1ZWWA

Crystal structure of endophilin-a1 bar domain
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
220
structure length
199
Chain Sequence
TKLDDDFKEMERKVDVTSRAVMEIMTKTIEYLQPNPASRPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMRELSEVKDSLDMEVKQNFIDPLQNLHDKDLREIQHHLKKLEGRRLDFGYKKKRQGKIPDEELRQALEKFDESKEIAESSMFNLLEMDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRLEERIRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords SH3-containing GRB2-like protein 2
publication title Crystal Structure of the Endophilin-A1 BAR Domain.
pubmed doi rcsb
source organism Mus musculus
total genus 86
structure length 199
sequence length 220
chains with identical sequence B
ec nomenclature ec 2.3.1.-:
pdb deposition date 2005-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03114 BAR BAR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 1zwwA00
4ATMA 1I49A 5C5BA 3HAIA 2Z0OA 2V0OA 2X3XA 2C08A 3HAHA 1I4TA 5C5BB 3Q84A 2EFKA 2RAJA 4WPCA 4BNEA 1I4DA 2RAKA 3M3WA 1WDZA 2Q13A 3QE6A 2FICA 4AKVA 3Q0KA 3ABHA 3HAJA 3PLTA 4DYLA 1URUA 3QWEA 3I2WA 4WPEA 2Z0VA 3CAZA 3QNIA 4H8SA 3G9GA 2X3WA 4AVMA 2RAIA 3LLLA 4FZSA 4NSWA 2D4CA 2D1LA 2ELBA 2YKTA 3DYTA 1I4LA 3SOGA 1ZWWA 4I1QA 2Z0NA 2EFLA 3OK8A 4NQIA 2X3VA 1Y2OA 2Q12A 1X04A 3ACOA 4DCNC 3SYVA 1X03A
chains in the Genus database with same CATH superfamily
4ATMA 3RV0A 4FZOA 2V0OA 1O7DB 4AZIA 4EZRA 4KIKB 4JLCA 4IWOA 2KHOA 2YL5A 3PLTA 2EWFA 4HR1A 4H8SA 4AVMA 3CZSA 1I4LA 1LQ7A 2GAFD 2ND0A 3UITA 3DPQA 2QFFA 3LVTA 4DYLA 3BUDA 1Y2OA 3DX4A 4NPHA 4DCNC 4HYBA 3HAIA 4EZNA 4WPCA 1E9VA 4R5JA 1W9MA 3HAJA 2LM0A 3B52X 3DPPA 4JNEA 3CAZA 1GN9A 3DYTA 3C7NA 4IM2A 4AZ5A 2X3VA 4PO2A 3CKDA 1X04A 1E1DA 3T47A 2YL6A 3KAWA 4EZZA 4AZCB 2FICA 4HY9A 4AKVA 4NSWA 3B51X 4NQIA 3I39X 4JNFA 2YL8A 3EJPA 4AZCA 1I4TA 3GI7A 3T49A 4EZUA 3OWGA 2Q13A 3DDFA 4EZVA 3D50A 4IWQA 4JN4A 3L3PA 2OBLA 3G9GA 4FZSA 4E81A 4R5IA 3I01A 3OK8A 4R5GA 1ZYLA 3L3OM 3ACOA 3BLBA 3HAHA 3EJQA 1OA1A 3O3OB 2F7RA 1R5EA 4JWIA 4IM3A 3Q0KA 2GA9D 3BVXA 3QNIA 3KDRA 4F01A 1YWMA 3BVVA 1TQSA 3QNJA 2RT6A 1X03A 1DKYA 4KIKA 5C5BB 3O3NB 4EZQA 3EJUA 4H6IA 3QWEA 2X3WA 3LLLA 3EJRA 1UPXA 2MI7A 2YKTA 3F7WA 3DX1A 3OHXM 2C08A 2EFKA 2X5CA 3ERCC 3RPMA 3VEAA 3M3WA 1WDZA 5FIGA 3O3MB 2YI8A 2EX3B 2O0I1 3D4ZA 2JNKA 1E2UA 3A98A 1QX1A 1I49A 4IM0A 2X3XA 4IW0A 4EZSA 4B9QA 3D51A 3EJSA 4EZWA 2EFLA 3I04A 4EZYA 4JWEA 4FZPA 1JQKA 3BVUA 3ER8C 3D2EA 1TQWA 1R33A 1URUA 2Z0VA 2JNSA 2Z0NA 4AZGA 1SUFA 4EZTA 3SYVA 3BVTA 3QA8A 2F7OA 2FYVA 1QWNA 4AZ7A 2ND1A 4UDXX 3T46A 1TQTA 2F7PA 4AZHA 1SU8A 3VEBA 2WYIA 3ER9B 4D8JA 2WYHA 3D4YA 1TQVA 4M0MA 1U00A 3DX0A 2Z0OA 1DKXA 1TQUA 3T4AG 4G6QA 1OAOA 2OBMA 3BUIA 1PS3A 3ABHA 2F7QA 2F18A 1SU6A 2RAIA 2ELBA 1SU7A 2GF4A 2OO2A 4R5LA 2WINM 2YIVX 4EZPA 2NCZA 2F1AA 5C5BA 2N3KA 3D52A 4BNEA 3CZNA 5KBPA 2LXYA 4EZXA 3BUPA 2YIBA 2OW6A 1O7DC 1MJGA 3B53X 4F00A 3LMFA 3D2FA 3CVRA 1DKZA 5E84A 1ZWWA 4FM3A 3DPOA 2F1BA 2YI9A 1R34A 3VKHA 3Q84A 2RAJA 1I4DA 4JWCA 1GNTA 4IWPA 4H6HA 4R5KA 1HWWA 4JWDA 3FD9A 3CV5A 2YLAA 2D1LA 3BVWA 3BUBA 2OZNB 4I1QA 5FLEX 4UDYX 4E3CA 1QWUA 2YLLA 2RAKA 1GNLA 3QE6A 2ZXQA 3DX2A 3KAVA 3BUQA 4AZBA 2PY6A 4WPEA 2D4CA 3SOGA 3EJTA 3DX3A 2ALWA 2YIAA 4AZ6A 1HTYA 2OW7A 5TKYA 2PMRA 3ZEDA 1OA0A 4EZOA 2Z8YA 2QXLA 2YL9A 3I2WA 1HXKA 4HR1B 3RV1A 3T48A 3DDGA 2Q12A 2QKWA 4JL9A
chains in the Genus database with same CATH topology
4ATMA 1I49A 5C5BA 3HAIA 2Z0OA 2V0OA 2X3XA 2C08A 3HAHA 1I4TA 5C5BB 3Q84A 2EFKA 2RAJA 4WPCA 4BNEA 1I4DA 2RAKA 3M3WA 1WDZA 2Q13A 3QE6A 2FICA 4AKVA 3Q0KA 3ABHA 3HAJA 3PLTA 4DYLA 1URUA 3QWEA 3I2WA 4WPEA 2Z0VA 3CAZA 3QNIA 4H8SA 3G9GA 2X3WA 4AVMA 2RAIA 3LLLA 4FZSA 4NSWA 2D4CA 2D1LA 2ELBA 2YKTA 3DYTA 1I4LA 3SOGA 1ZWWA 4I1QA 2Z0NA 2EFLA 3OK8A 4NQIA 2X3VA 1Y2OA 2Q12A 1X04A 3ACOA 4DCNC 3SYVA 1X03A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ATM A;  1I49 A;  5C5B A;  3HAI A;  2Z0O A;  2V0O A;  2X3X A;  2C08 A;  3HAH A;  1I4T A;  5C5B B;  3Q84 A;  2EFK A;  2RAJ A;  4WPC A;  4BNE A;  1I4D A;  2RAK A;  3M3W A;  1WDZ A;  2Q13 A;  3QE6 A;  2FIC A;  4AKV A;  3Q0K A;  3ABH A;  3HAJ A;  3PLT A;  4DYL A;  1URU A;  3QWE A;  3I2W A;  4WPE A;  2Z0V A;  3CAZ A;  3QNI A;  4H8S A;  3G9G A;  2X3W A;  4AVM A;  2RAI A;  3LLL A;  4FZS A;  4NSW A;  2D4C A;  2D1L A;  2ELB A;  2YKT A;  3DYT A;  1I4L A;  3SOG A;  1ZWW A;  4I1Q A;  2Z0N A;  2EFL A;  3OK8 A;  4NQI A;  2X3V A;  1Y2O A;  2Q12 A;  1X04 A;  3ACO A;  4DCN C;  3SYV A;  1X03 A; 
#chains in the Genus database with same CATH topology
 4ATM A;  3RV0 A;  4FZO A;  2V0O A;  1O7D B;  4AZI A;  4EZR A;  4KIK B;  4JLC A;  4IWO A;  2KHO A;  2YL5 A;  3PLT A;  2EWF A;  4HR1 A;  4H8S A;  4AVM A;  3CZS A;  1I4L A;  1LQ7 A;  2GAF D;  2ND0 A;  3UIT A;  3DPQ A;  2QFF A;  3LVT A;  4DYL A;  3BUD A;  1Y2O A;  3DX4 A;  4NPH A;  4DCN C;  4HYB A;  3HAI A;  4EZN A;  4WPC A;  1E9V A;  4R5J A;  1W9M A;  3HAJ A;  2LM0 A;  3B52 X;  3DPP A;  4JNE A;  3CAZ A;  1GN9 A;  3DYT A;  3C7N A;  4IM2 A;  4AZ5 A;  2X3V A;  4PO2 A;  3CKD A;  1X04 A;  1E1D A;  3T47 A;  2YL6 A;  3KAW A;  4EZZ A;  4AZC B;  2FIC A;  4HY9 A;  4AKV A;  4NSW A;  3B51 X;  4NQI A;  3I39 X;  4JNF A;  2YL8 A;  3EJP A;  4AZC A;  1I4T A;  3GI7 A;  3T49 A;  4EZU A;  3OWG A;  2Q13 A;  3DDF A;  4EZV A;  3D50 A;  4IWQ A;  4JN4 A;  3L3P A;  2OBL A;  3G9G A;  4FZS A;  4E81 A;  4R5I A;  3I01 A;  3OK8 A;  4R5G A;  1ZYL A;  3L3O M;  3ACO A;  3BLB A;  3HAH A;  3EJQ A;  1OA1 A;  3O3O B;  2F7R A;  1R5E A;  4JWI A;  4IM3 A;  3Q0K A;  2GA9 D;  3BVX A;  3QNI A;  3KDR A;  4F01 A;  1YWM A;  3BVV A;  1TQS A;  3QNJ A;  2RT6 A;  1X03 A;  1DKY A;  4KIK A;  5C5B B;  3O3N B;  4EZQ A;  3EJU A;  4H6I A;  3QWE A;  2X3W A;  3LLL A;  3EJR A;  1UPX A;  2MI7 A;  2YKT A;  3F7W A;  3DX1 A;  3OHX M;  2C08 A;  2EFK A;  2X5C A;  3ERC C;  3RPM A;  3VEA A;  3M3W A;  1WDZ A;  5FIG A;  3O3M B;  2YI8 A;  2EX3 B;  2O0I 1;  3D4Z A;  2JNK A;  1E2U A;  3A98 A;  1QX1 A;  1I49 A;  4IM0 A;  2X3X A;  4IW0 A;  4EZS A;  4B9Q A;  3D51 A;  3EJS A;  4EZW A;  2EFL A;  3I04 A;  4EZY A;  4JWE A;  4FZP A;  1JQK A;  3BVU A;  3ER8 C;  3D2E A;  1TQW A;  1R33 A;  1URU A;  2Z0V A;  2JNS A;  2Z0N A;  4AZG A;  1SUF A;  4EZT A;  3SYV A;  3BVT A;  3QA8 A;  2F7O A;  2FYV A;  1QWN A;  4AZ7 A;  2ND1 A;  4UDX X;  3T46 A;  1TQT A;  2F7P A;  4AZH A;  1SU8 A;  3VEB A;  2WYI A;  3ER9 B;  4D8J A;  2WYH A;  3D4Y A;  1TQV A;  4M0M A;  1U00 A;  3DX0 A;  2Z0O A;  1DKX A;  1TQU A;  3T4A G;  4G6Q A;  1OAO A;  2OBM A;  3BUI A;  1PS3 A;  3ABH A;  2F7Q A;  2F18 A;  1SU6 A;  2RAI A;  2ELB A;  1SU7 A;  2GF4 A;  2OO2 A;  4R5L A;  2WIN M;  2YIV X;  4EZP A;  2NCZ A;  2F1A A;  5C5B A;  2N3K A;  3D52 A;  4BNE A;  3CZN A;  5KBP A;  2LXY A;  4EZX A;  3BUP A;  2YIB A;  2OW6 A;  1O7D C;  1MJG A;  3B53 X;  4F00 A;  3LMF A;  3D2F A;  3CVR A;  1DKZ A;  5E84 A;  1ZWW A;  4FM3 A;  3DPO A;  2F1B A;  2YI9 A;  1R34 A;  3VKH A;  3Q84 A;  2RAJ A;  1I4D A;  4JWC A;  1GNT A;  4IWP A;  4H6H A;  4R5K A;  1HWW A;  4JWD A;  3FD9 A;  3CV5 A;  2YLA A;  2D1L A;  3BVW A;  3BUB A;  2OZN B;  4I1Q A;  5FLE X;  4UDY X;  4E3C A;  1QWU A;  2YLL A;  2RAK A;  1GNL A;  3QE6 A;  2ZXQ A;  3DX2 A;  3KAV A;  3BUQ A;  4AZB A;  2PY6 A;  4WPE A;  2D4C A;  3SOG A;  3EJT A;  3DX3 A;  2ALW A;  2YIA A;  4AZ6 A;  1HTY A;  2OW7 A;  5TKY A;  2PMR A;  3ZED A;  1OA0 A;  4EZO A;  2Z8Y A;  2QXL A;  2YL9 A;  3I2W A;  1HXK A;  4HR1 B;  3RV1 A;  3T48 A;  3DDG A;  2Q12 A;  2QKW A;  4JL9 A; 
#chains in the Genus database with same CATH homology
 4ATM A;  1I49 A;  5C5B A;  3HAI A;  2Z0O A;  2V0O A;  2X3X A;  2C08 A;  3HAH A;  1I4T A;  5C5B B;  3Q84 A;  2EFK A;  2RAJ A;  4WPC A;  4BNE A;  1I4D A;  2RAK A;  3M3W A;  1WDZ A;  2Q13 A;  3QE6 A;  2FIC A;  4AKV A;  3Q0K A;  3ABH A;  3HAJ A;  3PLT A;  4DYL A;  1URU A;  3QWE A;  3I2W A;  4WPE A;  2Z0V A;  3CAZ A;  3QNI A;  4H8S A;  3G9G A;  2X3W A;  4AVM A;  2RAI A;  3LLL A;  4FZS A;  4NSW A;  2D4C A;  2D1L A;  2ELB A;  2YKT A;  3DYT A;  1I4L A;  3SOG A;  1ZWW A;  4I1Q A;  2Z0N A;  2EFL A;  3OK8 A;  4NQI A;  2X3V A;  1Y2O A;  2Q12 A;  1X04 A;  3ACO A;  4DCN C;  3SYV A;  1X03 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...