4H6IA

Crystal structure of staphylococcal complement inhibitor scin-b
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
77
structure length
77
Chain Sequence
ESQFHDKRIAEELRTLLNKSNVYALAAGSLNPYYKRTIMMNEYRAKAALKKNDFVSMADAKVALEKIYKEIDEIINR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fibrinogen-binding protein
publication title A Structurally Dynamic N-terminal Helix Is a Key Functional Determinant in Staphylococcal Complement Inhibitor (SCIN) Proteins.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 25
structure length 77
sequence length 77
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-09-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 4h6iA00
4H6IA 4R5JA 3T46A 1U00A 1DKYA 3D2EA 4EZWA 4HY9A 4EZSA 4EZXA 3OHXM 4EZUA 2KHOA 4JN4A 4R5IA 2WINM 4JWDA 3T48A 4B9QA 4EZNA 4PO2A 4JNFA 4JNEA 4R5GA 5E84A 4R5LA 1DKZA 4H6HA 4HYBA 4JWCA 3T4AG 4EZTA 3DPOA 3DPQA 3D2FA 3DPPA 5TKYA 4EZPA 3L3OM 4EZQA 2QXLA 1DKXA 4EZYA 4R5KA 4EZRA 4F00A 4JWIA 4E81A 3T47A 4EZVA 4F01A 4EZZA 4EZOA 4JWEA 3T49A 2QFFA 3QNJA 3C7NA
chains in the Genus database with same CATH superfamily
1OA1A 3T48A 3L3PA 2F18A 2YI9A 4IM2A 4EZTA 3VEAA 3CZSA 3CZNA 1SU8A 3I04A 4JWEA 4FM3A 1QX1A 3CKDA 3HAIA 2FYVA 4JL9A 1Y2OA 4KIKB 3BVXA 2YL5A 1OA0A 4AZCA 2RAIA 4WPEA 3G9GA 3KAWA 4EZYA 1TQVA 3BVWA 3I39X 1HWWA 2F7RA 4UDYX 3BUDA 1WDZA 4R5GA 1JQKA 1DKZA 2ZXQA 3T4AG 4BNEA 1GN9A 2WYIA 4AZCB 4EZZA 3EJTA 2OZNB 2YIVX 4IWOA 1R33A 2ELBA 2Z0VA 3BLBA 3BUQA 2Z0NA 3B51X 2RAKA 5KBPA 2ALWA 3ABHA 1TQUA 3T46A 3EJRA 2RAJA 3B53X 3DX3A 2KHOA 4JWDA 3ER9B 2GAFD 4AZBA 1TQWA 4JNEA 3I2WA 1QWUA 3EJUA 4UDXX 2Z8YA 2C08A 2EWFA 1DKXA 3A98A 3VKHA 3DX2A 4H8SA 1I4LA 3DDFA 3O3OB 2Z0OA 3QE6A 4EZXA 1QWNA 4R5IA 4DYLA 2MI7A 4IW0A 2EFLA 3KAVA 4H6HA 2YL8A 3D2FA 1GNTA 2YKTA 3DPPA 5TKYA 2F1BA 1PS3A 2Q12A 1TQSA 4E81A 4AZGA 4H6IA 2D4CA 1SU6A 3GI7A 2X3XA 1E9VA 5C5BB 1TQTA 3DX0A 3F7WA 3D4ZA 3SYVA 3QWEA 2OW7A 3DPQA 2OO2A 4EZQA 4EZOA 4HR1A 2QFFA 3LVTA 4EZWA 4EZSA 1I4DA 4EZUA 2FICA 4E3CA 3CVRA 1GNLA 5E84A 3HAJA 3DDGA 4FZPA 2O0I1 3L3OM 2PY6A 1HXKA 1OAOA 3D51A 3I01A 2N3KA 3DX1A 3EJSA 2GA9D 4PO2A 2ND0A 3CV5A 4HR1B 3M3WA 1E1DA 1X04A 4AKVA 3O3MB 3ACOA 1I4TA 2D1LA 4IM0A 1R5EA 3VEBA 1I49A 1UPXA 4AZ7A 3CAZA 4IWQA 2Q13A 3RV0A 3ZEDA 3QNIA 4DCNC 4WPCA 2X5CA 3DX4A 4JLCA 3D50A 1E2UA 3LLLA 5FLEX 5C5BA 2YIBA 3C7NA 4AZ5A 1U00A 1ZWWA 2JNKA 2F1AA 4FZSA 2X3WA 3HAHA 3EJPA 2QXLA 4IM3A 3T47A 1R34A 3OHXM 2LM0A 2WINM 4EZNA 4B9QA 2F7PA 3QA8A 3BVVA 3BVTA 2EFKA 3EJQA 3ERCC 1LQ7A 2LXYA 2RT6A 2GF4A 1YWMA 3OK8A 1O7DC 2YLAA 3UITA 2ND1A 3BVUA 4NPHA 2YI8A 3QNJA 2QKWA 5FIGA 3D2EA 4AVMA 4AZIA 4JN4A 2OBLA 1SUFA 4JWCA 2YIAA 4EZPA 4M0MA 4R5KA 4EZRA 3RPMA 4EZVA 4F01A 3Q84A 3T49A 4D8JA 1DKYA 4HY9A 3PLTA 4I1QA 2EX3B 4FZOA 2YL6A 3DPOA 2OW6A 4AZ6A 1MJGA 4JWIA 3RV1A 3O3NB 1URUA 3Q0KA 4R5JA 2WYHA 4IWPA 4HYBA 1HTYA 2PMRA 2X3VA 3BUIA 2JNSA 4G6QA 3SOGA 3ER8C 3BUPA 2F7OA 3BUBA 2V0OA 3B52X 1X03A 1ZYLA 4ATMA 2YLLA 4JNFA 1O7DB 3KDRA 2YL9A 4R5LA 3D4YA 2OBMA 3OWGA 4KIKA 2F7QA 2NCZA 3D52A 4F00A 4AZHA 4NQIA 4NSWA 1SU7A 3FD9A 3DYTA 1W9MA 3LMFA
chains in the Genus database with same CATH topology
3I01A 1OA1A 3T46A 2N3KA 5FIGA 3D2EA 3B53X 2KHOA 4JN4A 4JWDA 2GA9D 3T48A 4PO2A 2GAFD 3ER9B 2ND0A 4JNEA 2OBLA 1SUFA 4HR1B 4JWCA 1E1DA 2YI9A 4UDXX 3O3MB 2YIAA 4IM2A 4EZTA 3VEAA 2Z8YA 4EZPA 4IM0A 2EWFA 1DKXA 3A98A 3VKHA 1SU8A 3I04A 4M0MA 4R5KA 4EZRA 3VEBA 1UPXA 4EZVA 4F01A 4IWQA 4JWEA 4FM3A 3T49A 3RV0A 4D8JA 3O3OB 4JL9A 3ZEDA 1DKYA 4HY9A 4EZXA 4KIKB 2X5CA 4R5IA 4JLCA 1OA0A 2EX3B 1W9MA 4IW0A 3KAVA 4H6HA 3DPOA 3D2FA 1GNTA 3DPPA 5TKYA 3KAWA 1E2UA 5FLEX 4EZYA 1MJGA 4JWIA 3RV1A 4E81A 2YIBA 3O3NB 3I39X 3C7NA 4H6IA 4R5JA 1SU6A 1U00A 3GI7A 4UDYX 1E9VA 3F7WA 4R5GA 1JQKA 1DKZA 4IWPA 4HYBA 3T4AG 3DPQA 1GN9A 2JNSA 4EZQA 4G6QA 2QXLA 4IM3A 3ER8C 3T47A 4EZZA 4EZOA 4HR1A 2QFFA 3B52X 4EZWA 4EZSA 1ZYLA 2YIVX 4IWOA 3OHXM 4EZUA 2LM0A 2WINM 4EZNA 4B9QA 4E3CA 4JNFA 3KDRA 3QA8A 1GNLA 5E84A 4R5LA 2OBMA 3B51X 3ERCC 2RT6A 3OWGA 3L3OM 4KIKA 2PY6A 2NCZA 3UITA 4F00A 2ND1A 4NPHA 1OAOA 1SU7A 2YI8A 3FD9A 3QNJA 3LMFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H6I A;  4R5J A;  3T46 A;  1U00 A;  1DKY A;  3D2E A;  4EZW A;  4HY9 A;  4EZS A;  4EZX A;  3OHX M;  4EZU A;  2KHO A;  4JN4 A;  4R5I A;  2WIN M;  4JWD A;  3T48 A;  4B9Q A;  4EZN A;  4PO2 A;  4JNF A;  4JNE A;  4R5G A;  5E84 A;  4R5L A;  1DKZ A;  4H6H A;  4HYB A;  4JWC A;  3T4A G;  4EZT A;  3DPO A;  3DPQ A;  3D2F A;  3DPP A;  5TKY A;  4EZP A;  3L3O M;  4EZQ A;  2QXL A;  1DKX A;  4EZY A;  4R5K A;  4EZR A;  4F00 A;  4JWI A;  4E81 A;  3T47 A;  4EZV A;  4F01 A;  4EZZ A;  4EZO A;  4JWE A;  3T49 A;  2QFF A;  3QNJ A;  3C7N A; 
#chains in the Genus database with same CATH topology
 1OA1 A;  3T48 A;  3L3P A;  2F18 A;  2YI9 A;  4IM2 A;  4EZT A;  3VEA A;  3CZS A;  3CZN A;  1SU8 A;  3I04 A;  4JWE A;  4FM3 A;  1QX1 A;  3CKD A;  3HAI A;  2FYV A;  4JL9 A;  1Y2O A;  4KIK B;  3BVX A;  2YL5 A;  1OA0 A;  4AZC A;  2RAI A;  4WPE A;  3G9G A;  3KAW A;  4EZY A;  1TQV A;  3BVW A;  3I39 X;  1HWW A;  2F7R A;  4UDY X;  3BUD A;  1WDZ A;  4R5G A;  1JQK A;  1DKZ A;  2ZXQ A;  3T4A G;  4BNE A;  1GN9 A;  2WYI A;  4AZC B;  4EZZ A;  3EJT A;  2OZN B;  2YIV X;  4IWO A;  1R33 A;  2ELB A;  2Z0V A;  3BLB A;  3BUQ A;  2Z0N A;  3B51 X;  2RAK A;  5KBP A;  2ALW A;  3ABH A;  1TQU A;  3T46 A;  3EJR A;  2RAJ A;  3B53 X;  3DX3 A;  2KHO A;  4JWD A;  3ER9 B;  2GAF D;  4AZB A;  1TQW A;  4JNE A;  3I2W A;  1QWU A;  3EJU A;  4UDX X;  2Z8Y A;  2C08 A;  2EWF A;  1DKX A;  3A98 A;  3VKH A;  3DX2 A;  4H8S A;  1I4L A;  3DDF A;  3O3O B;  2Z0O A;  3QE6 A;  4EZX A;  1QWN A;  4R5I A;  4DYL A;  2MI7 A;  4IW0 A;  2EFL A;  3KAV A;  4H6H A;  2YL8 A;  3D2F A;  1GNT A;  2YKT A;  3DPP A;  5TKY A;  2F1B A;  1PS3 A;  2Q12 A;  1TQS A;  4E81 A;  4AZG A;  4H6I A;  2D4C A;  1SU6 A;  3GI7 A;  2X3X A;  1E9V A;  5C5B B;  1TQT A;  3DX0 A;  3F7W A;  3D4Z A;  3SYV A;  3QWE A;  2OW7 A;  3DPQ A;  2OO2 A;  4EZQ A;  4EZO A;  4HR1 A;  2QFF A;  3LVT A;  4EZW A;  4EZS A;  1I4D A;  4EZU A;  2FIC A;  4E3C A;  3CVR A;  1GNL A;  5E84 A;  3HAJ A;  3DDG A;  4FZP A;  2O0I 1;  3L3O M;  2PY6 A;  1HXK A;  1OAO A;  3D51 A;  3I01 A;  2N3K A;  3DX1 A;  3EJS A;  2GA9 D;  4PO2 A;  2ND0 A;  3CV5 A;  4HR1 B;  3M3W A;  1E1D A;  1X04 A;  4AKV A;  3O3M B;  3ACO A;  1I4T A;  2D1L A;  4IM0 A;  1R5E A;  3VEB A;  1I49 A;  1UPX A;  4AZ7 A;  3CAZ A;  4IWQ A;  2Q13 A;  3RV0 A;  3ZED A;  3QNI A;  4DCN C;  4WPC A;  2X5C A;  3DX4 A;  4JLC A;  3D50 A;  1E2U A;  3LLL A;  5FLE X;  5C5B A;  2YIB A;  3C7N A;  4AZ5 A;  1U00 A;  1ZWW A;  2JNK A;  2F1A A;  4FZS A;  2X3W A;  3HAH A;  3EJP A;  2QXL A;  4IM3 A;  3T47 A;  1R34 A;  3OHX M;  2LM0 A;  2WIN M;  4EZN A;  4B9Q A;  2F7P A;  3QA8 A;  3BVV A;  3BVT A;  2EFK A;  3EJQ A;  3ERC C;  1LQ7 A;  2LXY A;  2RT6 A;  2GF4 A;  1YWM A;  3OK8 A;  1O7D C;  2YLA A;  3UIT A;  2ND1 A;  3BVU A;  4NPH A;  2YI8 A;  3QNJ A;  2QKW A;  5FIG A;  3D2E A;  4AVM A;  4AZI A;  4JN4 A;  2OBL A;  1SUF A;  4JWC A;  2YIA A;  4EZP A;  4M0M A;  4R5K A;  4EZR A;  3RPM A;  4EZV A;  4F01 A;  3Q84 A;  3T49 A;  4D8J A;  1DKY A;  4HY9 A;  3PLT A;  4I1Q A;  2EX3 B;  4FZO A;  2YL6 A;  3DPO A;  2OW6 A;  4AZ6 A;  1MJG A;  4JWI A;  3RV1 A;  3O3N B;  1URU A;  3Q0K A;  4R5J A;  2WYH A;  4IWP A;  4HYB A;  1HTY A;  2PMR A;  2X3V A;  3BUI A;  2JNS A;  4G6Q A;  3SOG A;  3ER8 C;  3BUP A;  2F7O A;  3BUB A;  2V0O A;  3B52 X;  1X03 A;  1ZYL A;  4ATM A;  2YLL A;  4JNF A;  1O7D B;  3KDR A;  2YL9 A;  4R5L A;  3D4Y A;  2OBM A;  3OWG A;  4KIK A;  2F7Q A;  2NCZ A;  3D52 A;  4F00 A;  4AZH A;  4NQI A;  4NSW A;  1SU7 A;  3FD9 A;  3DYT A;  1W9M A;  3LMF A; 
#chains in the Genus database with same CATH homology
 3I01 A;  1OA1 A;  3T46 A;  2N3K A;  5FIG A;  3D2E A;  3B53 X;  2KHO A;  4JN4 A;  4JWD A;  2GA9 D;  3T48 A;  4PO2 A;  2GAF D;  3ER9 B;  2ND0 A;  4JNE A;  2OBL A;  1SUF A;  4HR1 B;  4JWC A;  1E1D A;  2YI9 A;  4UDX X;  3O3M B;  2YIA A;  4IM2 A;  4EZT A;  3VEA A;  2Z8Y A;  4EZP A;  4IM0 A;  2EWF A;  1DKX A;  3A98 A;  3VKH A;  1SU8 A;  3I04 A;  4M0M A;  4R5K A;  4EZR A;  3VEB A;  1UPX A;  4EZV A;  4F01 A;  4IWQ A;  4JWE A;  4FM3 A;  3T49 A;  3RV0 A;  4D8J A;  3O3O B;  4JL9 A;  3ZED A;  1DKY A;  4HY9 A;  4EZX A;  4KIK B;  2X5C A;  4R5I A;  4JLC A;  1OA0 A;  2EX3 B;  1W9M A;  4IW0 A;  3KAV A;  4H6H A;  3DPO A;  3D2F A;  1GNT A;  3DPP A;  5TKY A;  3KAW A;  1E2U A;  5FLE X;  4EZY A;  1MJG A;  4JWI A;  3RV1 A;  4E81 A;  2YIB A;  3O3N B;  3I39 X;  3C7N A;  4H6I A;  4R5J A;  1SU6 A;  1U00 A;  3GI7 A;  4UDY X;  1E9V A;  3F7W A;  4R5G A;  1JQK A;  1DKZ A;  4IWP A;  4HYB A;  3T4A G;  3DPQ A;  1GN9 A;  2JNS A;  4EZQ A;  4G6Q A;  2QXL A;  4IM3 A;  3ER8 C;  3T47 A;  4EZZ A;  4EZO A;  4HR1 A;  2QFF A;  3B52 X;  4EZW A;  4EZS A;  1ZYL A;  2YIV X;  4IWO A;  3OHX M;  4EZU A;  2LM0 A;  2WIN M;  4EZN A;  4B9Q A;  4E3C A;  4JNF A;  3KDR A;  3QA8 A;  1GNL A;  5E84 A;  4R5L A;  2OBM A;  3B51 X;  3ERC C;  2RT6 A;  3OWG A;  3L3O M;  4KIK A;  2PY6 A;  2NCZ A;  3UIT A;  4F00 A;  2ND1 A;  4NPH A;  1OAO A;  1SU7 A;  2YI8 A;  3FD9 A;  3QNJ A;  3LMF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...