2X3VA

Structure of the f-bar domain of mouse syndapin i
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
291
structure length
291
Chain Sequence
DSFWEVGNYKRTVKRIDDGHRLCNDLMSCVQERAKIEKAYAQQLTDWAKRWRQLIEKGPQYGSLERAWGAMMTEADKVSELHQEVKNSLLNEDLEKVKNWQKDAYHKQIMGGFKETKEAEDGFRKAQKPWAKKMKELEAAKKAYHLACKEERLAMTREMNSKTEQSVTPEQQKKLVDKVDKCRQDVQKTQEKYEKVLEDVGKTTPQYMEGMEQVFEQCQQFEEKRLVFLKEVLLDIKRHLNLAENSSYMHVYRELEQAIRGADAQEDLRWFRSTSGPGMPMNWPQFEEWNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN KINASE C AND CASEIN KINASE SUBSTRATE IN NEURONS PROT
publication title Molecular Basis for SH3 Domain Regulation of F-Bar-Mediated Membrane Deformation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Endocytosis
total genus 123
structure length 291
sequence length 291
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00611 FCH Fes/CIP4, and EFC/F-BAR homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 2x3vA01
1X03A 4H8SA 2ELBA 1WDZA 4BNEA 4NSWA 2RAJA 3I2WA 3HAJA 1X04A 3ACOA 3CAZA 3DYTA 4WPEA 3QE6A 4DYLA 2Q13A 2X3VA 2Z0OA 3HAHA 2X3WA 1I49A 1Y2OA 2EFKA 2Z0NA 1I4TA 3PLTA 4FZSA 2RAKA 3SOGA 3LLLA 1ZWWA 1URUA 3Q0KA 3ABHA 3SYVA 2RAIA 1I4DA 3HAIA 3G9GA 4NQIA 2Q12A 3OK8A 4AKVA 2FICA 3Q84A 4AVMA 5C5BB 5C5BA 3QNIA 3QWEA 4I1QA 3M3WA 2EFLA 4ATMA 4DCNC 2D1LA 2YKTA 4WPCA 2C08A 2V0OA 2Z0VA 2D4CA 1I4LA 2X3XA
chains in the Genus database with same CATH superfamily
2OBMA 3CVRA 3HAJA 3D4ZA 2YL9A 3B53X 2FYVA 4JNEA 3O3MB 4JWCA 2YI8A 2EWFA 2GAFD 4B9QA 3ER8C 3T48A 3LVTA 3DX2A 4WPEA 1I49A 1Y2OA 2YL6A 3VKHA 2F7RA 3T49A 3QNIA 4NPHA 1ZYLA 2EX3B 5KBPA 3BUIA 4M0MA 3QA8A 2X3WA 3O3NB 3BVUA 5TKYA 3Q84A 4R5JA 4I1QA 2WYIA 4AZHA 3M3WA 4WPCA 3RPMA 1I4LA 3EJSA 4JWIA 3OWGA 1R5EA 2YIBA 4AZ7A 4HR1B 2YL5A 4DYLA 3RV0A 3ZEDA 2RAIA 3O3OB 1E1DA 2F7PA 4JN4A 2YIAA 3T46A 4IWPA 3I04A 2F7QA 4R5IA 2C08A 3BVVA 2ELBA 2OW7A 3BUQA 3BVXA 3D52A 3OHXM 4IW0A 3CZSA 2RAKA 2YLAA 3BUPA 4NQIA 4EZPA 3BVWA 4AVMA 4EZXA 1DKYA 4AZIA 1GNTA 4AZ5A 3RV1A 3DYTA 1R33A 1HWWA 4FZPA 3ER9B 4EZZA 1OAOA 1YWMA 3B51X 3ABHA 2Q12A 1TQSA 3FD9A 3QWEA 2EFLA 4EZSA 4IM0A 4KIKB 4JWDA 4KIKA 2D4CA 3VEBA 3CAZA 1QWNA 2N3KA 2Z8YA 4HYBA 1SU6A 2FICA 5C5BB 5C5BA 3CV5A 4FZOA 2YKTA 4AZBA 2RT6A 1WDZA 2F1AA 3ACOA 3DDGA 2OW6A 4IWQA 1E9VA 1OA1A 1TQTA 4IM3A 3Q0KA 1URUA 3BVTA 2ND1A 2LM0A 1LQ7A 3HAIA 1R34A 1DKZA 1MJGA 4F00A 4EZWA 2X5CA 4D8JA 4BNEA 5E84A 3I2WA 3DPOA 3T47A 3C7NA 4HR1A 2F1BA 3PLTA 2LXYA 1I4DA 3EJPA 3DDFA 3DX4A 4UDXX 3QNJA 2WYHA 2ALWA 1JQKA 2JNSA 1I4TA 3LLLA 3D4YA 1UPXA 1PS3A 1SUFA 4R5GA 4PO2A 2F7OA 1HTYA 2OO2A 3DX3A 3QE6A 3KAWA 4NSWA 1QWUA 1X04A 3L3OM 4E3CA 2Z0OA 2ND0A 4AZGA 4EZUA 3CKDA 2YI9A 1TQWA 3EJTA 3SYVA 2NCZA 3BUDA 4AKVA 1QX1A 3KDRA 4ATMA 4DCNC 4EZQA 2V0OA 4HY9A 3EJQA 1W9MA 3BUBA 2KHOA 2YIVX 2OZNB 4E81A 3DX1A 4EZNA 2YLLA 2PMRA 1SU8A 3DPPA 2O0I1 1ZWWA 1O7DB 3CZNA 1O7DC 1E2UA 3F7WA 3ERCC 3B52X 1TQVA 2MI7A 4R5LA 2QXLA 4EZYA 4H8SA 3EJRA 4IM2A 2RAJA 4FM3A 2OBLA 4G6QA 4AZCB 4AZCA 2Q13A 3HAHA 4EZTA 3EJUA 1OA0A 4JNFA 2WINM 1SU7A 2PY6A 1DKXA 4JWEA 4UDYX 2GA9D 4EZVA 1TQUA 3I39X 5FLEX 1X03A 4JLCA 4AZ6A 2QFFA 1HXKA 2Z0NA 3D50A 1U00A 3OK8A 3BLBA 3KAVA 4H6HA 2X3XA 3A98A 2X3VA 2F18A 4FZSA 2EFKA 2JNKA 3D51A 3I01A 1GN9A 3T4AG 5FIGA 3DPQA 2Z0VA 4H6IA 2GF4A 3UITA 4EZRA 2QKWA 4IWOA 3LMFA 3L3PA 3D2FA 4EZOA 4F01A 2ZXQA 3G9GA 4R5KA 1GNLA 4JL9A 3VEAA 3DX0A 3D2EA 2D1LA 3GI7A 2YL8A 3SOGA
chains in the Genus database with same CATH topology
1X03A 4H8SA 2ELBA 1WDZA 4BNEA 4NSWA 2RAJA 3I2WA 3HAJA 1X04A 3ACOA 3CAZA 3DYTA 4WPEA 3QE6A 4DYLA 2Q13A 2X3VA 2Z0OA 3HAHA 2X3WA 1I49A 1Y2OA 2EFKA 2Z0NA 1I4TA 3PLTA 4FZSA 2RAKA 3SOGA 3LLLA 1ZWWA 1URUA 3Q0KA 3ABHA 3SYVA 2RAIA 1I4DA 3HAIA 3G9GA 4NQIA 2Q12A 3OK8A 4AKVA 2FICA 3Q84A 4AVMA 5C5BB 5C5BA 3QNIA 3QWEA 4I1QA 3M3WA 2EFLA 4ATMA 4DCNC 2D1LA 2YKTA 4WPCA 2C08A 2V0OA 2Z0VA 2D4CA 1I4LA 2X3XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X03 A;  4H8S A;  2ELB A;  1WDZ A;  4BNE A;  4NSW A;  2RAJ A;  3I2W A;  3HAJ A;  1X04 A;  3ACO A;  3CAZ A;  3DYT A;  4WPE A;  3QE6 A;  4DYL A;  2Q13 A;  2X3V A;  2Z0O A;  3HAH A;  2X3W A;  1I49 A;  1Y2O A;  2EFK A;  2Z0N A;  1I4T A;  3PLT A;  4FZS A;  2RAK A;  3SOG A;  3LLL A;  1ZWW A;  1URU A;  3Q0K A;  3ABH A;  3SYV A;  2RAI A;  1I4D A;  3HAI A;  3G9G A;  4NQI A;  2Q12 A;  3OK8 A;  4AKV A;  2FIC A;  3Q84 A;  4AVM A;  5C5B B;  5C5B A;  3QNI A;  3QWE A;  4I1Q A;  3M3W A;  2EFL A;  4ATM A;  4DCN C;  2D1L A;  2YKT A;  4WPC A;  2C08 A;  2V0O A;  2Z0V A;  2D4C A;  1I4L A;  2X3X A; 
#chains in the Genus database with same CATH topology
 2OBM A;  3CVR A;  3HAJ A;  3D4Z A;  2YL9 A;  3B53 X;  2FYV A;  4JNE A;  3O3M B;  4JWC A;  2YI8 A;  2EWF A;  2GAF D;  4B9Q A;  3ER8 C;  3T48 A;  3LVT A;  3DX2 A;  4WPE A;  1I49 A;  1Y2O A;  2YL6 A;  3VKH A;  2F7R A;  3T49 A;  3QNI A;  4NPH A;  1ZYL A;  2EX3 B;  5KBP A;  3BUI A;  4M0M A;  3QA8 A;  2X3W A;  3O3N B;  3BVU A;  5TKY A;  3Q84 A;  4R5J A;  4I1Q A;  2WYI A;  4AZH A;  3M3W A;  4WPC A;  3RPM A;  1I4L A;  3EJS A;  4JWI A;  3OWG A;  1R5E A;  2YIB A;  4AZ7 A;  4HR1 B;  2YL5 A;  4DYL A;  3RV0 A;  3ZED A;  2RAI A;  3O3O B;  1E1D A;  2F7P A;  4JN4 A;  2YIA A;  3T46 A;  4IWP A;  3I04 A;  2F7Q A;  4R5I A;  2C08 A;  3BVV A;  2ELB A;  2OW7 A;  3BUQ A;  3BVX A;  3D52 A;  3OHX M;  4IW0 A;  3CZS A;  2RAK A;  2YLA A;  3BUP A;  4NQI A;  4EZP A;  3BVW A;  4AVM A;  4EZX A;  1DKY A;  4AZI A;  1GNT A;  4AZ5 A;  3RV1 A;  3DYT A;  1R33 A;  1HWW A;  4FZP A;  3ER9 B;  4EZZ A;  1OAO A;  1YWM A;  3B51 X;  3ABH A;  2Q12 A;  1TQS A;  3FD9 A;  3QWE A;  2EFL A;  4EZS A;  4IM0 A;  4KIK B;  4JWD A;  4KIK A;  2D4C A;  3VEB A;  3CAZ A;  1QWN A;  2N3K A;  2Z8Y A;  4HYB A;  1SU6 A;  2FIC A;  5C5B B;  5C5B A;  3CV5 A;  4FZO A;  2YKT A;  4AZB A;  2RT6 A;  1WDZ A;  2F1A A;  3ACO A;  3DDG A;  2OW6 A;  4IWQ A;  1E9V A;  1OA1 A;  1TQT A;  4IM3 A;  3Q0K A;  1URU A;  3BVT A;  2ND1 A;  2LM0 A;  1LQ7 A;  3HAI A;  1R34 A;  1DKZ A;  1MJG A;  4F00 A;  4EZW A;  2X5C A;  4D8J A;  4BNE A;  5E84 A;  3I2W A;  3DPO A;  3T47 A;  3C7N A;  4HR1 A;  2F1B A;  3PLT A;  2LXY A;  1I4D A;  3EJP A;  3DDF A;  3DX4 A;  4UDX X;  3QNJ A;  2WYH A;  2ALW A;  1JQK A;  2JNS A;  1I4T A;  3LLL A;  3D4Y A;  1UPX A;  1PS3 A;  1SUF A;  4R5G A;  4PO2 A;  2F7O A;  1HTY A;  2OO2 A;  3DX3 A;  3QE6 A;  3KAW A;  4NSW A;  1QWU A;  1X04 A;  3L3O M;  4E3C A;  2Z0O A;  2ND0 A;  4AZG A;  4EZU A;  3CKD A;  2YI9 A;  1TQW A;  3EJT A;  3SYV A;  2NCZ A;  3BUD A;  4AKV A;  1QX1 A;  3KDR A;  4ATM A;  4DCN C;  4EZQ A;  2V0O A;  4HY9 A;  3EJQ A;  1W9M A;  3BUB A;  2KHO A;  2YIV X;  2OZN B;  4E81 A;  3DX1 A;  4EZN A;  2YLL A;  2PMR A;  1SU8 A;  3DPP A;  2O0I 1;  1ZWW A;  1O7D B;  3CZN A;  1O7D C;  1E2U A;  3F7W A;  3ERC C;  3B52 X;  1TQV A;  2MI7 A;  4R5L A;  2QXL A;  4EZY A;  4H8S A;  3EJR A;  4IM2 A;  2RAJ A;  4FM3 A;  2OBL A;  4G6Q A;  4AZC B;  4AZC A;  2Q13 A;  3HAH A;  4EZT A;  3EJU A;  1OA0 A;  4JNF A;  2WIN M;  1SU7 A;  2PY6 A;  1DKX A;  4JWE A;  4UDY X;  2GA9 D;  4EZV A;  1TQU A;  3I39 X;  5FLE X;  1X03 A;  4JLC A;  4AZ6 A;  2QFF A;  1HXK A;  2Z0N A;  3D50 A;  1U00 A;  3OK8 A;  3BLB A;  3KAV A;  4H6H A;  2X3X A;  3A98 A;  2X3V A;  2F18 A;  4FZS A;  2EFK A;  2JNK A;  3D51 A;  3I01 A;  1GN9 A;  3T4A G;  5FIG A;  3DPQ A;  2Z0V A;  4H6I A;  2GF4 A;  3UIT A;  4EZR A;  2QKW A;  4IWO A;  3LMF A;  3L3P A;  3D2F A;  4EZO A;  4F01 A;  2ZXQ A;  3G9G A;  4R5K A;  1GNL A;  4JL9 A;  3VEA A;  3DX0 A;  3D2E A;  2D1L A;  3GI7 A;  2YL8 A;  3SOG A; 
#chains in the Genus database with same CATH homology
 1X03 A;  4H8S A;  2ELB A;  1WDZ A;  4BNE A;  4NSW A;  2RAJ A;  3I2W A;  3HAJ A;  1X04 A;  3ACO A;  3CAZ A;  3DYT A;  4WPE A;  3QE6 A;  4DYL A;  2Q13 A;  2X3V A;  2Z0O A;  3HAH A;  2X3W A;  1I49 A;  1Y2O A;  2EFK A;  2Z0N A;  1I4T A;  3PLT A;  4FZS A;  2RAK A;  3SOG A;  3LLL A;  1ZWW A;  1URU A;  3Q0K A;  3ABH A;  3SYV A;  2RAI A;  1I4D A;  3HAI A;  3G9G A;  4NQI A;  2Q12 A;  3OK8 A;  4AKV A;  2FIC A;  3Q84 A;  4AVM A;  5C5B B;  5C5B A;  3QNI A;  3QWE A;  4I1Q A;  3M3W A;  2EFL A;  4ATM A;  4DCN C;  2D1L A;  2YKT A;  4WPC A;  2C08 A;  2V0O A;  2Z0V A;  2D4C A;  1I4L A;  2X3X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...