2LM0A

Solution structure of the af4-af9 complex
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
125
structure length
125
Chain Sequence
TRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKPMGSDKQIKNGECDKAYLDELVELHRRLMTLRERHILQQIVNLIEETGHFHITNTTFDFDLCSLDKTTVRKLQSYLETSGTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Nuclear protein
molecule keywords AF4/FMR2 family member 1/Protein AF-9 chimera
publication title Leukemia Fusion Target AF9 Is an Intrinsically Disordered Transcriptional Regulator that Recruits Multiple Partners via Coupled Folding and Binding.
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2011-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17793 AHD ANC1 homology domain (AHD)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.290 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 2lm0A01
2LM0A
chains in the Genus database with same CATH superfamily
4IM3A 3O3MB 2ND1A 3D50A 3C7NA 2EWFA 3ERCC 3BLBA 3BVXA 4EZUA 2D4CA 3CZSA 2OBMA 4H8SA 3LVTA 3D52A 3T46A 3KAVA 3BUDA 2GA9D 4EZWA 4R5JA 2OZNB 4ATMA 4JWIA 3BVUA 3VEBA 3UITA 4AZIA 3QE6A 4R5GA 1W9MA 1JQKA 4R5IA 3DPPA 4EZPA 2YIVX 2OBLA 2F7RA 3BUQA 2ALWA 3DYTA 3Q0KA 2YLAA 2YKTA 3ER8C 4AKVA 3HAJA 2YI9A 4NQIA 2RT6A 2ELBA 3CVRA 4EZSA 3DDFA 3EJSA 3ZEDA 3DX4A 3B52X 2YL8A 2C08A 3B53X 3O3NB 4EZVA 4AZ6A 3ABHA 2QKWA 4JNEA 3BUIA 3EJTA 1TQWA 2YI8A 3EJQA 1QWUA 4FM3A 4KIKB 2QFFA 1SU7A 2EFKA 1TQSA 1I49A 4EZRA 2RAIA 2YL9A 4AZ7A 3DPQA 1TQVA 4IWQA 2F7PA 1YWMA 2WYIA 3SOGA 1OA1A 2EX3B 3D4ZA 1GNTA 4KIKA 1UPXA 4EZYA 2Z0NA 3PLTA 3KAWA 3QNIA 1O7DB 2OW7A 2F7OA 1DKYA 5KBPA 1U00A 2JNSA 3GI7A 4JLCA 3BVTA 3BUBA 2ZXQA 3HAHA 1HXKA 1MJGA 2X3WA 4UDXX 3DDGA 1I4LA 2N3KA 3LMFA 4AZ5A 2Z0VA 1X03A 2QXLA 4DYLA 1SU8A 3DX2A 3I04A 2WYHA 1HWWA 1QWNA 1X04A 4EZZA 4EZXA 4JWDA 2YL6A 1GN9A 4FZSA 3DX1A 4IM0A 2KHOA 2FICA 1QX1A 3QWEA 2X5CA 2YIBA 1O7DC 5FIGA 4HR1B 1Y2OA 3HAIA 2LXYA 3VEAA 2GAFD 3B51X 1OA0A 1I4TA 2RAJA 4AZBA 3I39X 2X3XA 2V0OA 1E2UA 4NSWA 2OW6A 1SUFA 4H6HA 3SYVA 3D4YA 4F00A 4JWEA 3FD9A 4AZCA 3T47A 4AZGA 4G6QA 4M0MA 4HR1A 4WPEA 3T48A 3F7WA 4EZTA 1ZWWA 2X3VA 4FZOA 1E9VA 1E1DA 2WINM 1DKXA 4IWPA 4EZNA 3D2FA 3G9GA 4IW0A 1R34A 1I4DA 2F18A 2FYVA 3L3OM 3CAZA 4JL9A 3EJUA 2MI7A 4BNEA 3KDRA 5E84A 4E3CA 4AVMA 3RV0A 3QA8A 5TKYA 3EJPA 4I1QA 3I01A 1R5EA 1ZYLA 5C5BB 3OWGA 3LLLA 4FZPA 4EZQA 2D1LA 3BVVA 4JN4A 3DX3A 2PMRA 2GF4A 4H6IA 3M3WA 1LQ7A 3CZNA 2RAKA 1GNLA 3T4AG 2Z8YA 2O0I1 3OHXM 4WPCA 1TQTA 5C5BA 2ND0A 2NCZA 4EZOA 3BVWA 5FLEX 3D2EA 3BUPA 3RPMA 4JNFA 2YL5A 3RV1A 2F1BA 1SU6A 2YIAA 3O3OB 4AZCB 4D8JA 2EFLA 1PS3A 4HYBA 3DX0A 3ACOA 3DPOA 3EJRA 4JWCA 2LM0A 1WDZA 2F1AA 3A98A 3OK8A 3I2WA 4HY9A 2JNKA 4UDYX 4PO2A 4R5KA 4B9QA 1OAOA 4R5LA 2F7QA 2Q13A 3D51A 4AZHA 3QNJA 3ER9B 4E81A 3T49A 1HTYA 2YLLA 1R33A 1URUA 4F01A 3Q84A 2PY6A 4IWOA 3VKHA 1TQUA 3L3PA 1DKZA 4IM2A 2Z0OA 2Q12A 4NPHA 2OO2A 3CV5A 3CKDA 4DCNC
chains in the Genus database with same CATH topology
4IM3A 3O3MB 2ND1A 2ND0A 2YIBA 3DPQA 2NCZA 5FIGA 3C7NA 4HR1B 4EZOA 2EWFA 3ERCC 4IWQA 3VEAA 5FLEX 2GAFD 4EZUA 3D2EA 3B51X 1OA0A 4JNFA 3RV1A 3I39X 1SU6A 1E2UA 1SUFA 1OA1A 2OBMA 2EX3B 4H6HA 2YIAA 4F00A 1GNTA 4KIKA 1UPXA 4EZYA 3O3OB 3T46A 3KAVA 4JWEA 3FD9A 2GA9D 4D8JA 4EZWA 3T47A 3KAWA 4G6QA 4R5JA 4M0MA 4HR1A 4HYBA 4JWIA 3T48A 3F7WA 1DKYA 3UITA 3VEBA 3DPOA 4EZTA 4JWCA 4R5GA 1W9MA 1JQKA 4R5IA 2LM0A 3DPPA 1U00A 2JNSA 3GI7A 2YIVX 4EZPA 3A98A 4JLCA 2OBLA 1E9VA 1E1DA 2WINM 1DKXA 4IWPA 4EZNA 3D2FA 4IW0A 4HY9A 1MJGA 3L3OM 4UDXX 3ER8C 4JL9A 4UDYX 3KDRA 5E84A 4PO2A 2YI9A 2RT6A 4E3CA 2N3KA 4R5KA 3LMFA 4EZSA 4B9QA 3RV0A 1OAOA 3QA8A 5TKYA 4R5LA 3ZEDA 2QXLA 3I01A 1ZYLA 1SU8A 3B52X 3QNJA 3ER9B 4E81A 3I04A 3T49A 3B53X 3O3NB 3OWGA 4F01A 4EZVA 4EZQA 4EZZA 2PY6A 4IWOA 3VKHA 4EZXA 4JN4A 4JWDA 1DKZA 4IM2A 4JNEA 4H6IA 1GN9A 2YI8A 4NPHA 1GNLA 3T4AG 2Z8YA 4FM3A 4KIKB 4IM0A 2KHOA 3OHXM 2QFFA 1SU7A 4EZRA 2X5CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LM0 A; 
#chains in the Genus database with same CATH topology
 4IM3 A;  3O3M B;  2ND1 A;  3D50 A;  3C7N A;  2EWF A;  3ERC C;  3BLB A;  3BVX A;  4EZU A;  2D4C A;  3CZS A;  2OBM A;  4H8S A;  3LVT A;  3D52 A;  3T46 A;  3KAV A;  3BUD A;  2GA9 D;  4EZW A;  4R5J A;  2OZN B;  4ATM A;  4JWI A;  3BVU A;  3VEB A;  3UIT A;  4AZI A;  3QE6 A;  4R5G A;  1W9M A;  1JQK A;  4R5I A;  3DPP A;  4EZP A;  2YIV X;  2OBL A;  2F7R A;  3BUQ A;  2ALW A;  3DYT A;  3Q0K A;  2YLA A;  2YKT A;  3ER8 C;  4AKV A;  3HAJ A;  2YI9 A;  4NQI A;  2RT6 A;  2ELB A;  3CVR A;  4EZS A;  3DDF A;  3EJS A;  3ZED A;  3DX4 A;  3B52 X;  2YL8 A;  2C08 A;  3B53 X;  3O3N B;  4EZV A;  4AZ6 A;  3ABH A;  2QKW A;  4JNE A;  3BUI A;  3EJT A;  1TQW A;  2YI8 A;  3EJQ A;  1QWU A;  4FM3 A;  4KIK B;  2QFF A;  1SU7 A;  2EFK A;  1TQS A;  1I49 A;  4EZR A;  2RAI A;  2YL9 A;  4AZ7 A;  3DPQ A;  1TQV A;  4IWQ A;  2F7P A;  1YWM A;  2WYI A;  3SOG A;  1OA1 A;  2EX3 B;  3D4Z A;  1GNT A;  4KIK A;  1UPX A;  4EZY A;  2Z0N A;  3PLT A;  3KAW A;  3QNI A;  1O7D B;  2OW7 A;  2F7O A;  1DKY A;  5KBP A;  1U00 A;  2JNS A;  3GI7 A;  4JLC A;  3BVT A;  3BUB A;  2ZXQ A;  3HAH A;  1HXK A;  1MJG A;  2X3W A;  4UDX X;  3DDG A;  1I4L A;  2N3K A;  3LMF A;  4AZ5 A;  2Z0V A;  1X03 A;  2QXL A;  4DYL A;  1SU8 A;  3DX2 A;  3I04 A;  2WYH A;  1HWW A;  1QWN A;  1X04 A;  4EZZ A;  4EZX A;  4JWD A;  2YL6 A;  1GN9 A;  4FZS A;  3DX1 A;  4IM0 A;  2KHO A;  2FIC A;  1QX1 A;  3QWE A;  2X5C A;  2YIB A;  1O7D C;  5FIG A;  4HR1 B;  1Y2O A;  3HAI A;  2LXY A;  3VEA A;  2GAF D;  3B51 X;  1OA0 A;  1I4T A;  2RAJ A;  4AZB A;  3I39 X;  2X3X A;  2V0O A;  1E2U A;  4NSW A;  2OW6 A;  1SUF A;  4H6H A;  3SYV A;  3D4Y A;  4F00 A;  4JWE A;  3FD9 A;  4AZC A;  3T47 A;  4AZG A;  4G6Q A;  4M0M A;  4HR1 A;  4WPE A;  3T48 A;  3F7W A;  4EZT A;  1ZWW A;  2X3V A;  4FZO A;  1E9V A;  1E1D A;  2WIN M;  1DKX A;  4IWP A;  4EZN A;  3D2F A;  3G9G A;  4IW0 A;  1R34 A;  1I4D A;  2F18 A;  2FYV A;  3L3O M;  3CAZ A;  4JL9 A;  3EJU A;  2MI7 A;  4BNE A;  3KDR A;  5E84 A;  4E3C A;  4AVM A;  3RV0 A;  3QA8 A;  5TKY A;  3EJP A;  4I1Q A;  3I01 A;  1R5E A;  1ZYL A;  5C5B B;  3OWG A;  3LLL A;  4FZP A;  4EZQ A;  2D1L A;  3BVV A;  4JN4 A;  3DX3 A;  2PMR A;  2GF4 A;  4H6I A;  3M3W A;  1LQ7 A;  3CZN A;  2RAK A;  1GNL A;  3T4A G;  2Z8Y A;  2O0I 1;  3OHX M;  4WPC A;  1TQT A;  5C5B A;  2ND0 A;  2NCZ A;  4EZO A;  3BVW A;  5FLE X;  3D2E A;  3BUP A;  3RPM A;  4JNF A;  2YL5 A;  3RV1 A;  2F1B A;  1SU6 A;  2YIA A;  3O3O B;  4AZC B;  4D8J A;  2EFL A;  1PS3 A;  4HYB A;  3DX0 A;  3ACO A;  3DPO A;  3EJR A;  4JWC A;  2LM0 A;  1WDZ A;  2F1A A;  3A98 A;  3OK8 A;  3I2W A;  4HY9 A;  2JNK A;  4UDY X;  4PO2 A;  4R5K A;  4B9Q A;  1OAO A;  4R5L A;  2F7Q A;  2Q13 A;  3D51 A;  4AZH A;  3QNJ A;  3ER9 B;  4E81 A;  3T49 A;  1HTY A;  2YLL A;  1R33 A;  1URU A;  4F01 A;  3Q84 A;  2PY6 A;  4IWO A;  3VKH A;  1TQU A;  3L3P A;  1DKZ A;  4IM2 A;  2Z0O A;  2Q12 A;  4NPH A;  2OO2 A;  3CV5 A;  3CKD A;  4DCN C; 
#chains in the Genus database with same CATH homology
 4IM3 A;  3O3M B;  2ND1 A;  2ND0 A;  2YIB A;  3DPQ A;  2NCZ A;  5FIG A;  3C7N A;  4HR1 B;  4EZO A;  2EWF A;  3ERC C;  4IWQ A;  3VEA A;  5FLE X;  2GAF D;  4EZU A;  3D2E A;  3B51 X;  1OA0 A;  4JNF A;  3RV1 A;  3I39 X;  1SU6 A;  1E2U A;  1SUF A;  1OA1 A;  2OBM A;  2EX3 B;  4H6H A;  2YIA A;  4F00 A;  1GNT A;  4KIK A;  1UPX A;  4EZY A;  3O3O B;  3T46 A;  3KAV A;  4JWE A;  3FD9 A;  2GA9 D;  4D8J A;  4EZW A;  3T47 A;  3KAW A;  4G6Q A;  4R5J A;  4M0M A;  4HR1 A;  4HYB A;  4JWI A;  3T48 A;  3F7W A;  1DKY A;  3UIT A;  3VEB A;  3DPO A;  4EZT A;  4JWC A;  4R5G A;  1W9M A;  1JQK A;  4R5I A;  2LM0 A;  3DPP A;  1U00 A;  2JNS A;  3GI7 A;  2YIV X;  4EZP A;  3A98 A;  4JLC A;  2OBL A;  1E9V A;  1E1D A;  2WIN M;  1DKX A;  4IWP A;  4EZN A;  3D2F A;  4IW0 A;  4HY9 A;  1MJG A;  3L3O M;  4UDX X;  3ER8 C;  4JL9 A;  4UDY X;  3KDR A;  5E84 A;  4PO2 A;  2YI9 A;  2RT6 A;  4E3C A;  2N3K A;  4R5K A;  3LMF A;  4EZS A;  4B9Q A;  3RV0 A;  1OAO A;  3QA8 A;  5TKY A;  4R5L A;  3ZED A;  2QXL A;  3I01 A;  1ZYL A;  1SU8 A;  3B52 X;  3QNJ A;  3ER9 B;  4E81 A;  3I04 A;  3T49 A;  3B53 X;  3O3N B;  3OWG A;  4F01 A;  4EZV A;  4EZQ A;  4EZZ A;  2PY6 A;  4IWO A;  3VKH A;  4EZX A;  4JN4 A;  4JWD A;  1DKZ A;  4IM2 A;  4JNE A;  4H6I A;  1GN9 A;  2YI8 A;  4NPH A;  1GNL A;  3T4A G;  2Z8Y A;  4FM3 A;  4KIK B;  4IM0 A;  2KHO A;  3OHX M;  2QFF A;  1SU7 A;  4EZR A;  2X5C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...