2LM0A

Solution structure of the af4-af9 complex
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
125
structure length
125
Chain Sequence
TRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKPMGSDKQIKNGECDKAYLDELVELHRRLMTLRERHILQQIVNLIEETGHFHITNTTFDFDLCSLDKTTVRKLQSYLETSGTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords AF4/FMR2 family member 1/Protein AF-9 chimera
publication title Leukemia Fusion Target AF9 Is an Intrinsically Disordered Transcriptional Regulator that Recruits Multiple Partners via Coupled Folding and Binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nuclear protein
total genus 13
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2011-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17793 AHD ANC1 homology domain (AHD)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.290 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 2lm0A01
2LM0A
chains in the Genus database with same CATH superfamily
3O3MB 1SU6A 1UPXA 2YL6A 1R33A 2EFLA 4EZTA 3OK8A 1I49A 1O7DC 4JNEA 4E81A 1I4DA 3G9GA 2WYHA 3HAIA 2JNKA 2YKTA 4EZXA 2GAFD 2MI7A 4WPEA 2O0I1 1URUA 2OW7A 2OBMA 4ATMA 3FD9A 4KIKB 1DKXA 3BVTA 1OAOA 3I01A 3D52A 3ZEDA 3DDGA 3B53X 1I4LA 4E3CA 4FZSA 3T49A 2GF4A 4JWDA 2FYVA 3CZSA 2F7OA 4JLCA 3UITA 2YL8A 3BUPA 1QWNA 4NPHA 2C08A 2WYIA 3ACOA 4H8SA 4DYLA 2N3KA 4EZPA 4BNEA 1TQTA 1GNTA 3O3OB 3BVUA 5C5BB 1WDZA 1TQWA 2F1AA 4KIKA 3D51A 3RV0A 1ZYLA 2YLLA 2LM0A 3C7NA 3BVXA 4FZOA 3CKDA 4AZCB 4EZZA 2YL5A 3B51X 4NSWA 3SYVA 4AZ6A 4EZWA 2RAJA 4AVMA 3DPPA 3T4AG 4EZQA 1SUFA 3D2EA 3OHXM 3L3PA 1U00A 1E2UA 5C5BA 3CAZA 2X3VA 4NQIA 1TQVA 1W9MA 4M0MA 4AZ5A 3QA8A 1GNLA 4AKVA 5E84A 4WPCA 4IWOA 3KAVA 1DKYA 4IM3A 2KHOA 1R5EA 2PMRA 3EJQA 3RV1A 1E1DA 2YLAA 4AZCA 1PS3A 3VEAA 2X3WA 2F7PA 4AZBA 4AZHA 4EZOA 3I2WA 3DX1A 4JN4A 3EJTA 4JL9A 4IW0A 2QFFA 2D4CA 3DX2A 1YWMA 4IWQA 2F1BA 2Z0OA 2YIAA 3DYTA 4F01A 1TQUA 3CVRA 3EJPA 3A98A 3D4YA 4HY9A 4EZUA 2X3XA 4R5KA 3BLBA 3QNIA 3VKHA 2ND1A 1QX1A 4HR1B 1I4TA 3Q0KA 3ERCC 3DDFA 4EZSA 3CZNA 3BVVA 5TKYA 3HAHA 1LQ7A 3I39X 4B9QA 2Z0VA 4G6QA 1MJGA 4H6HA 3EJSA 1HTYA 1SU7A 3DX3A 2RAKA 3O3NB 1SU8A 4UDXX 4H6IA 1HXKA 3D50A 3DX4A 3LMFA 2F7QA 2RAIA 3HAJA 2EFKA 1X03A 3M3WA 2Z8YA 3I04A 3B52X 3RPMA 2FICA 1DKZA 3SOGA 2V0OA 2PY6A 4EZNA 4JWEA 2ALWA 2RT6A 4HR1A 1E9VA 2D1LA 3LVTA 1OA0A 2F7RA 3ER8C 4JWCA 2OW6A 1GN9A 3DX0A 3VEBA 4AZGA 3ABHA 3EJRA 4EZYA 1X04A 2ND0A 2OO2A 4FM3A 4IWPA 4EZRA 4R5JA 4JNFA 3ER9B 2ELBA 3LLLA 4I1QA 5KBPA 5FLEX 2QXLA 4EZVA 4F00A 3Q84A 1Y2OA 3KAWA 4R5IA 3D4ZA 4HYBA 3CV5A 3EJUA 1O7DB 3L3OM 3BVWA 2OZNB 2YIVX 2F18A 4PO2A 2YIBA 2Z0NA 3QE6A 1QWUA 3DPOA 1ZWWA 4IM0A 2Q12A 2EX3B 3PLTA 3T46A 3DPQA 3T47A 3KDRA 4AZIA 4R5GA 3GI7A 3BUBA 3F7WA 4IM2A 3BUDA 1HWWA 2NCZA 4JWIA 3T48A 2WINM 2GA9D 2ZXQA 2EWFA 3BUIA 3BUQA 3QWEA 2JNSA 5FIGA 2Q13A 4UDYX 2QKWA 1TQSA 3OWGA 4AZ7A 4FZPA 2X5CA 2YL9A 4D8JA 2YI8A 4R5LA 1R34A 1OA1A 2LXYA 2OBLA 4DCNC 1JQKA 3D2FA 3QNJA 2YI9A
chains in the Genus database with same CATH topology
4EZVA 4EZSA 2QXLA 3O3MB 5TKYA 4EZWA 1SU6A 4F00A 1UPXA 3I39X 4B9QA 4EZTA 4G6QA 3KAWA 4R5IA 3DPPA 1MJGA 4H6HA 4HYBA 3T4AG 4EZQA 1SUFA 4JNEA 1SU7A 3D2EA 3OHXM 4E81A 3O3NB 3ERCC 1SU8A 3L3OM 4UDXX 4EZXA 2GAFD 4H6IA 1U00A 1E2UA 3LMFA 3B51X 1W9MA 2YIVX 2Z8YA 4M0MA 2OBMA 3QA8A 4PO2A 1GNLA 2YIBA 3FD9A 4KIKB 5E84A 3I04A 1DKXA 3B52X 3DPOA 1OAOA 3KAVA 1DKYA 4IM0A 3I01A 4IWOA 2EX3B 2KHOA 4IM3A 3T46A 3DPQA 3T47A 3ZEDA 1DKZA 3RV1A 3B53X 1E1DA 3VEAA 3KDRA 4E3CA 3T49A 2PY6A 4R5GA 4EZNA 3GI7A 4EZOA 4JWEA 3F7WA 2RT6A 4HR1A 4JWDA 4IM2A 4JN4A 2NCZA 4JWIA 4JL9A 1E9VA 3T48A 4JLCA 3UITA 2WINM 2GA9D 1OA0A 4IW0A 2QFFA 2EWFA 3ER8C 4JWCA 4NPHA 1GN9A 3VEBA 2JNSA 4EZPA 2N3KA 5FIGA 4EZYA 1GNTA 3O3OB 4IWQA 4UDYX 3OWGA 2YIAA 4F01A 2ND0A 4KIKA 3A98A 3RV0A 2X5CA 4FM3A 4HY9A 4D8JA 4EZUA 2YI8A 1ZYLA 4IWPA 4R5KA 4EZRA 4R5JA 4JNFA 2LM0A 3C7NA 3ER9B 4R5LA 3VKHA 4EZZA 1OA1A 2OBLA 2ND1A 5FLEX 1JQKA 4HR1B 3D2FA 3QNJA 2YI9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LM0 A; 
#chains in the Genus database with same CATH topology
 3O3M B;  1SU6 A;  1UPX A;  2YL6 A;  1R33 A;  2EFL A;  4EZT A;  3OK8 A;  1I49 A;  1O7D C;  4JNE A;  4E81 A;  1I4D A;  3G9G A;  2WYH A;  3HAI A;  2JNK A;  2YKT A;  4EZX A;  2GAF D;  2MI7 A;  4WPE A;  2O0I 1;  1URU A;  2OW7 A;  2OBM A;  4ATM A;  3FD9 A;  4KIK B;  1DKX A;  3BVT A;  1OAO A;  3I01 A;  3D52 A;  3ZED A;  3DDG A;  3B53 X;  1I4L A;  4E3C A;  4FZS A;  3T49 A;  2GF4 A;  4JWD A;  2FYV A;  3CZS A;  2F7O A;  4JLC A;  3UIT A;  2YL8 A;  3BUP A;  1QWN A;  4NPH A;  2C08 A;  2WYI A;  3ACO A;  4H8S A;  4DYL A;  2N3K A;  4EZP A;  4BNE A;  1TQT A;  1GNT A;  3O3O B;  3BVU A;  5C5B B;  1WDZ A;  1TQW A;  2F1A A;  4KIK A;  3D51 A;  3RV0 A;  1ZYL A;  2YLL A;  2LM0 A;  3C7N A;  3BVX A;  4FZO A;  3CKD A;  4AZC B;  4EZZ A;  2YL5 A;  3B51 X;  4NSW A;  3SYV A;  4AZ6 A;  4EZW A;  2RAJ A;  4AVM A;  3DPP A;  3T4A G;  4EZQ A;  1SUF A;  3D2E A;  3OHX M;  3L3P A;  1U00 A;  1E2U A;  5C5B A;  3CAZ A;  2X3V A;  4NQI A;  1TQV A;  1W9M A;  4M0M A;  4AZ5 A;  3QA8 A;  1GNL A;  4AKV A;  5E84 A;  4WPC A;  4IWO A;  3KAV A;  1DKY A;  4IM3 A;  2KHO A;  1R5E A;  2PMR A;  3EJQ A;  3RV1 A;  1E1D A;  2YLA A;  4AZC A;  1PS3 A;  3VEA A;  2X3W A;  2F7P A;  4AZB A;  4AZH A;  4EZO A;  3I2W A;  3DX1 A;  4JN4 A;  3EJT A;  4JL9 A;  4IW0 A;  2QFF A;  2D4C A;  3DX2 A;  1YWM A;  4IWQ A;  2F1B A;  2Z0O A;  2YIA A;  3DYT A;  4F01 A;  1TQU A;  3CVR A;  3EJP A;  3A98 A;  3D4Y A;  4HY9 A;  4EZU A;  2X3X A;  4R5K A;  3BLB A;  3QNI A;  3VKH A;  2ND1 A;  1QX1 A;  4HR1 B;  1I4T A;  3Q0K A;  3ERC C;  3DDF A;  4EZS A;  3CZN A;  3BVV A;  5TKY A;  3HAH A;  1LQ7 A;  3I39 X;  4B9Q A;  2Z0V A;  4G6Q A;  1MJG A;  4H6H A;  3EJS A;  1HTY A;  1SU7 A;  3DX3 A;  2RAK A;  3O3N B;  1SU8 A;  4UDX X;  4H6I A;  1HXK A;  3D50 A;  3DX4 A;  3LMF A;  2F7Q A;  2RAI A;  3HAJ A;  2EFK A;  1X03 A;  3M3W A;  2Z8Y A;  3I04 A;  3B52 X;  3RPM A;  2FIC A;  1DKZ A;  3SOG A;  2V0O A;  2PY6 A;  4EZN A;  4JWE A;  2ALW A;  2RT6 A;  4HR1 A;  1E9V A;  2D1L A;  3LVT A;  1OA0 A;  2F7R A;  3ER8 C;  4JWC A;  2OW6 A;  1GN9 A;  3DX0 A;  3VEB A;  4AZG A;  3ABH A;  3EJR A;  4EZY A;  1X04 A;  2ND0 A;  2OO2 A;  4FM3 A;  4IWP A;  4EZR A;  4R5J A;  4JNF A;  3ER9 B;  2ELB A;  3LLL A;  4I1Q A;  5KBP A;  5FLE X;  2QXL A;  4EZV A;  4F00 A;  3Q84 A;  1Y2O A;  3KAW A;  4R5I A;  3D4Z A;  4HYB A;  3CV5 A;  3EJU A;  1O7D B;  3L3O M;  3BVW A;  2OZN B;  2YIV X;  2F18 A;  4PO2 A;  2YIB A;  2Z0N A;  3QE6 A;  1QWU A;  3DPO A;  1ZWW A;  4IM0 A;  2Q12 A;  2EX3 B;  3PLT A;  3T46 A;  3DPQ A;  3T47 A;  3KDR A;  4AZI A;  4R5G A;  3GI7 A;  3BUB A;  3F7W A;  4IM2 A;  3BUD A;  1HWW A;  2NCZ A;  4JWI A;  3T48 A;  2WIN M;  2GA9 D;  2ZXQ A;  2EWF A;  3BUI A;  3BUQ A;  3QWE A;  2JNS A;  5FIG A;  2Q13 A;  4UDY X;  2QKW A;  1TQS A;  3OWG A;  4AZ7 A;  4FZP A;  2X5C A;  2YL9 A;  4D8J A;  2YI8 A;  4R5L A;  1R34 A;  1OA1 A;  2LXY A;  2OBL A;  4DCN C;  1JQK A;  3D2F A;  3QNJ A;  2YI9 A; 
#chains in the Genus database with same CATH homology
 4EZV A;  4EZS A;  2QXL A;  3O3M B;  5TKY A;  4EZW A;  1SU6 A;  4F00 A;  1UPX A;  3I39 X;  4B9Q A;  4EZT A;  4G6Q A;  3KAW A;  4R5I A;  3DPP A;  1MJG A;  4H6H A;  4HYB A;  3T4A G;  4EZQ A;  1SUF A;  4JNE A;  1SU7 A;  3D2E A;  3OHX M;  4E81 A;  3O3N B;  3ERC C;  1SU8 A;  3L3O M;  4UDX X;  4EZX A;  2GAF D;  4H6I A;  1U00 A;  1E2U A;  3LMF A;  3B51 X;  1W9M A;  2YIV X;  2Z8Y A;  4M0M A;  2OBM A;  3QA8 A;  4PO2 A;  1GNL A;  2YIB A;  3FD9 A;  4KIK B;  5E84 A;  3I04 A;  1DKX A;  3B52 X;  3DPO A;  1OAO A;  3KAV A;  1DKY A;  4IM0 A;  3I01 A;  4IWO A;  2EX3 B;  2KHO A;  4IM3 A;  3T46 A;  3DPQ A;  3T47 A;  3ZED A;  1DKZ A;  3RV1 A;  3B53 X;  1E1D A;  3VEA A;  3KDR A;  4E3C A;  3T49 A;  2PY6 A;  4R5G A;  4EZN A;  3GI7 A;  4EZO A;  4JWE A;  3F7W A;  2RT6 A;  4HR1 A;  4JWD A;  4IM2 A;  4JN4 A;  2NCZ A;  4JWI A;  4JL9 A;  1E9V A;  3T48 A;  4JLC A;  3UIT A;  2WIN M;  2GA9 D;  1OA0 A;  4IW0 A;  2QFF A;  2EWF A;  3ER8 C;  4JWC A;  4NPH A;  1GN9 A;  3VEB A;  2JNS A;  4EZP A;  2N3K A;  5FIG A;  4EZY A;  1GNT A;  3O3O B;  4IWQ A;  4UDY X;  3OWG A;  2YIA A;  4F01 A;  2ND0 A;  4KIK A;  3A98 A;  3RV0 A;  2X5C A;  4FM3 A;  4HY9 A;  4D8J A;  4EZU A;  2YI8 A;  1ZYL A;  4IWP A;  4R5K A;  4EZR A;  4R5J A;  4JNF A;  2LM0 A;  3C7N A;  3ER9 B;  4R5L A;  3VKH A;  4EZZ A;  1OA1 A;  2OBL A;  2ND1 A;  5FLE X;  1JQK A;  4HR1 B;  3D2F A;  3QNJ A;  2YI9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...