2LM0A

Solution structure of the af4-af9 complex
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
125
structure length
125
Chain Sequence
TRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKPMGSDKQIKNGECDKAYLDELVELHRRLMTLRERHILQQIVNLIEETGHFHITNTTFDFDLCSLDKTTVRKLQSYLETSGTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords AF4/FMR2 family member 1/Protein AF-9 chimera
publication title Leukemia Fusion Target AF9 Is an Intrinsically Disordered Transcriptional Regulator that Recruits Multiple Partners via Coupled Folding and Binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nuclear protein
total genus 13
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2011-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17793 AHD ANC1 homology domain (AHD)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.290 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 2lm0A01
2LM0A
chains in the Genus database with same CATH superfamily
4WPEA 3BUDA 4B9QA 3DX0A 4NSWA 4ATMA 1O7DB 3FD9A 1O7DC 2GA9D 3BVUA 3DX2A 2OW7A 3DX4A 2WYHA 4AZ5A 1OA0A 3EJSA 4IWQA 2YLLA 1DKZA 2OO2A 4DYLA 2YIAA 2F18A 3QE6A 1X03A 4KIKB 3CZSA 4I1QA 4EZRA 1X04A 1QX1A 2GAFD 4FZSA 1I4DA 2FICA 1JQKA 3LVTA 4H6IA 3RV0A 2YLAA 2Z0NA 4HR1B 2KHOA 4DCNC 4JNEA 1ZWWA 2RAIA 3VEAA 2YL6A 2Z0OA 3BUPA 4EZNA 2ND0A 4E81A 5FLEX 3T47A 3BLBA 4IW0A 2EWFA 4NPHA 2QXLA 3DX3A 2EX3B 5TKYA 1YWMA 3SYVA 1SUFA 3HAIA 2JNKA 4IM2A 3CZNA 3BVXA 1UPXA 4IM0A 2ELBA 3A98A 2F7PA 1WDZA 3QNJA 4AVMA 2Q12A 4JWEA 4FZPA 2PMRA 1TQWA 3BVVA 3EJQA 1TQVA 5E84A 3DDFA 3L3PA 1DKYA 4AZ6A 3D2EA 1HTYA 1LQ7A 1E2UA 4EZQA 3B53X 5C5BA 4R5KA 5FIGA 3EJRA 4F01A 2RAJA 3KAWA 1HWWA 4EZPA 3T48A 3LMFA 4EZWA 5KBPA 2X3WA 4H6HA 4JN4A 3BUQA 3I04A 1Y2OA 2RT6A 3EJPA 2YL9A 4EZUA 3G9GA 3ABHA 4NQIA 4EZZA 4M0MA 4PO2A 1DKXA 1TQSA 3L3OM 3D4YA 1E9VA 3T46A 4JWIA 2V0OA 4AZIA 2OBLA 4EZXA 4G6QA 3HAHA 2YI8A 2C08A 3D51A 4EZVA 1GNTA 1I4TA 3OK8A 2F7OA 4UDXX 1GN9A 2GF4A 4FM3A 2LM0A 1TQUA 3KAVA 4KIKA 2YI9A 1U00A 2WINM 4HY9A 3ZEDA 3DX1A 3B52X 3DPPA 2LXYA 1R5EA 3UITA 4JL9A 4AZ7A 1PS3A 2Q13A 2EFLA 4JNFA 4UDYX 3BUIA 3OWGA 4HR1A 3D52A 4AZGA 2YL5A 4R5JA 3I01A 3RV1A 4AZCB 4R5IA 3DYTA 2X5CA 2YKTA 2O0I1 2OW6A 4EZTA 1QWNA 3ERCC 3B51X 4FZOA 2EFKA 3O3NB 3ACOA 2RAKA 2YL8A 1I4LA 1TQTA 2Z0VA 3Q84A 4IWPA 3ER9B 3QNIA 2F1AA 4HYBA 4H8SA 3CV5A 2D1LA 4WPCA 1SU6A 3BUBA 2Z8YA 3KDRA 1ZYLA 4AZHA 3D50A 4EZYA 3O3OB 3CAZA 2YIVX 3O3MB 2WYIA 2OBMA 4IWOA 3DPQA 3BVTA 3RPMA 4AKVA 3D4ZA 2ND1A 4JWCA 3QA8A 3VKHA 3VEBA 2PY6A 3T4AG 1GNLA 3PLTA 3SOGA 1SU7A 3M3WA 2QKWA 1R34A 3Q0KA 4F00A 2ZXQA 1R33A 3BVWA 2F1BA 3D2FA 1HXKA 1MJGA 4JLCA 3GI7A 1E1DA 2F7RA 2X3VA 2F7QA 3ER8C 3I2WA 4EZOA 2QFFA 4R5LA 3I39X 3CVRA 4IM3A 4D8JA 4AZBA 3OHXM 3HAJA 2JNSA 2N3KA 3T49A 1I49A 3CKDA 5C5BB 2YIBA 4JWDA 3DDGA 4BNEA 1URUA 4E3CA 3F7WA 2ALWA 3EJUA 2NCZA 2MI7A 4EZSA 1W9MA 1QWUA 4R5GA 4AZCA 2D4CA 1OA1A 1SU8A 2FYVA 3QWEA 3DPOA 1OAOA 2X3XA 3LLLA 3C7NA 2OZNB 3EJTA
chains in the Genus database with same CATH topology
2PY6A 3T4AG 1GNLA 2WINM 4HY9A 3ZEDA 4JWEA 3B52X 3DPPA 1SU7A 3UITA 4B9QA 4JL9A 3FD9A 2GA9D 5E84A 4JNFA 4F00A 4UDYX 3OWGA 4HR1A 1DKYA 1OA0A 3D2EA 4IWQA 4R5JA 3I01A 3RV1A 3D2FA 1E2UA 4R5IA 4EZQA 1DKZA 1MJGA 3B53X 4JLCA 4R5KA 3GI7A 2YIAA 5FIGA 4F01A 1E1DA 2X5CA 3KAWA 4EZPA 3T48A 3ER8C 3LMFA 4KIKB 4EZTA 4EZWA 4EZOA 3ERCC 3B51X 4EZRA 4JN4A 4H6HA 2QFFA 4R5LA 3O3NB 3I39X 3I04A 2GAFD 2RT6A 1JQKA 4H6IA 3RV0A 4IM3A 4HR1B 2KHOA 4EZUA 4D8JA 4EZZA 4JNEA 4M0MA 3OHXM 4IWPA 3ER9B 4PO2A 2JNSA 1DKXA 4HYBA 3VEAA 2N3KA 3L3OM 3T49A 1E9VA 2YIBA 4JWDA 3T46A 4JWIA 4EZNA 2ND0A 4E81A 4E3CA 1SU6A 5FLEX 2OBLA 3F7WA 4EZXA 2Z8YA 3KDRA 1ZYLA 4G6QA 3T47A 2YI8A 4EZYA 4IW0A 3O3OB 2NCZA 2EWFA 4NPHA 2YIVX 2QXLA 4EZVA 3O3MB 4EZSA 2OBMA 1GNTA 4IWOA 1W9MA 2EX3B 3DPQA 5TKYA 4R5GA 1SUFA 1OA1A 4IM2A 1SU8A 4UDXX 1GN9A 3DPOA 1OAOA 4FM3A 1UPXA 2ND1A 4JWCA 3C7NA 4IM0A 2LM0A 3QA8A 3A98A 3VKHA 3KAVA 3QNJA 4KIKA 2YI9A 3VEBA 1U00A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LM0 A; 
#chains in the Genus database with same CATH topology
 4WPE A;  3BUD A;  4B9Q A;  3DX0 A;  4NSW A;  4ATM A;  1O7D B;  3FD9 A;  1O7D C;  2GA9 D;  3BVU A;  3DX2 A;  2OW7 A;  3DX4 A;  2WYH A;  4AZ5 A;  1OA0 A;  3EJS A;  4IWQ A;  2YLL A;  1DKZ A;  2OO2 A;  4DYL A;  2YIA A;  2F18 A;  3QE6 A;  1X03 A;  4KIK B;  3CZS A;  4I1Q A;  4EZR A;  1X04 A;  1QX1 A;  2GAF D;  4FZS A;  1I4D A;  2FIC A;  1JQK A;  3LVT A;  4H6I A;  3RV0 A;  2YLA A;  2Z0N A;  4HR1 B;  2KHO A;  4DCN C;  4JNE A;  1ZWW A;  2RAI A;  3VEA A;  2YL6 A;  2Z0O A;  3BUP A;  4EZN A;  2ND0 A;  4E81 A;  5FLE X;  3T47 A;  3BLB A;  4IW0 A;  2EWF A;  4NPH A;  2QXL A;  3DX3 A;  2EX3 B;  5TKY A;  1YWM A;  3SYV A;  1SUF A;  3HAI A;  2JNK A;  4IM2 A;  3CZN A;  3BVX A;  1UPX A;  4IM0 A;  2ELB A;  3A98 A;  2F7P A;  1WDZ A;  3QNJ A;  4AVM A;  2Q12 A;  4JWE A;  4FZP A;  2PMR A;  1TQW A;  3BVV A;  3EJQ A;  1TQV A;  5E84 A;  3DDF A;  3L3P A;  1DKY A;  4AZ6 A;  3D2E A;  1HTY A;  1LQ7 A;  1E2U A;  4EZQ A;  3B53 X;  5C5B A;  4R5K A;  5FIG A;  3EJR A;  4F01 A;  2RAJ A;  3KAW A;  1HWW A;  4EZP A;  3T48 A;  3LMF A;  4EZW A;  5KBP A;  2X3W A;  4H6H A;  4JN4 A;  3BUQ A;  3I04 A;  1Y2O A;  2RT6 A;  3EJP A;  2YL9 A;  4EZU A;  3G9G A;  3ABH A;  4NQI A;  4EZZ A;  4M0M A;  4PO2 A;  1DKX A;  1TQS A;  3L3O M;  3D4Y A;  1E9V A;  3T46 A;  4JWI A;  2V0O A;  4AZI A;  2OBL A;  4EZX A;  4G6Q A;  3HAH A;  2YI8 A;  2C08 A;  3D51 A;  4EZV A;  1GNT A;  1I4T A;  3OK8 A;  2F7O A;  4UDX X;  1GN9 A;  2GF4 A;  4FM3 A;  2LM0 A;  1TQU A;  3KAV A;  4KIK A;  2YI9 A;  1U00 A;  2WIN M;  4HY9 A;  3ZED A;  3DX1 A;  3B52 X;  3DPP A;  2LXY A;  1R5E A;  3UIT A;  4JL9 A;  4AZ7 A;  1PS3 A;  2Q13 A;  2EFL A;  4JNF A;  4UDY X;  3BUI A;  3OWG A;  4HR1 A;  3D52 A;  4AZG A;  2YL5 A;  4R5J A;  3I01 A;  3RV1 A;  4AZC B;  4R5I A;  3DYT A;  2X5C A;  2YKT A;  2O0I 1;  2OW6 A;  4EZT A;  1QWN A;  3ERC C;  3B51 X;  4FZO A;  2EFK A;  3O3N B;  3ACO A;  2RAK A;  2YL8 A;  1I4L A;  1TQT A;  2Z0V A;  3Q84 A;  4IWP A;  3ER9 B;  3QNI A;  2F1A A;  4HYB A;  4H8S A;  3CV5 A;  2D1L A;  4WPC A;  1SU6 A;  3BUB A;  2Z8Y A;  3KDR A;  1ZYL A;  4AZH A;  3D50 A;  4EZY A;  3O3O B;  3CAZ A;  2YIV X;  3O3M B;  2WYI A;  2OBM A;  4IWO A;  3DPQ A;  3BVT A;  3RPM A;  4AKV A;  3D4Z A;  2ND1 A;  4JWC A;  3QA8 A;  3VKH A;  3VEB A;  2PY6 A;  3T4A G;  1GNL A;  3PLT A;  3SOG A;  1SU7 A;  3M3W A;  2QKW A;  1R34 A;  3Q0K A;  4F00 A;  2ZXQ A;  1R33 A;  3BVW A;  2F1B A;  3D2F A;  1HXK A;  1MJG A;  4JLC A;  3GI7 A;  1E1D A;  2F7R A;  2X3V A;  2F7Q A;  3ER8 C;  3I2W A;  4EZO A;  2QFF A;  4R5L A;  3I39 X;  3CVR A;  4IM3 A;  4D8J A;  4AZB A;  3OHX M;  3HAJ A;  2JNS A;  2N3K A;  3T49 A;  1I49 A;  3CKD A;  5C5B B;  2YIB A;  4JWD A;  3DDG A;  4BNE A;  1URU A;  4E3C A;  3F7W A;  2ALW A;  3EJU A;  2NCZ A;  2MI7 A;  4EZS A;  1W9M A;  1QWU A;  4R5G A;  4AZC A;  2D4C A;  1OA1 A;  1SU8 A;  2FYV A;  3QWE A;  3DPO A;  1OAO A;  2X3X A;  3LLL A;  3C7N A;  2OZN B;  3EJT A; 
#chains in the Genus database with same CATH homology
 2PY6 A;  3T4A G;  1GNL A;  2WIN M;  4HY9 A;  3ZED A;  4JWE A;  3B52 X;  3DPP A;  1SU7 A;  3UIT A;  4B9Q A;  4JL9 A;  3FD9 A;  2GA9 D;  5E84 A;  4JNF A;  4F00 A;  4UDY X;  3OWG A;  4HR1 A;  1DKY A;  1OA0 A;  3D2E A;  4IWQ A;  4R5J A;  3I01 A;  3RV1 A;  3D2F A;  1E2U A;  4R5I A;  4EZQ A;  1DKZ A;  1MJG A;  3B53 X;  4JLC A;  4R5K A;  3GI7 A;  2YIA A;  5FIG A;  4F01 A;  1E1D A;  2X5C A;  3KAW A;  4EZP A;  3T48 A;  3ER8 C;  3LMF A;  4KIK B;  4EZT A;  4EZW A;  4EZO A;  3ERC C;  3B51 X;  4EZR A;  4JN4 A;  4H6H A;  2QFF A;  4R5L A;  3O3N B;  3I39 X;  3I04 A;  2GAF D;  2RT6 A;  1JQK A;  4H6I A;  3RV0 A;  4IM3 A;  4HR1 B;  2KHO A;  4EZU A;  4D8J A;  4EZZ A;  4JNE A;  4M0M A;  3OHX M;  4IWP A;  3ER9 B;  4PO2 A;  2JNS A;  1DKX A;  4HYB A;  3VEA A;  2N3K A;  3L3O M;  3T49 A;  1E9V A;  2YIB A;  4JWD A;  3T46 A;  4JWI A;  4EZN A;  2ND0 A;  4E81 A;  4E3C A;  1SU6 A;  5FLE X;  2OBL A;  3F7W A;  4EZX A;  2Z8Y A;  3KDR A;  1ZYL A;  4G6Q A;  3T47 A;  2YI8 A;  4EZY A;  4IW0 A;  3O3O B;  2NCZ A;  2EWF A;  4NPH A;  2YIV X;  2QXL A;  4EZV A;  3O3M B;  4EZS A;  2OBM A;  1GNT A;  4IWO A;  1W9M A;  2EX3 B;  3DPQ A;  5TKY A;  4R5G A;  1SUF A;  1OA1 A;  4IM2 A;  1SU8 A;  4UDX X;  1GN9 A;  3DPO A;  1OAO A;  4FM3 A;  1UPX A;  2ND1 A;  4JWC A;  3C7N A;  4IM0 A;  2LM0 A;  3QA8 A;  3A98 A;  3VKH A;  3KAV A;  3QNJ A;  4KIK A;  2YI9 A;  3VEB A;  1U00 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...