4H6IA

Crystal structure of staphylococcal complement inhibitor scin-b
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
77
structure length
77
Chain Sequence
ESQFHDKRIAEELRTLLNKSNVYALAAGSLNPYYKRTIMMNEYRAKAALKKNDFVSMADAKVALEKIYKEIDEIINR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrinogen-binding protein
publication title A Structurally Dynamic N-terminal Helix Is a Key Functional Determinant in Staphylococcal Complement Inhibitor (SCIN) Proteins.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Immune system
total genus 25
structure length 77
sequence length 77
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-09-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4h6iA00
2QXLA 3T48A 4HY9A 4E81A 4EZRA 1DKYA 3DPQA 1U00A 4EZPA 3D2FA 4EZZA 4JWIA 4R5LA 3T49A 4HYBA 5E84A 4EZWA 4EZOA 4EZXA 4EZUA 4F00A 3DPPA 4B9QA 1DKXA 4JWEA 3QNJA 4EZYA 4JNFA 3C7NA 4H6IA 3L3OM 4EZQA 4R5IA 2KHOA 3T4AG 4EZSA 4JWDA 3T46A 4EZNA 4H6HA 4JN4A 4R5JA 4R5GA 2WINM 4EZTA 1DKZA 2QFFA 4JNEA 4F01A 5TKYA 3DPOA 4R5KA 4PO2A 4EZVA 3OHXM 3D2EA 4JWCA 3T47A
chains in the Genus database with same CATH superfamily
2OBLA 2YKTA 3EJQA 1E1DA 3BUQA 4IM3A 3OWGA 2JNSA 1SU7A 3F7WA 3HAJA 3SYVA 3QE6A 2ELBA 4EZYA 2GAFD 2YI9A 1I4TA 1X04A 3QA8A 1DKYA 5FLEX 1PS3A 3VEBA 3I01A 4IWQA 3VKHA 1DKXA 1TQVA 4WPEA 2F7OA 4R5IA 2N3KA 3DYTA 2C08A 2LXYA 3GI7A 1GN9A 1R5EA 1E2UA 3CZNA 4D8JA 4HR1B 3BVVA 3T47A 1GNLA 3DDFA 3KDRA 3ABHA 5E84A 2YIBA 5C5BB 4EZUA 3QNJA 4KIKB 1I4LA 4FZPA 2GF4A 4I1QA 1OAOA 3DX4A 1R34A 3DPOA 3VEAA 3HAIA 4EZVA 3OHXM 3D2EA 3T48A 2F1AA 3PLTA 2LM0A 4AZCB 4JL9A 2WYHA 3DX1A 3BUPA 3DPPA 4AZ6A 2EFKA 2JNKA 3T4AG 4JWDA 3CKDA 3LLLA 3RPMA 3DX3A 4PO2A 1O7DB 1I4DA 2RAIA 3EJTA 3BVTA 1SUFA 1QWUA 3CV5A 1TQWA 4E3CA 2YLLA 3EJUA 1ZYLA 4JLCA 3LVTA 2YI8A 1JQKA 1HXKA 4AZGA 1HWWA 3D2FA 4AKVA 3BVUA 4JWIA 4R5LA 3T49A 2QKWA 2X3WA 3ZEDA 3ACOA 2OZNB 2YL9A 2KHOA 2WYIA 4UDYX 4EZNA 2F7PA 4BNEA 3DDGA 4H8SA 2YIVX 4R5JA 4ATMA 3KAWA 3M3WA 2OBMA 1TQTA 3Q84A 1QWNA 3BVWA 3BLBA 4AZBA 1ZWWA 1OA1A 4JWEA 1MJGA 2D4CA 2D1LA 4R5GA 1X03A 2ZXQA 1DKZA 1QX1A 4NSWA 3KAVA 3I39X 4FZSA 4EZZA 3O3MB 4IM0A 1E9VA 3A98A 1Y2OA 3D51A 3D50A 2X5CA 4EZQA 2Z0NA 4JN4A 2X3VA 2RT6A 2EFLA 2PMRA 4HY9A 2F7RA 1R33A 2GA9D 3HAHA 4EZOA 3BUDA 3I2WA 4F00A 2ALWA 3CAZA 3DX2A 4AZIA 3QNIA 3L3OM 4EZSA 3B53X 3D4ZA 3I04A 1I49A 3D52A 3EJRA 3QWEA 1U00A 1UPXA 2EWFA 4AZHA 2Z0VA 2YL8A 3EJPA 4JNFA 3BVXA 2F1BA 1OA0A 3FD9A 1SU6A 3ERCC 4EZTA 4F01A 4R5KA 3RV0A 3L3PA 4AZ7A 2NCZA 3RV1A 4EZRA 4NPHA 3DX0A 2YIAA 2OW7A 5FIGA 3ER9B 1HTYA 4H6IA 3CVRA 4IWPA 1SU8A 5TKYA 2RAKA 4G6QA 2YL5A 4EZWA 2X3XA 2OW6A 4UDXX 3UITA 2V0OA 3SOGA 1WDZA 2MI7A 4JWCA 2OO2A 2QXLA 4HR1A 4E81A 2EX3B 4IW0A 1O7DC 2O0I1 5KBPA 2FYVA 2YLAA 4B9QA 5C5BA 3O3NB 4IWOA 3B52X 3BUIA 4KIKA 3G9GA 4FM3A 2Q13A 4DCNC 2YL6A 3ER8C 1YWMA 3DPQA 2Q12A 4EZPA 4NQIA 4HYBA 1TQUA 4M0MA 4AZCA 3CZSA 3OK8A 3O3OB 4AVMA 3C7NA 1W9MA 3T46A 2PY6A 4FZOA 2QFFA 2ND0A 1TQSA 2F18A 3D4YA 2Z8YA 3LMFA 3EJSA 3B51X 2RAJA 1LQ7A 2FICA 3BUBA 4IM2A 4EZXA 1URUA 3Q0KA 4AZ5A 2F7QA 4WPCA 4H6HA 4DYLA 2WINM 1GNTA 4JNEA 2Z0OA 2ND1A
chains in the Genus database with same CATH topology
2QXLA 4HR1A 2OBLA 4HY9A 4E81A 2EX3B 1E1DA 4IM3A 4IW0A 2GA9D 3OWGA 2JNSA 1SUFA 1SU7A 4EZOA 4F00A 3F7WA 4B9QA 4E3CA 4EZYA 3O3NB 3L3OM 4IWOA 1ZYLA 4JLCA 2GAFD 3B52X 4KIKA 4EZSA 2YI9A 3B53X 4FM3A 3I04A 3QA8A 3ER8C 2YI8A 1JQKA 1DKYA 5FLEX 3DPQA 1U00A 3VEBA 3I01A 1UPXA 4EZPA 3D2FA 4JWIA 4R5LA 3T49A 4HYBA 4IWQA 2EWFA 4M0MA 3VKHA 1DKXA 3O3OB 3ZEDA 4JNFA 3C7NA 4R5IA 1W9MA 2KHOA 2N3KA 4UDYX 3T46A 4EZNA 4R5JA 2YIVX 3GI7A 1OA0A 2PY6A 1GN9A 1SU6A 3FD9A 4EZTA 3ERCC 2QFFA 4F01A 2ND0A 1E2UA 3KAWA 4R5KA 3RV0A 4D8JA 2OBMA 4HR1B 3T47A 2Z8YA 2NCZA 3RV1A 4EZRA 1GNLA 3LMFA 4NPHA 2YIAA 3KDRA 5E84A 2YIBA 4EZUA 3B51X 1OA1A 5FIGA 4JWEA 1MJGA 3QNJA 3ER9B 4H6IA 4KIKB 4IWPA 4R5GA 1OAOA 1DKZA 1SU8A 5TKYA 3DPOA 3VEAA 4EZVA 3OHXM 3D2EA 4IM2A 3T48A 3KAVA 4G6QA 2LM0A 3I39X 4EZZA 3O3MB 4EZWA 4IM0A 1E9VA 3A98A 4JL9A 4EZXA 3DPPA 2X5CA 4EZQA 4UDXX 3T4AG 3UITA 4JWDA 4H6HA 4JN4A 2WINM 1GNTA 4JNEA 4PO2A 2ND1A 2RT6A 4JWCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QXL A;  3T48 A;  4HY9 A;  4E81 A;  4EZR A;  1DKY A;  3DPQ A;  1U00 A;  4EZP A;  3D2F A;  4EZZ A;  4JWI A;  4R5L A;  3T49 A;  4HYB A;  5E84 A;  4EZW A;  4EZO A;  4EZX A;  4EZU A;  4F00 A;  3DPP A;  4B9Q A;  1DKX A;  4JWE A;  3QNJ A;  4EZY A;  4JNF A;  3C7N A;  4H6I A;  3L3O M;  4EZQ A;  4R5I A;  2KHO A;  3T4A G;  4EZS A;  4JWD A;  3T46 A;  4EZN A;  4H6H A;  4JN4 A;  4R5J A;  4R5G A;  2WIN M;  4EZT A;  1DKZ A;  2QFF A;  4JNE A;  4F01 A;  5TKY A;  3DPO A;  4R5K A;  4PO2 A;  4EZV A;  3OHX M;  3D2E A;  4JWC A;  3T47 A; 
#chains in the Genus database with same CATH topology
 2OBL A;  2YKT A;  3EJQ A;  1E1D A;  3BUQ A;  4IM3 A;  3OWG A;  2JNS A;  1SU7 A;  3F7W A;  3HAJ A;  3SYV A;  3QE6 A;  2ELB A;  4EZY A;  2GAF D;  2YI9 A;  1I4T A;  1X04 A;  3QA8 A;  1DKY A;  5FLE X;  1PS3 A;  3VEB A;  3I01 A;  4IWQ A;  3VKH A;  1DKX A;  1TQV A;  4WPE A;  2F7O A;  4R5I A;  2N3K A;  3DYT A;  2C08 A;  2LXY A;  3GI7 A;  1GN9 A;  1R5E A;  1E2U A;  3CZN A;  4D8J A;  4HR1 B;  3BVV A;  3T47 A;  1GNL A;  3DDF A;  3KDR A;  3ABH A;  5E84 A;  2YIB A;  5C5B B;  4EZU A;  3QNJ A;  4KIK B;  1I4L A;  4FZP A;  2GF4 A;  4I1Q A;  1OAO A;  3DX4 A;  1R34 A;  3DPO A;  3VEA A;  3HAI A;  4EZV A;  3OHX M;  3D2E A;  3T48 A;  2F1A A;  3PLT A;  2LM0 A;  4AZC B;  4JL9 A;  2WYH A;  3DX1 A;  3BUP A;  3DPP A;  4AZ6 A;  2EFK A;  2JNK A;  3T4A G;  4JWD A;  3CKD A;  3LLL A;  3RPM A;  3DX3 A;  4PO2 A;  1O7D B;  1I4D A;  2RAI A;  3EJT A;  3BVT A;  1SUF A;  1QWU A;  3CV5 A;  1TQW A;  4E3C A;  2YLL A;  3EJU A;  1ZYL A;  4JLC A;  3LVT A;  2YI8 A;  1JQK A;  1HXK A;  4AZG A;  1HWW A;  3D2F A;  4AKV A;  3BVU A;  4JWI A;  4R5L A;  3T49 A;  2QKW A;  2X3W A;  3ZED A;  3ACO A;  2OZN B;  2YL9 A;  2KHO A;  2WYI A;  4UDY X;  4EZN A;  2F7P A;  4BNE A;  3DDG A;  4H8S A;  2YIV X;  4R5J A;  4ATM A;  3KAW A;  3M3W A;  2OBM A;  1TQT A;  3Q84 A;  1QWN A;  3BVW A;  3BLB A;  4AZB A;  1ZWW A;  1OA1 A;  4JWE A;  1MJG A;  2D4C A;  2D1L A;  4R5G A;  1X03 A;  2ZXQ A;  1DKZ A;  1QX1 A;  4NSW A;  3KAV A;  3I39 X;  4FZS A;  4EZZ A;  3O3M B;  4IM0 A;  1E9V A;  3A98 A;  1Y2O A;  3D51 A;  3D50 A;  2X5C A;  4EZQ A;  2Z0N A;  4JN4 A;  2X3V A;  2RT6 A;  2EFL A;  2PMR A;  4HY9 A;  2F7R A;  1R33 A;  2GA9 D;  3HAH A;  4EZO A;  3BUD A;  3I2W A;  4F00 A;  2ALW A;  3CAZ A;  3DX2 A;  4AZI A;  3QNI A;  3L3O M;  4EZS A;  3B53 X;  3D4Z A;  3I04 A;  1I49 A;  3D52 A;  3EJR A;  3QWE A;  1U00 A;  1UPX A;  2EWF A;  4AZH A;  2Z0V A;  2YL8 A;  3EJP A;  4JNF A;  3BVX A;  2F1B A;  1OA0 A;  3FD9 A;  1SU6 A;  3ERC C;  4EZT A;  4F01 A;  4R5K A;  3RV0 A;  3L3P A;  4AZ7 A;  2NCZ A;  3RV1 A;  4EZR A;  4NPH A;  3DX0 A;  2YIA A;  2OW7 A;  5FIG A;  3ER9 B;  1HTY A;  4H6I A;  3CVR A;  4IWP A;  1SU8 A;  5TKY A;  2RAK A;  4G6Q A;  2YL5 A;  4EZW A;  2X3X A;  2OW6 A;  4UDX X;  3UIT A;  2V0O A;  3SOG A;  1WDZ A;  2MI7 A;  4JWC A;  2OO2 A;  2QXL A;  4HR1 A;  4E81 A;  2EX3 B;  4IW0 A;  1O7D C;  2O0I 1;  5KBP A;  2FYV A;  2YLA A;  4B9Q A;  5C5B A;  3O3N B;  4IWO A;  3B52 X;  3BUI A;  4KIK A;  3G9G A;  4FM3 A;  2Q13 A;  4DCN C;  2YL6 A;  3ER8 C;  1YWM A;  3DPQ A;  2Q12 A;  4EZP A;  4NQI A;  4HYB A;  1TQU A;  4M0M A;  4AZC A;  3CZS A;  3OK8 A;  3O3O B;  4AVM A;  3C7N A;  1W9M A;  3T46 A;  2PY6 A;  4FZO A;  2QFF A;  2ND0 A;  1TQS A;  2F18 A;  3D4Y A;  2Z8Y A;  3LMF A;  3EJS A;  3B51 X;  2RAJ A;  1LQ7 A;  2FIC A;  3BUB A;  4IM2 A;  4EZX A;  1URU A;  3Q0K A;  4AZ5 A;  2F7Q A;  4WPC A;  4H6H A;  4DYL A;  2WIN M;  1GNT A;  4JNE A;  2Z0O A;  2ND1 A; 
#chains in the Genus database with same CATH homology
 2QXL A;  4HR1 A;  2OBL A;  4HY9 A;  4E81 A;  2EX3 B;  1E1D A;  4IM3 A;  4IW0 A;  2GA9 D;  3OWG A;  2JNS A;  1SUF A;  1SU7 A;  4EZO A;  4F00 A;  3F7W A;  4B9Q A;  4E3C A;  4EZY A;  3O3N B;  3L3O M;  4IWO A;  1ZYL A;  4JLC A;  2GAF D;  3B52 X;  4KIK A;  4EZS A;  2YI9 A;  3B53 X;  4FM3 A;  3I04 A;  3QA8 A;  3ER8 C;  2YI8 A;  1JQK A;  1DKY A;  5FLE X;  3DPQ A;  1U00 A;  3VEB A;  3I01 A;  1UPX A;  4EZP A;  3D2F A;  4JWI A;  4R5L A;  3T49 A;  4HYB A;  4IWQ A;  2EWF A;  4M0M A;  3VKH A;  1DKX A;  3O3O B;  3ZED A;  4JNF A;  3C7N A;  4R5I A;  1W9M A;  2KHO A;  2N3K A;  4UDY X;  3T46 A;  4EZN A;  4R5J A;  2YIV X;  3GI7 A;  1OA0 A;  2PY6 A;  1GN9 A;  1SU6 A;  3FD9 A;  4EZT A;  3ERC C;  2QFF A;  4F01 A;  2ND0 A;  1E2U A;  3KAW A;  4R5K A;  3RV0 A;  4D8J A;  2OBM A;  4HR1 B;  3T47 A;  2Z8Y A;  2NCZ A;  3RV1 A;  4EZR A;  1GNL A;  3LMF A;  4NPH A;  2YIA A;  3KDR A;  5E84 A;  2YIB A;  4EZU A;  3B51 X;  1OA1 A;  5FIG A;  4JWE A;  1MJG A;  3QNJ A;  3ER9 B;  4H6I A;  4KIK B;  4IWP A;  4R5G A;  1OAO A;  1DKZ A;  1SU8 A;  5TKY A;  3DPO A;  3VEA A;  4EZV A;  3OHX M;  3D2E A;  4IM2 A;  3T48 A;  3KAV A;  4G6Q A;  2LM0 A;  3I39 X;  4EZZ A;  3O3M B;  4EZW A;  4IM0 A;  1E9V A;  3A98 A;  4JL9 A;  4EZX A;  3DPP A;  2X5C A;  4EZQ A;  4UDX X;  3T4A G;  3UIT A;  4JWD A;  4H6H A;  4JN4 A;  2WIN M;  1GNT A;  4JNE A;  4PO2 A;  2ND1 A;  2RT6 A;  4JWC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...