3QWEA

Crystal structure of the n-terminal domain of the gem interacting protein
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
273
structure length
260
Chain Sequence
GEELDLRLIRTKGGVDAALEYAKTWSRYAKELLAWTEKRASYELEFAKSTMKIAEAGKVSIQQQSHMPLQYIYTLFLEHDLSLGTLAMETVAQQKRDYYQPLAAKRTEIEKWRKEFKEQWMKEQKRMNEAVQALRRAQLQYVQRSEDLRARSQGSKQQERRRRSREEAQAKAQEAEALYQACVREANARQQDLEIAKQRIVSHVRKLVFQGDEVLRRVTLSLFGLRGAQAERGPRAFAALAECCAPFEPGQRYQEFVRAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords GEM-interacting protein
publication title Crystal structure of the N-terminal domain of the GEM interacting protein
rcsb
source organism Homo sapiens
total genus 126
structure length 260
sequence length 273
ec nomenclature
pdb deposition date 2011-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 3qweA00
1X04A 5C5BA 3ABHA 2C08A 3M3WA 3Q0KA 3Q84A 1I49A 4H8SA 3SYVA 1Y2OA 4DCNC 4DYLA 2X3VA 1WDZA 2D4CA 2Q13A 3I2WA 4NSWA 2EFKA 3HAHA 3LLLA 2YKTA 4BNEA 3QE6A 3CAZA 4WPCA 3PLTA 2Q12A 4FZSA 4AVMA 2Z0NA 3DYTA 3ACOA 5C5BB 2RAIA 4ATMA 1I4DA 1I4LA 1I4TA 3HAIA 4WPEA 3QWEA 2ELBA 2Z0VA 2D1LA 2Z0OA 4I1QA 2X3XA 3SOGA 2X3WA 3QNIA 2RAJA 2FICA 1X03A 3HAJA 2RAKA 4NQIA 1ZWWA 3G9GA 2EFLA 3OK8A 4AKVA 2V0OA 1URUA
chains in the Genus database with same CATH superfamily
4AZ6A 3B53X 2D4CA 3CAZA 2YL6A 3KAWA 4AZGA 4JN4A 2ALWA 3T46A 2OBLA 4IM3A 5FIGA 3EJRA 3C7NA 2YIAA 4EZVA 1HWWA 2F7OA 2O0I1 3EJSA 4FM3A 4UDYX 4JLCA 4R5GA 4EZWA 4F00A 2LM0A 2F7RA 4IWPA 3O3OB 2V0OA 3QNJA 4IM0A 1HXKA 3T47A 4NSWA 2F7QA 1E9VA 2OO2A 3I01A 3BVTA 3QA8A 3L3PA 4IWOA 4IM2A 1SU8A 2PMRA 1U00A 2NCZA 3HAJA 4NQIA 2ND0A 3OWGA 3Q0KA 1WDZA 3PLTA 4JWEA 2Z0NA 3DYTA 4R5LA 1E2UA 3BUBA 3DX0A 3T49A 2GA9D 2GAFD 4PO2A 2RT6A 4EZQA 4EZYA 1I49A 4AZ7A 4JL9A 5KBPA 1GNLA 2ND1A 3QE6A 5C5BB 2YL8A 2LXYA 3KAVA 2QXLA 1GN9A 3ER8C 2MI7A 1X03A 4E81A 1OAOA 1X04A 5C5BA 3ERCC 2OW6A 1Y2OA 2YL5A 2OZNB 5E84A 4WPCA 3RV0A 4M0MA 2YI8A 4EZTA 2PY6A 1YWMA 3DDFA 2EFLA 3OK8A 4F01A 3ABHA 3L3OM 2YLLA 2YLAA 3DX3A 3FD9A 3ER9B 4JWIA 4BNEA 1R33A 4JNFA 4EZSA 3DPQA 3D51A 3BUQA 3EJPA 4AZIA 3EJTA 4IW0A 2GF4A 3BVWA 3CZSA 1LQ7A 2ZXQA 3ZEDA 2F1BA 3BVXA 1SU7A 1TQUA 1ZYLA 3CV5A 2FYVA 2RAIA 4HR1B 2EWFA 1I4LA 3DX4A 4HY9A 3LVTA 2X3WA 4AZCB 4AZHA 4AKVA 4HR1A 2JNSA 3Q84A 4DYLA 4G6QA 1SU6A 4AZ5A 4AZCA 2YIVX 1UPXA 3KDRA 4R5JA 3EJQA 2X5CA 3HAIA 4AZBA 1MJGA 2X3XA 4EZOA 3BUIA 2OW7A 3DPPA 3G9GA 2F18A 1R34A 4EZUA 4EZRA 3VEAA 2EFKA 3CKDA 1HTYA 3UITA 1R5EA 3A98A 4R5KA 2F1AA 4FZSA 3DX2A 4JWCA 4FZOA 2EX3B 4KIKB 2ELBA 5TKYA 3QNIA 4EZZA 2RAJA 3B52X 1QX1A 1TQSA 3RV1A 1QWUA 2Q12A 4HYBA 1OA1A 3ACOA 3GI7A 2YIBA 2WYIA 2F7PA 3D2FA 3QWEA 4I1QA 1QWNA 3F7WA 2YL9A 4DCNC 3I2WA 4B9QA 2YI9A 2WYHA 1DKYA 1E1DA 4H6IA 3CVRA 2Z0VA 4EZXA 1URUA 3M3WA 4E3CA 4JWDA 4H8SA 3LMFA 2OBMA 2KHOA 2YKTA 2Z8YA 2QKWA 4R5IA 1TQWA 3DDGA 3DX1A 4WPEA 3D2EA 3B51X 3SOGA 3BVVA 2N3KA 4H6HA 4UDXX 3D52A 3D50A 3SYVA 3LLLA 3O3NB 3OHXM 4AVMA 4IWQA 3EJUA 4ATMA 3VKHA 1I4DA 2D1LA 1TQTA 3BUDA 4NPHA 2RAKA 1TQVA 4EZPA 3BLBA 2X3VA 3I04A 3HAHA 1O7DB 4EZNA 4JNEA 3T48A 5FLEX 3O3MB 2WINM 1SUFA 1OA0A 1JQKA 2FICA 1GNTA 1ZWWA 3I39X 1W9MA 3BVUA 2C08A 3DPOA 1DKXA 2Q13A 4KIKA 4D8JA 1O7DC 3VEBA 2QFFA 3T4AG 4FZPA 1PS3A 3CZNA 1I4TA 1DKZA 2Z0OA 3D4ZA 3RPMA 2JNKA 3D4YA 3BUPA
chains in the Genus database with same CATH topology
1X04A 5C5BA 3ABHA 2C08A 3M3WA 3Q0KA 3Q84A 1I49A 4H8SA 3SYVA 1Y2OA 4DCNC 4DYLA 2X3VA 1WDZA 2D4CA 2Q13A 3I2WA 4NSWA 2EFKA 3HAHA 3LLLA 2YKTA 4BNEA 3QE6A 3CAZA 4WPCA 3PLTA 2Q12A 4FZSA 4AVMA 2Z0NA 3DYTA 3ACOA 5C5BB 2RAIA 4ATMA 1I4DA 1I4LA 1I4TA 3HAIA 4WPEA 3QWEA 2ELBA 2Z0VA 2D1LA 2Z0OA 4I1QA 2X3XA 3SOGA 2X3WA 3QNIA 2RAJA 2FICA 1X03A 3HAJA 2RAKA 4NQIA 1ZWWA 3G9GA 2EFLA 3OK8A 4AKVA 2V0OA 1URUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X04 A;  5C5B A;  3ABH A;  2C08 A;  3M3W A;  3Q0K A;  3Q84 A;  1I49 A;  4H8S A;  3SYV A;  1Y2O A;  4DCN C;  4DYL A;  2X3V A;  1WDZ A;  2D4C A;  2Q13 A;  3I2W A;  4NSW A;  2EFK A;  3HAH A;  3LLL A;  2YKT A;  4BNE A;  3QE6 A;  3CAZ A;  4WPC A;  3PLT A;  2Q12 A;  4FZS A;  4AVM A;  2Z0N A;  3DYT A;  3ACO A;  5C5B B;  2RAI A;  4ATM A;  1I4D A;  1I4L A;  1I4T A;  3HAI A;  4WPE A;  3QWE A;  2ELB A;  2Z0V A;  2D1L A;  2Z0O A;  4I1Q A;  2X3X A;  3SOG A;  2X3W A;  3QNI A;  2RAJ A;  2FIC A;  1X03 A;  3HAJ A;  2RAK A;  4NQI A;  1ZWW A;  3G9G A;  2EFL A;  3OK8 A;  4AKV A;  2V0O A;  1URU A; 
#chains in the Genus database with same CATH topology
 4AZ6 A;  3B53 X;  2D4C A;  3CAZ A;  2YL6 A;  3KAW A;  4AZG A;  4JN4 A;  2ALW A;  3T46 A;  2OBL A;  4IM3 A;  5FIG A;  3EJR A;  3C7N A;  2YIA A;  4EZV A;  1HWW A;  2F7O A;  2O0I 1;  3EJS A;  4FM3 A;  4UDY X;  4JLC A;  4R5G A;  4EZW A;  4F00 A;  2LM0 A;  2F7R A;  4IWP A;  3O3O B;  2V0O A;  3QNJ A;  4IM0 A;  1HXK A;  3T47 A;  4NSW A;  2F7Q A;  1E9V A;  2OO2 A;  3I01 A;  3BVT A;  3QA8 A;  3L3P A;  4IWO A;  4IM2 A;  1SU8 A;  2PMR A;  1U00 A;  2NCZ A;  3HAJ A;  4NQI A;  2ND0 A;  3OWG A;  3Q0K A;  1WDZ A;  3PLT A;  4JWE A;  2Z0N A;  3DYT A;  4R5L A;  1E2U A;  3BUB A;  3DX0 A;  3T49 A;  2GA9 D;  2GAF D;  4PO2 A;  2RT6 A;  4EZQ A;  4EZY A;  1I49 A;  4AZ7 A;  4JL9 A;  5KBP A;  1GNL A;  2ND1 A;  3QE6 A;  5C5B B;  2YL8 A;  2LXY A;  3KAV A;  2QXL A;  1GN9 A;  3ER8 C;  2MI7 A;  1X03 A;  4E81 A;  1OAO A;  1X04 A;  5C5B A;  3ERC C;  2OW6 A;  1Y2O A;  2YL5 A;  2OZN B;  5E84 A;  4WPC A;  3RV0 A;  4M0M A;  2YI8 A;  4EZT A;  2PY6 A;  1YWM A;  3DDF A;  2EFL A;  3OK8 A;  4F01 A;  3ABH A;  3L3O M;  2YLL A;  2YLA A;  3DX3 A;  3FD9 A;  3ER9 B;  4JWI A;  4BNE A;  1R33 A;  4JNF A;  4EZS A;  3DPQ A;  3D51 A;  3BUQ A;  3EJP A;  4AZI A;  3EJT A;  4IW0 A;  2GF4 A;  3BVW A;  3CZS A;  1LQ7 A;  2ZXQ A;  3ZED A;  2F1B A;  3BVX A;  1SU7 A;  1TQU A;  1ZYL A;  3CV5 A;  2FYV A;  2RAI A;  4HR1 B;  2EWF A;  1I4L A;  3DX4 A;  4HY9 A;  3LVT A;  2X3W A;  4AZC B;  4AZH A;  4AKV A;  4HR1 A;  2JNS A;  3Q84 A;  4DYL A;  4G6Q A;  1SU6 A;  4AZ5 A;  4AZC A;  2YIV X;  1UPX A;  3KDR A;  4R5J A;  3EJQ A;  2X5C A;  3HAI A;  4AZB A;  1MJG A;  2X3X A;  4EZO A;  3BUI A;  2OW7 A;  3DPP A;  3G9G A;  2F18 A;  1R34 A;  4EZU A;  4EZR A;  3VEA A;  2EFK A;  3CKD A;  1HTY A;  3UIT A;  1R5E A;  3A98 A;  4R5K A;  2F1A A;  4FZS A;  3DX2 A;  4JWC A;  4FZO A;  2EX3 B;  4KIK B;  2ELB A;  5TKY A;  3QNI A;  4EZZ A;  2RAJ A;  3B52 X;  1QX1 A;  1TQS A;  3RV1 A;  1QWU A;  2Q12 A;  4HYB A;  1OA1 A;  3ACO A;  3GI7 A;  2YIB A;  2WYI A;  2F7P A;  3D2F A;  3QWE A;  4I1Q A;  1QWN A;  3F7W A;  2YL9 A;  4DCN C;  3I2W A;  4B9Q A;  2YI9 A;  2WYH A;  1DKY A;  1E1D A;  4H6I A;  3CVR A;  2Z0V A;  4EZX A;  1URU A;  3M3W A;  4E3C A;  4JWD A;  4H8S A;  3LMF A;  2OBM A;  2KHO A;  2YKT A;  2Z8Y A;  2QKW A;  4R5I A;  1TQW A;  3DDG A;  3DX1 A;  4WPE A;  3D2E A;  3B51 X;  3SOG A;  3BVV A;  2N3K A;  4H6H A;  4UDX X;  3D52 A;  3D50 A;  3SYV A;  3LLL A;  3O3N B;  3OHX M;  4AVM A;  4IWQ A;  3EJU A;  4ATM A;  3VKH A;  1I4D A;  2D1L A;  1TQT A;  3BUD A;  4NPH A;  2RAK A;  1TQV A;  4EZP A;  3BLB A;  2X3V A;  3I04 A;  3HAH A;  1O7D B;  4EZN A;  4JNE A;  3T48 A;  5FLE X;  3O3M B;  2WIN M;  1SUF A;  1OA0 A;  1JQK A;  2FIC A;  1GNT A;  1ZWW A;  3I39 X;  1W9M A;  3BVU A;  2C08 A;  3DPO A;  1DKX A;  2Q13 A;  4KIK A;  4D8J A;  1O7D C;  3VEB A;  2QFF A;  3T4A G;  4FZP A;  1PS3 A;  3CZN A;  1I4T A;  1DKZ A;  2Z0O A;  3D4Z A;  3RPM A;  2JNK A;  3D4Y A;  3BUP A; 
#chains in the Genus database with same CATH homology
 1X04 A;  5C5B A;  3ABH A;  2C08 A;  3M3W A;  3Q0K A;  3Q84 A;  1I49 A;  4H8S A;  3SYV A;  1Y2O A;  4DCN C;  4DYL A;  2X3V A;  1WDZ A;  2D4C A;  2Q13 A;  3I2W A;  4NSW A;  2EFK A;  3HAH A;  3LLL A;  2YKT A;  4BNE A;  3QE6 A;  3CAZ A;  4WPC A;  3PLT A;  2Q12 A;  4FZS A;  4AVM A;  2Z0N A;  3DYT A;  3ACO A;  5C5B B;  2RAI A;  4ATM A;  1I4D A;  1I4L A;  1I4T A;  3HAI A;  4WPE A;  3QWE A;  2ELB A;  2Z0V A;  2D1L A;  2Z0O A;  4I1Q A;  2X3X A;  3SOG A;  2X3W A;  3QNI A;  2RAJ A;  2FIC A;  1X03 A;  3HAJ A;  2RAK A;  4NQI A;  1ZWW A;  3G9G A;  2EFL A;  3OK8 A;  4AKV A;  2V0O A;  1URU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...