1I4TA

Crystal structure analysis of rac1-gmppnp in complex with arfaptin
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
195
structure length
180
Chain Sequence
SRTVDLELELQIELLRETKRKYESVLQLGRALTAHLYSLLQTQHALGDAFADLSQKSPELQEEFGYNAETQKLLCKNGETLLGAVNFFVSSINTLVTKTMEDTLMTVKQYEAARLEYDAYRTDLEELSLGPRDAGRDKYEKLRGDVAIKLKFLEENKIKVMHKQLLLFHNAVSAYFAGNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords ARFAPTIN 2
publication title The structural basis of Arfaptin-mediated cross-talk between Rac and Arf signalling pathways.
pubmed doi rcsb
source organism Homo sapiens
total genus 83
structure length 180
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-02-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 1i4tA00
3DYTA 3QE6A 2RAJA 1I4TA 3CAZA 1I4DA 4I1QA 4AVMA 4AKVA 5C5BB 4DYLA 3LLLA 3OK8A 2EFLA 2C08A 3HAHA 3ACOA 1ZWWA 4FZSA 2ELBA 2YKTA 3I2WA 4BNEA 1I4LA 3Q84A 4ATMA 2Z0NA 2Q12A 3Q0KA 3HAJA 3SOGA 1URUA 3G9GA 2FICA 2V0OA 2X3WA 2Z0VA 2RAIA 4H8SA 4WPCA 5C5BA 4NQIA 2D1LA 2EFKA 2Q13A 1X03A 3QNIA 2Z0OA 3ABHA 2X3XA 2RAKA 4NSWA 3SYVA 3HAIA 3QWEA 2X3VA 4WPEA 1WDZA 3M3WA 1X04A 2D4CA 3PLTA 1Y2OA 4DCNC 1I49A
chains in the Genus database with same CATH superfamily
1PS3A 3B52X 3BUBA 3EJPA 4EZUA 4AZCA 4AZIA 1DKZA 2YKTA 5FIGA 2Q12A 4HR1B 3G9GA 4IM2A 2KHOA 1TQWA 2OW7A 3FD9A 3ERCC 4JL9A 3T46A 4R5GA 3BUIA 3RV0A 4EZTA 3I2WA 4ATMA 3KAWA 2V0OA 2X3WA 3BUQA 4EZNA 2QFFA 2X3XA 2RAKA 4F00A 3T47A 2WYHA 3D2FA 3RPMA 4UDYX 3DDGA 2RAIA 2YI9A 1GNLA 2D1LA 1E1DA 1GNTA 4H6HA 4R5LA 4G6QA 4JWIA 1I49A 3QE6A 4DCNC 1TQUA 2EX3B 3OHXM 1QWUA 1OAOA 4JNEA 2WYIA 3QNIA 2YLAA 3M3WA 2O0I1 1QWNA 3ACOA 4FZSA 2QKWA 3Q0KA 3SOGA 1URUA 4E3CA 3DX3A 3D4YA 5C5BA 3EJRA 3DX4A 1E2UA 4JNFA 2X3VA 4EZPA 2ZXQA 3BVXA 3EJSA 3ER9B 1O7DB 3CKDA 2F7RA 3UITA 3D52A 3BUPA 1O7DC 2Q13A 2YIAA 2ALWA 3HAIA 4EZSA 1WDZA 3BLBA 3GI7A 3CAZA 3CVRA 2OZNB 4KIKA 3CV5A 1YWMA 2ND0A 3Q84A 2FYVA 4EZQA 3C7NA 3LMFA 2F7QA 1W9MA 2PY6A 2ND1A 3DPQA 4AZ7A 3VKHA 4IM0A 3I01A 1OA0A 2ELBA 3T4AG 4BNEA 1I4LA 2WINM 3DX0A 5FLEX 3EJQA 4EZOA 3L3PA 3KAVA 4NQIA 1SU7A 2OO2A 4HR1A 2OBLA 4F01A 4B9QA 1HTYA 1OA1A 4I1QA 2LXYA 5KBPA 5C5BB 1UPXA 1TQTA 4HY9A 3BVTA 1DKYA 2GF4A 2OBMA 4H6IA 3BVWA 4AZGA 2MI7A 2Z0NA 3O3NB 1JQKA 2FICA 2YL9A 4AZHA 5E84A 2Z0OA 4D8JA 3SYVA 1TQSA 2N3KA 3QWEA 4AZCB 2Z8YA 4E81A 2C08A 2X5CA 1ZWWA 3O3MB 3L3OM 3A98A 5TKYA 3T48A 2Z0VA 3BVVA 2RT6A 3DX1A 1X03A 1QX1A 3O3OB 4KIKB 4IWOA 4IWQA 3VEAA 3QA8A 1I4TA 4JWCA 4UDXX 3LVTA 4IWPA 4EZXA 1HWWA 2YI8A 2YIVX 2YIBA 3DPOA 3CZSA 4JWDA 4HYBA 2F1AA 1U00A 2PMRA 4JLCA 1LQ7A 3VEBA 2NCZA 4EZYA 3D2EA 2RAJA 4JWEA 4NPHA 1I4DA 2YL6A 3D51A 1DKXA 2GAFD 3D4ZA 4AZBA 4H8SA 2JNSA 1GN9A 2QXLA 4FM3A 3CZNA 4EZVA 3PLTA 2GA9D 3DYTA 1TQVA 2EWFA 4DYLA 3ZEDA 3KDRA 3DDFA 2EFLA 2YLLA 3B51X 1SU8A 4EZWA 4PO2A 3DX2A 1E9VA 1SU6A 1R5EA 2OW6A 2F7OA 1X04A 4IM3A 3EJUA 3QNJA 4AKVA 4EZZA 3LLLA 3HAHA 4JN4A 4R5IA 4AZ6A 3F7WA 3BVUA 1MJGA 3ER8C 3HAJA 3D50A 3EJTA 2F7PA 4WPCA 3ABHA 4NSWA 1HXKA 1ZYLA 3I39X 3B53X 2D4CA 1Y2OA 3OK8A 3T49A 1R34A 2JNKA 4R5KA 2EFKA 4AZ5A 3I04A 2F18A 4FZOA 1R33A 4IW0A 1SUFA 4AVMA 2YL8A 2YL5A 3BUDA 2F1BA 4FZPA 4M0MA 3RV1A 4EZRA 4R5JA 3DPPA 2LM0A 4WPEA 3OWGA
chains in the Genus database with same CATH topology
3DYTA 3QE6A 2RAJA 1I4TA 3CAZA 1I4DA 4I1QA 4AVMA 4AKVA 5C5BB 4DYLA 3LLLA 3OK8A 2EFLA 2C08A 3HAHA 3ACOA 1ZWWA 4FZSA 2ELBA 2YKTA 3I2WA 4BNEA 1I4LA 3Q84A 4ATMA 2Z0NA 2Q12A 3Q0KA 3HAJA 3SOGA 1URUA 3G9GA 2FICA 2V0OA 2X3WA 2Z0VA 2RAIA 4H8SA 4WPCA 5C5BA 4NQIA 2D1LA 2EFKA 2Q13A 1X03A 3QNIA 2Z0OA 3ABHA 2X3XA 2RAKA 4NSWA 3SYVA 3HAIA 3QWEA 2X3VA 4WPEA 1WDZA 3M3WA 1X04A 2D4CA 3PLTA 1Y2OA 4DCNC 1I49A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DYT A;  3QE6 A;  2RAJ A;  1I4T A;  3CAZ A;  1I4D A;  4I1Q A;  4AVM A;  4AKV A;  5C5B B;  4DYL A;  3LLL A;  3OK8 A;  2EFL A;  2C08 A;  3HAH A;  3ACO A;  1ZWW A;  4FZS A;  2ELB A;  2YKT A;  3I2W A;  4BNE A;  1I4L A;  3Q84 A;  4ATM A;  2Z0N A;  2Q12 A;  3Q0K A;  3HAJ A;  3SOG A;  1URU A;  3G9G A;  2FIC A;  2V0O A;  2X3W A;  2Z0V A;  2RAI A;  4H8S A;  4WPC A;  5C5B A;  4NQI A;  2D1L A;  2EFK A;  2Q13 A;  1X03 A;  3QNI A;  2Z0O A;  3ABH A;  2X3X A;  2RAK A;  4NSW A;  3SYV A;  3HAI A;  3QWE A;  2X3V A;  4WPE A;  1WDZ A;  3M3W A;  1X04 A;  2D4C A;  3PLT A;  1Y2O A;  4DCN C;  1I49 A; 
#chains in the Genus database with same CATH topology
 1PS3 A;  3B52 X;  3BUB A;  3EJP A;  4EZU A;  4AZC A;  4AZI A;  1DKZ A;  2YKT A;  5FIG A;  2Q12 A;  4HR1 B;  3G9G A;  4IM2 A;  2KHO A;  1TQW A;  2OW7 A;  3FD9 A;  3ERC C;  4JL9 A;  3T46 A;  4R5G A;  3BUI A;  3RV0 A;  4EZT A;  3I2W A;  4ATM A;  3KAW A;  2V0O A;  2X3W A;  3BUQ A;  4EZN A;  2QFF A;  2X3X A;  2RAK A;  4F00 A;  3T47 A;  2WYH A;  3D2F A;  3RPM A;  4UDY X;  3DDG A;  2RAI A;  2YI9 A;  1GNL A;  2D1L A;  1E1D A;  1GNT A;  4H6H A;  4R5L A;  4G6Q A;  4JWI A;  1I49 A;  3QE6 A;  4DCN C;  1TQU A;  2EX3 B;  3OHX M;  1QWU A;  1OAO A;  4JNE A;  2WYI A;  3QNI A;  2YLA A;  3M3W A;  2O0I 1;  1QWN A;  3ACO A;  4FZS A;  2QKW A;  3Q0K A;  3SOG A;  1URU A;  4E3C A;  3DX3 A;  3D4Y A;  5C5B A;  3EJR A;  3DX4 A;  1E2U A;  4JNF A;  2X3V A;  4EZP A;  2ZXQ A;  3BVX A;  3EJS A;  3ER9 B;  1O7D B;  3CKD A;  2F7R A;  3UIT A;  3D52 A;  3BUP A;  1O7D C;  2Q13 A;  2YIA A;  2ALW A;  3HAI A;  4EZS A;  1WDZ A;  3BLB A;  3GI7 A;  3CAZ A;  3CVR A;  2OZN B;  4KIK A;  3CV5 A;  1YWM A;  2ND0 A;  3Q84 A;  2FYV A;  4EZQ A;  3C7N A;  3LMF A;  2F7Q A;  1W9M A;  2PY6 A;  2ND1 A;  3DPQ A;  4AZ7 A;  3VKH A;  4IM0 A;  3I01 A;  1OA0 A;  2ELB A;  3T4A G;  4BNE A;  1I4L A;  2WIN M;  3DX0 A;  5FLE X;  3EJQ A;  4EZO A;  3L3P A;  3KAV A;  4NQI A;  1SU7 A;  2OO2 A;  4HR1 A;  2OBL A;  4F01 A;  4B9Q A;  1HTY A;  1OA1 A;  4I1Q A;  2LXY A;  5KBP A;  5C5B B;  1UPX A;  1TQT A;  4HY9 A;  3BVT A;  1DKY A;  2GF4 A;  2OBM A;  4H6I A;  3BVW A;  4AZG A;  2MI7 A;  2Z0N A;  3O3N B;  1JQK A;  2FIC A;  2YL9 A;  4AZH A;  5E84 A;  2Z0O A;  4D8J A;  3SYV A;  1TQS A;  2N3K A;  3QWE A;  4AZC B;  2Z8Y A;  4E81 A;  2C08 A;  2X5C A;  1ZWW A;  3O3M B;  3L3O M;  3A98 A;  5TKY A;  3T48 A;  2Z0V A;  3BVV A;  2RT6 A;  3DX1 A;  1X03 A;  1QX1 A;  3O3O B;  4KIK B;  4IWO A;  4IWQ A;  3VEA A;  3QA8 A;  1I4T A;  4JWC A;  4UDX X;  3LVT A;  4IWP A;  4EZX A;  1HWW A;  2YI8 A;  2YIV X;  2YIB A;  3DPO A;  3CZS A;  4JWD A;  4HYB A;  2F1A A;  1U00 A;  2PMR A;  4JLC A;  1LQ7 A;  3VEB A;  2NCZ A;  4EZY A;  3D2E A;  2RAJ A;  4JWE A;  4NPH A;  1I4D A;  2YL6 A;  3D51 A;  1DKX A;  2GAF D;  3D4Z A;  4AZB A;  4H8S A;  2JNS A;  1GN9 A;  2QXL A;  4FM3 A;  3CZN A;  4EZV A;  3PLT A;  2GA9 D;  3DYT A;  1TQV A;  2EWF A;  4DYL A;  3ZED A;  3KDR A;  3DDF A;  2EFL A;  2YLL A;  3B51 X;  1SU8 A;  4EZW A;  4PO2 A;  3DX2 A;  1E9V A;  1SU6 A;  1R5E A;  2OW6 A;  2F7O A;  1X04 A;  4IM3 A;  3EJU A;  3QNJ A;  4AKV A;  4EZZ A;  3LLL A;  3HAH A;  4JN4 A;  4R5I A;  4AZ6 A;  3F7W A;  3BVU A;  1MJG A;  3ER8 C;  3HAJ A;  3D50 A;  3EJT A;  2F7P A;  4WPC A;  3ABH A;  4NSW A;  1HXK A;  1ZYL A;  3I39 X;  3B53 X;  2D4C A;  1Y2O A;  3OK8 A;  3T49 A;  1R34 A;  2JNK A;  4R5K A;  2EFK A;  4AZ5 A;  3I04 A;  2F18 A;  4FZO A;  1R33 A;  4IW0 A;  1SUF A;  4AVM A;  2YL8 A;  2YL5 A;  3BUD A;  2F1B A;  4FZP A;  4M0M A;  3RV1 A;  4EZR A;  4R5J A;  3DPP A;  2LM0 A;  4WPE A;  3OWG A; 
#chains in the Genus database with same CATH homology
 3DYT A;  3QE6 A;  2RAJ A;  1I4T A;  3CAZ A;  1I4D A;  4I1Q A;  4AVM A;  4AKV A;  5C5B B;  4DYL A;  3LLL A;  3OK8 A;  2EFL A;  2C08 A;  3HAH A;  3ACO A;  1ZWW A;  4FZS A;  2ELB A;  2YKT A;  3I2W A;  4BNE A;  1I4L A;  3Q84 A;  4ATM A;  2Z0N A;  2Q12 A;  3Q0K A;  3HAJ A;  3SOG A;  1URU A;  3G9G A;  2FIC A;  2V0O A;  2X3W A;  2Z0V A;  2RAI A;  4H8S A;  4WPC A;  5C5B A;  4NQI A;  2D1L A;  2EFK A;  2Q13 A;  1X03 A;  3QNI A;  2Z0O A;  3ABH A;  2X3X A;  2RAK A;  4NSW A;  3SYV A;  3HAI A;  3QWE A;  2X3V A;  4WPE A;  1WDZ A;  3M3W A;  1X04 A;  2D4C A;  3PLT A;  1Y2O A;  4DCN C;  1I49 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...