1I4TA

Crystal structure analysis of rac1-gmppnp in complex with arfaptin
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
195
structure length
180
Chain Sequence
SRTVDLELELQIELLRETKRKYESVLQLGRALTAHLYSLLQTQHALGDAFADLSQKSPELQEEFGYNAETQKLLCKNGETLLGAVNFFVSSINTLVTKTMEDTLMTVKQYEAARLEYDAYRTDLEELSLGPRDAGRDKYEKLRGDVAIKLKFLEENKIKVMHKQLLLFHNAVSAYFAGNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARFAPTIN 2
publication title The structural basis of Arfaptin-mediated cross-talk between Rac and Arf signalling pathways.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 83
structure length 180
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-02-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 1i4tA00
1Y2OA 3OK8A 4WPEA 3G9GA 1ZWWA 3QWEA 4I1QA 3QNIA 2EFLA 2X3WA 2Z0VA 3DYTA 2RAIA 3I2WA 3HAIA 2Q12A 4H8SA 3HAJA 1I49A 2Q13A 2D4CA 3ABHA 3ACOA 3QE6A 4NSWA 4DCNC 1X04A 2FICA 4FZSA 1I4LA 4NQIA 1WDZA 2YKTA 3SYVA 5C5BA 2D1LA 4WPCA 2RAKA 5C5BB 1URUA 4AVMA 3PLTA 2ELBA 2X3XA 2Z0NA 3Q0KA 4BNEA 3CAZA 4ATMA 2Z0OA 3HAHA 4AKVA 3M3WA 1X03A 3SOGA 1I4TA 2X3VA 2V0OA 3Q84A 4DYLA 3LLLA 2RAJA 2EFKA 1I4DA 2C08A
chains in the Genus database with same CATH superfamily
4I1QA 3RV0A 3ACOA 1R34A 2YLAA 4HYBA 2OW7A 4FZSA 3UITA 4WPCA 2RAKA 4EZTA 1TQSA 1QWNA 4AZ7A 2V0OA 1UPXA 2FYVA 1ZYLA 2YI9A 4IW0A 4AZGA 3ER8C 3I2WA 3DPPA 2F7QA 3ZEDA 3RPMA 1URUA 4JWIA 4AVMA 3M3WA 3LLLA 4JNFA 3D51A 4WPEA 2F7PA 3G9GA 4EZVA 3I04A 3DDGA 2GF4A 3Q0KA 3B52X 2PY6A 3B51X 3D2FA 1I4DA 2OBLA 3KDRA 2F1BA 4EZRA 4JNEA 2Q13A 1SU7A 1R5EA 2WINM 4H6IA 4DCNC 4JWDA 4B9QA 3CVRA 3DX1A 3QA8A 2WYIA 4JWEA 1SU8A 2NCZA 1ZWWA 3QNIA 2KHOA 4NPHA 1OAOA 3FD9A 3BUIA 3VKHA 3CAZA 3CV5A 4EZOA 2F7RA 3OWGA 4EZZA 3LVTA 2YLLA 2EFLA 3O3OB 1O7DC 4F00A 4EZYA 2Z8YA 2WYHA 4NQIA 3KAWA 4E3CA 1OA0A 2EWFA 2ALWA 1PS3A 4EZSA 2OBMA 3OK8A 4R5LA 2Z0VA 1SU6A 3CZSA 3HAJA 4R5GA 4M0MA 3I01A 1I4LA 3BUDA 2YKTA 4IWOA 2QKWA 3BUBA 1TQVA 3L3OM 3PLTA 2X3XA 2PMRA 2Z0OA 4E81A 1HXKA 2LM0A 3VEBA 3RV1A 1U00A 2C08A 1HWWA 1LQ7A 3LMFA 4JL9A 4H6HA 3CKDA 4R5KA 2RAIA 1JQKA 1DKYA 2LXYA 1I49A 2JNKA 4NSWA 3SYVA 3BVUA 1O7DB 5C5BA 1TQTA 2ELBA 3OHXM 4G6QA 1HTYA 3DPOA 3BVTA 4UDXX 2EFKA 3D52A 3F7WA 3QWEA 2F18A 4R5IA 3VEAA 3B53X 3BVXA 3BLBA 3L3PA 2Z0NA 3DX4A 2YIAA 2EX3B 2YI8A 4JLCA 2RT6A 4HR1B 4AZ6A 1X03A 1QX1A 3DDFA 5TKYA 3EJSA 4EZXA 1YWMA 3I39X 3DX0A 4FZPA 3ABHA 2QFFA 3A98A 1GN9A 4IWQA 4EZQA 3D4YA 1I4TA 4EZWA 3Q84A 3C7NA 2JNSA 4KIKB 3ER9B 4IM0A 1E2UA 3EJUA 5KBPA 2Q12A 2D4CA 1E9VA 4IWPA 3T48A 2D1LA 4HY9A 3DPQA 4PO2A 3EJRA 3O3NB 4JN4A 1OA1A 4AKVA 2YL9A 4JWCA 4AZIA 2RAJA 4AZCB 3BVVA 2GAFD 1DKZA 3ERCC 4FM3A 4FZOA 2X3WA 1DKXA 4UDYX 4EZUA 3QE6A 2O0I1 1WDZA 2MI7A 3QNJA 3KAVA 4BNEA 4HR1A 4R5JA 1GNTA 4EZPA 5FIGA 4AZBA 2ND1A 3EJQA 3HAIA 4H8SA 2N3KA 1X04A 3DX3A 2OW6A 1GNLA 3T47A 1SUFA 2X3VA 4KIKA 5E84A 2GA9D 1E1DA 1Y2OA 4D8JA 2F1AA 3D2EA 4F01A 3CZNA 4EZNA 3GI7A 3D4ZA 2YL5A 2ZXQA 2F7OA 4AZCA 4IM2A 3T4AG 1W9MA 3T49A 1TQWA 3DX2A 1QWUA 3DYTA 2OO2A 2YIBA 4IM3A 3T46A 3BVWA 2FICA 2YL6A 3O3MB 2YL8A 1TQUA 3D50A 4ATMA 3BUQA 2YIVX 3EJTA 2ND0A 3EJPA 4AZHA 4AZ5A 2X5CA 2OZNB 5C5BB 3HAHA 1R33A 1MJGA 3SOGA 2QXLA 4DYLA 5FLEX 3BUPA
chains in the Genus database with same CATH topology
1Y2OA 3OK8A 4WPEA 3G9GA 1ZWWA 3QWEA 4I1QA 3QNIA 2EFLA 2X3WA 2Z0VA 3DYTA 2RAIA 3I2WA 3HAIA 2Q12A 4H8SA 3HAJA 1I49A 2Q13A 2D4CA 3ABHA 3ACOA 3QE6A 4NSWA 4DCNC 1X04A 2FICA 4FZSA 1I4LA 4NQIA 1WDZA 2YKTA 3SYVA 5C5BA 2D1LA 4WPCA 2RAKA 5C5BB 1URUA 4AVMA 3PLTA 2ELBA 2X3XA 2Z0NA 3Q0KA 4BNEA 3CAZA 4ATMA 2Z0OA 3HAHA 4AKVA 3M3WA 1X03A 3SOGA 1I4TA 2X3VA 2V0OA 3Q84A 4DYLA 3LLLA 2RAJA 2EFKA 1I4DA 2C08A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y2O A;  3OK8 A;  4WPE A;  3G9G A;  1ZWW A;  3QWE A;  4I1Q A;  3QNI A;  2EFL A;  2X3W A;  2Z0V A;  3DYT A;  2RAI A;  3I2W A;  3HAI A;  2Q12 A;  4H8S A;  3HAJ A;  1I49 A;  2Q13 A;  2D4C A;  3ABH A;  3ACO A;  3QE6 A;  4NSW A;  4DCN C;  1X04 A;  2FIC A;  4FZS A;  1I4L A;  4NQI A;  1WDZ A;  2YKT A;  3SYV A;  5C5B A;  2D1L A;  4WPC A;  2RAK A;  5C5B B;  1URU A;  4AVM A;  3PLT A;  2ELB A;  2X3X A;  2Z0N A;  3Q0K A;  4BNE A;  3CAZ A;  4ATM A;  2Z0O A;  3HAH A;  4AKV A;  3M3W A;  1X03 A;  3SOG A;  1I4T A;  2X3V A;  2V0O A;  3Q84 A;  4DYL A;  3LLL A;  2RAJ A;  2EFK A;  1I4D A;  2C08 A; 
#chains in the Genus database with same CATH topology
 4I1Q A;  3RV0 A;  3ACO A;  1R34 A;  2YLA A;  4HYB A;  2OW7 A;  4FZS A;  3UIT A;  4WPC A;  2RAK A;  4EZT A;  1TQS A;  1QWN A;  4AZ7 A;  2V0O A;  1UPX A;  2FYV A;  1ZYL A;  2YI9 A;  4IW0 A;  4AZG A;  3ER8 C;  3I2W A;  3DPP A;  2F7Q A;  3ZED A;  3RPM A;  1URU A;  4JWI A;  4AVM A;  3M3W A;  3LLL A;  4JNF A;  3D51 A;  4WPE A;  2F7P A;  3G9G A;  4EZV A;  3I04 A;  3DDG A;  2GF4 A;  3Q0K A;  3B52 X;  2PY6 A;  3B51 X;  3D2F A;  1I4D A;  2OBL A;  3KDR A;  2F1B A;  4EZR A;  4JNE A;  2Q13 A;  1SU7 A;  1R5E A;  2WIN M;  4H6I A;  4DCN C;  4JWD A;  4B9Q A;  3CVR A;  3DX1 A;  3QA8 A;  2WYI A;  4JWE A;  1SU8 A;  2NCZ A;  1ZWW A;  3QNI A;  2KHO A;  4NPH A;  1OAO A;  3FD9 A;  3BUI A;  3VKH A;  3CAZ A;  3CV5 A;  4EZO A;  2F7R A;  3OWG A;  4EZZ A;  3LVT A;  2YLL A;  2EFL A;  3O3O B;  1O7D C;  4F00 A;  4EZY A;  2Z8Y A;  2WYH A;  4NQI A;  3KAW A;  4E3C A;  1OA0 A;  2EWF A;  2ALW A;  1PS3 A;  4EZS A;  2OBM A;  3OK8 A;  4R5L A;  2Z0V A;  1SU6 A;  3CZS A;  3HAJ A;  4R5G A;  4M0M A;  3I01 A;  1I4L A;  3BUD A;  2YKT A;  4IWO A;  2QKW A;  3BUB A;  1TQV A;  3L3O M;  3PLT A;  2X3X A;  2PMR A;  2Z0O A;  4E81 A;  1HXK A;  2LM0 A;  3VEB A;  3RV1 A;  1U00 A;  2C08 A;  1HWW A;  1LQ7 A;  3LMF A;  4JL9 A;  4H6H A;  3CKD A;  4R5K A;  2RAI A;  1JQK A;  1DKY A;  2LXY A;  1I49 A;  2JNK A;  4NSW A;  3SYV A;  3BVU A;  1O7D B;  5C5B A;  1TQT A;  2ELB A;  3OHX M;  4G6Q A;  1HTY A;  3DPO A;  3BVT A;  4UDX X;  2EFK A;  3D52 A;  3F7W A;  3QWE A;  2F18 A;  4R5I A;  3VEA A;  3B53 X;  3BVX A;  3BLB A;  3L3P A;  2Z0N A;  3DX4 A;  2YIA A;  2EX3 B;  2YI8 A;  4JLC A;  2RT6 A;  4HR1 B;  4AZ6 A;  1X03 A;  1QX1 A;  3DDF A;  5TKY A;  3EJS A;  4EZX A;  1YWM A;  3I39 X;  3DX0 A;  4FZP A;  3ABH A;  2QFF A;  3A98 A;  1GN9 A;  4IWQ A;  4EZQ A;  3D4Y A;  1I4T A;  4EZW A;  3Q84 A;  3C7N A;  2JNS A;  4KIK B;  3ER9 B;  4IM0 A;  1E2U A;  3EJU A;  5KBP A;  2Q12 A;  2D4C A;  1E9V A;  4IWP A;  3T48 A;  2D1L A;  4HY9 A;  3DPQ A;  4PO2 A;  3EJR A;  3O3N B;  4JN4 A;  1OA1 A;  4AKV A;  2YL9 A;  4JWC A;  4AZI A;  2RAJ A;  4AZC B;  3BVV A;  2GAF D;  1DKZ A;  3ERC C;  4FM3 A;  4FZO A;  2X3W A;  1DKX A;  4UDY X;  4EZU A;  3QE6 A;  2O0I 1;  1WDZ A;  2MI7 A;  3QNJ A;  3KAV A;  4BNE A;  4HR1 A;  4R5J A;  1GNT A;  4EZP A;  5FIG A;  4AZB A;  2ND1 A;  3EJQ A;  3HAI A;  4H8S A;  2N3K A;  1X04 A;  3DX3 A;  2OW6 A;  1GNL A;  3T47 A;  1SUF A;  2X3V A;  4KIK A;  5E84 A;  2GA9 D;  1E1D A;  1Y2O A;  4D8J A;  2F1A A;  3D2E A;  4F01 A;  3CZN A;  4EZN A;  3GI7 A;  3D4Z A;  2YL5 A;  2ZXQ A;  2F7O A;  4AZC A;  4IM2 A;  3T4A G;  1W9M A;  3T49 A;  1TQW A;  3DX2 A;  1QWU A;  3DYT A;  2OO2 A;  2YIB A;  4IM3 A;  3T46 A;  3BVW A;  2FIC A;  2YL6 A;  3O3M B;  2YL8 A;  1TQU A;  3D50 A;  4ATM A;  3BUQ A;  2YIV X;  3EJT A;  2ND0 A;  3EJP A;  4AZH A;  4AZ5 A;  2X5C A;  2OZN B;  5C5B B;  3HAH A;  1R33 A;  1MJG A;  3SOG A;  2QXL A;  4DYL A;  5FLE X;  3BUP A; 
#chains in the Genus database with same CATH homology
 1Y2O A;  3OK8 A;  4WPE A;  3G9G A;  1ZWW A;  3QWE A;  4I1Q A;  3QNI A;  2EFL A;  2X3W A;  2Z0V A;  3DYT A;  2RAI A;  3I2W A;  3HAI A;  2Q12 A;  4H8S A;  3HAJ A;  1I49 A;  2Q13 A;  2D4C A;  3ABH A;  3ACO A;  3QE6 A;  4NSW A;  4DCN C;  1X04 A;  2FIC A;  4FZS A;  1I4L A;  4NQI A;  1WDZ A;  2YKT A;  3SYV A;  5C5B A;  2D1L A;  4WPC A;  2RAK A;  5C5B B;  1URU A;  4AVM A;  3PLT A;  2ELB A;  2X3X A;  2Z0N A;  3Q0K A;  4BNE A;  3CAZ A;  4ATM A;  2Z0O A;  3HAH A;  4AKV A;  3M3W A;  1X03 A;  3SOG A;  1I4T A;  2X3V A;  2V0O A;  3Q84 A;  4DYL A;  3LLL A;  2RAJ A;  2EFK A;  1I4D A;  2C08 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...