WA 3I39X 4JWDA 3ZEDA 2LM0A 4G6QA 3QNJA 4IWPA 2JNSA 3T49A 1OA0A 3ERCC 1E1DA 4E3CA 4M0MA 3RV0A 2WINM 4B9QA 3VEBA 1OAOA 4EZWA 4JL9A 3I01A 3I04A 4D8JA 5TKYA 3T48A 3VEAA 4H6IA 4HYBA 1GNTA 1JQKA 1GNLA 4UDXX 2ND1A 4HR1A 1E9VA 4JNFA 1SU6A 2RT6A 3KAVA 4EZUA 4JNEA 1E2UA 4FM3A 3A98A 1GN9A 1DKYA 4R5IA 4EZXA 4UDYX 4KIKA 4IWOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EZQ A;  4EZT A;  4JN4 A;  2KHO A;  4F01 A;  2WIN M;  4B9Q A;  4EZN A;  4EZW A;  3OHX M;  4JWE A;  4EZR A;  3T46 A;  1DKZ A;  3DPQ A;  2QXL A;  5TKY A;  3T48 A;  4R5G A;  4EZO A;  4JWC A;  1U00 A;  4H6I A;  4HYB A;  4EZV A;  3C7N A;  4PO2 A;  3L3O M;  4JNF A;  4EZY A;  4EZP A;  3T47 A;  4H6H A;  4EZS A;  4EZU A;  2QFF A;  4JNE A;  4R5J A;  4F00 A;  3DPP A;  3D2F A;  1DKX A;  1DKY A;  4JWD A;  3DPO A;  4EZZ A;  3T4A G;  4R5I A;  4EZX A;  5E84 A;  3D2E A;  4R5L A;  4HY9 A;  3QNJ A;  4R5K A;  4JWI A;  4E81 A;  3T49 A; 
#chains in the Genus database with same CATH topology
 2Q12 A;  3T46 A;  3DYT A;  4R5G A;  2O0I 1;  1HWW A;  4AZC A;  2RAK A;  2GA9 D;  3OK8 A;  4R5J A;  3Q84 A;  2YKT A;  2YL9 A;  4DCN C;  2Z0N A;  1QX1 A;  2YIA A;  1UPX A;  3LMF A;  3OHX M;  5KBP A;  3BUD A;  4H8S A;  2YIV X;  4KIK B;  3L3O M;  2GAF D;  3DDG A;  3EJP A;  4EZY A;  3HAJ A;  3VKH A;  3D2F A;  4EZZ A;  3T4A G;  4AZC B;  4AZI A;  3L3P A;  4IWQ A;  4NPH A;  4R5L A;  4R5K A;  4HR1 B;  1R34 A;  4JWI A;  3QA8 A;  2X3W A;  4F01 A;  2QXL A;  4DYL A;  3B53 X;  1SUF A;  3M3W A;  3I2W A;  3BVW A;  1ZWW A;  3QNJ A;  1X03 A;  4NQI A;  3D50 A;  4WPE A;  1E1D A;  3QWE A;  3LLL A;  2F7R A;  3T48 A;  2QKW A;  2ELB A;  1I4L A;  2WYI A;  3DDF A;  4NSW A;  1E9V A;  2RT6 A;  2EFL A;  4EZU A;  4JNE A;  1E2U A;  4FM3 A;  3EJQ A;  2Z0O A;  1GN9 A;  3D51 A;  1TQW A;  3CZN A;  1OA1 A;  3OWG A;  4JWC A;  4EZV A;  3CAZ A;  4PO2 A;  3BLB A;  1ZYL A;  1PS3 A;  4ATM A;  4H6H A;  4EZS A;  2YI9 A;  3DPP A;  3DPO A;  4AKV A;  2OBL A;  4HY9 A;  3ABH A;  1DKZ A;  2C08 A;  2YI8 A;  2F7O A;  3DX3 A;  1Y2O A;  2QFF A;  4FZP A;  2D1L A;  3D2E A;  2WYH A;  2FYV A;  3KAW A;  4E81 A;  4AZ6 A;  3EJU A;  2NCZ A;  2N3K A;  5FLE X;  3ER9 B;  4JLC A;  4EZN A;  3DPQ A;  3DX1 A;  2X5C A;  1MJG A;  2ZXQ A;  1O7D C;  4G6Q A;  3BVU A;  3DX0 A;  3D4Z A;  4IWP A;  4M0M A;  4B9Q A;  4EZW A;  4JL9 A;  5TKY A;  3VEA A;  1GNT A;  1JQK A;  2F18 A;  2ND1 A;  3ACO A;  3KAV A;  2RAI A;  2F7Q A;  1DKY A;  4EZX A;  4IM2 A;  4JN4 A;  1TQT A;  4IM3 A;  5FIG A;  3BVX A;  3C7N A;  4EZP A;  4FZS A;  5C5B A;  2GF4 A;  2YL6 A;  3O3O B;  4EZQ A;  2Q13 A;  4WPC A;  4JWE A;  3G9G A;  4AZG A;  2JNK A;  2V0O A;  3O3M B;  1HTY A;  2PMR A;  3BUB A;  3EJT A;  1HXK A;  1X04 A;  1I49 A;  4F00 A;  1O7D B;  3GI7 A;  3O3N B;  4AZ5 A;  3SYV A;  2ND0 A;  2YLL A;  2YL8 A;  1W9M A;  3BVT A;  3EJR A;  3FD9 A;  4EZR A;  2YLA A;  3BUI A;  3ER8 C;  4IW0 A;  1URU A;  3CV5 A;  3D4Y A;  3F7W A;  3I39 X;  2RAJ A;  2JNS A;  3T49 A;  3ERC C;  4E3C A;  3RV0 A;  2WIN M;  2OZN B;  1OAO A;  4AZH A;  1YWM A;  2FIC A;  4HR1 A;  3Q0K A;  3CVR A;  3A98 A;  4UDY X;  1TQS A;  4IWO A;  1R33 A;  4EZT A;  3B52 X;  3HAI A;  2Z8Y A;  1SU7 A;  3RV1 A;  1R5E A;  1U00 A;  4IM0 A;  2YIB A;  3QNI A;  2D4C A;  2PY6 A;  2X3V A;  4AZ7 A;  2F1B A;  3B51 X;  2F1A A;  3BUP A;  2KHO A;  1I4D A;  1QWU A;  1TQU A;  3HAH A;  4BNE A;  3BUQ A;  2YL5 A;  4I1Q A;  2ALW A;  3CZS A;  2OBM A;  3T47 A;  2Z0V A;  3UIT A;  1DKX A;  2EWF A;  2F7P A;  5E84 A;  3DX2 A;  1SU8 A;  4EZO A;  3EJS A;  2OW6 A;  2EFK A;  4AVM A;  2OW7 A;  3LVT A;  2LXY A;  2EX3 B;  3KDR A;  3QE6 A;  3PLT A;  4JWD A;  3ZED A;  2LM0 A;  1QWN A;  3BVV A;  2OO2 A;  4AZB A;  3DX4 A;  3RPM A;  1OA0 A;  3D52 A;  1I4T A;  5C5B B;  2MI7 A;  3CKD A;  4FZO A;  3VEB A;  3I01 A;  3I04 A;  4D8J A;  4H6I A;  1WDZ A;  4HYB A;  4UDX X;  1GNL A;  4JNF A;  1SU6 A;  2X3X A;  4R5I A;  3SOG A;  4KIK A;  1TQV A;  1LQ7 A; 
#chains in the Genus database with same CATH homology
 4IM2 A;  4EZT A;  4JN4 A;  3B52 X;  1OA1 A;  4IM3 A;  3T46 A;  5FIG A;  2Z8Y A;  1SU7 A;  3OWG A;  4R5G A;  3RV1 A;  4JWC A;  1U00 A;  4EZV A;  3C7N A;  4PO2 A;  4IM0 A;  2GA9 D;  2YIB A;  1ZYL A;  4EZP A;  4H6H A;  4EZS A;  2PY6 A;  4R5J A;  2YI9 A;  3DPP A;  3DPO A;  2OBL A;  3B51 X;  4HY9 A;  3O3O B;  4EZQ A;  2KHO A;  2YIA A;  1UPX A;  3LMF A;  3OHX M;  4JWE A;  1DKZ A;  3O3M B;  2YIV X;  4KIK B;  2YI8 A;  3L3O M;  2GAF D;  2OBM A;  4EZY A;  3VKH A;  3T47 A;  2QFF A;  4F00 A;  3UIT A;  3D2F A;  1DKX A;  3GI7 A;  3O3N B;  4EZZ A;  3T4A G;  2EWF A;  5E84 A;  3D2E A;  4IWQ A;  4R5L A;  4NPH A;  3KAW A;  4R5K A;  4HR1 B;  4JWI A;  4E81 A;  3QA8 A;  2ND0 A;  2NCZ A;  2N3K A;  5FLE X;  4F01 A;  3ER9 B;  4JLC A;  1SU8 A;  4EZN A;  1W9M A;  4EZR A;  3FD9 A;  3DPQ A;  2QXL A;  4EZO A;  3ER8 C;  3B53 X;  1SUF A;  2X5C A;  4IW0 A;  1MJG A;  2EX3 B;  3KDR A;  3F7W A;  3I39 X;  4JWD A;  3ZED A;  2LM0 A;  4G6Q A;  3QNJ A;  4IWP A;  2JNS A;  3T49 A;  1OA0 A;  3ERC C;  1E1D A;  4E3C A;  4M0M A;  3RV0 A;  2WIN M;  4B9Q A;  3VEB A;  1OAO A;  4EZW A;  4JL9 A;  3I01 A;  3I04 A;  4D8J A;  5TKY A;  3T48 A;  3VEA A;  4H6I A;  4HYB A;  1GNT A;  1JQK A;  1GNL A;  4UDX X;  2ND1 A;  4HR1 A;  1E9V A;  4JNF A;  1SU6 A;  2RT6 A;  3KAV A;  4EZU A;  4JNE A;  1E2U A;  4FM3 A;  3A98 A;  1GN9 A;  1DKY A;  4R5I A;  4EZX A;  4UDY X;  4KIK A;  4IWO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...