3Q84A

Crystal structure of human pacsin 1 f-bar domain
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
293
structure length
285
Chain Sequence
TDSFWEVGNYKRTVKRIDDGHRLCNDLMNCVQERAKIEKAYGQQLTDWAKRWRQLIEKGPQYGSLERAWGAIMTEADKVSELHQEVKNNLLNEDLEKVKNWQKDAYHKQIMGGFKETKEAEDGFRKAQKPWAKKMKELEAAKKAYHLACKEEKLAMTREMTEVPQKKLQDKVDKCKQDVQKTQEKYEKVLEDVGKTTPQYMENMEQVFEQCQQFEEKRLVFLKEVLLDIKRHLNLAENSSYIHVYRELEQAIRGADAQEDLRWFRSTSGPGMPMNWPQFEEWNPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein kinase C and casein kinase substrate in neurons prot
publication title Crystal structure of human PACSIN 1 F-BAR domain
rcsb
molecule tags Endocytosis
total genus 112
structure length 285
sequence length 293
chains with identical sequence B, G, H, M, N
ec nomenclature
pdb deposition date 2011-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00611 FCH Fes/CIP4, and EFC/F-BAR homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 3q84A01
4FZSA 1WDZA 1I4DA 1URUA 1X04A 2Q13A 2RAKA 3CAZA 3PLTA 2Z0NA 4AVMA 1I4TA 1I4LA 2X3XA 3QNIA 3SOGA 3OK8A 2Z0VA 2RAJA 1X03A 2Q12A 2V0OA 2YKTA 4AKVA 1ZWWA 4WPEA 2EFLA 2X3WA 3HAHA 2X3VA 3M3WA 3HAJA 3ABHA 4ATMA 1Y2OA 4BNEA 4NQIA 2RAIA 3Q84A 3G9GA 4I1QA 3ACOA 4WPCA 2FICA 1I49A 2C08A 4H8SA 2D1LA 5C5BB 3LLLA 4DYLA 2EFKA 4NSWA 4DCNC 2Z0OA 3HAIA 3Q0KA 3DYTA 3I2WA 3SYVA 2D4CA 5C5BA 3QE6A 3QWEA 2ELBA
chains in the Genus database with same CATH superfamily
3CZNA 3CV5A 1R5EA 4WPEA 3HAJA 3EJTA 1SUFA 4EZYA 3LLLA 1R34A 1TQWA 1SU7A 1O7DB 3KDRA 4NPHA 3BLBA 3RPMA 3QNJA 2LXYA 3C7NA 4R5IA 2X3VA 3M3WA 2F1BA 2F7OA 1I49A 4F01A 3L3PA 3RV0A 1W9MA 3FD9A 3EJUA 4EZQA 1X03A 1MJGA 2EX3B 1QWUA 4FM3A 1ZYLA 4UDXX 4ATMA 3T46A 2QXLA 2C08A 4JWDA 2YLAA 4JL9A 3LVTA 3BUIA 3B51X 3KAVA 4FZSA 1URUA 4R5JA 4EZWA 2Z8YA 2WYIA 2X3WA 1OAOA 3OWGA 5FLEX 4IM0A 4NSWA 2N3KA 3HAIA 4PO2A 3EJRA 4JN4A 3QWEA 4R5LA 2Q13A 3B52X 2YI8A 1HXKA 4EZTA 3D51A 2MI7A 2OW7A 2YIBA 2GA9D 3D4YA 2YL8A 4WPCA 3VEBA 4AZ5A 4JNFA 1LQ7A 4EZVA 4H6HA 3O3OB 2YL5A 3EJQA 3KAWA 2ELBA 1WDZA 2GF4A 4EZNA 2YLLA 3OK8A 1TQVA 3DX4A 2ALWA 3D2FA 3Q0KA 2OBMA 3DDGA 3CZSA 3T4AG 4AZCB 3L3OM 4AVMA 3DPOA 3F7WA 3D2EA 2RT6A 3ERCC 2FYVA 1GNTA 2F7PA 3BUBA 4H8SA 1QWNA 2KHOA 1GN9A 4FZOA 3CAZA 3T47A 2ND0A 2YL6A 3VKHA 5E84A 3DPPA 3BVTA 3ABHA 4UDYX 4EZPA 2F7RA 1YWMA 4M0MA 2NCZA 4DYLA 2Z0OA 3I2WA 4HR1B 2Z0VA 4HR1A 1DKZA 3ZEDA 1E2UA 1TQTA 2F1AA 4IWQA 2YKTA 3EJSA 3BVWA 1Y2OA 3G9GA 3RV1A 2JNKA 4IWPA 3DPQA 4E81A 5KBPA 1TQSA 2WYHA 4KIKB 3QNIA 1HTYA 1JQKA 2YIAA 1ZWWA 4EZZA 3DX2A 4IM3A 4JNEA 3ER8C 3OHXM 3QA8A 2LM0A 1R33A 3I04A 3BVXA 2F7QA 3BVVA 1OA1A 2EFLA 4AZIA 4HYBA 4JLCA 2RAIA 4NQIA 4EZXA 2OO2A 4AZBA 2JNSA 3D52A 3GI7A 5FIGA 1I4DA 4G6QA 2RAKA 3I39X 3O3NB 3PLTA 2Z0NA 1U00A 4AZCA 4EZRA 2V0OA 4AKVA 2QKWA 1SU8A 1TQUA 4JWIA 4EZUA 1O7DC 2OW6A 3DDFA 1UPXA 1PS3A 1DKXA 4B9QA 4AZGA 3D50A 4F00A 3BVUA 3EJPA 2ND1A 1E1DA 4AZHA 5C5BB 2F18A 3DX3A 4DCNC 5TKYA 1E9VA 3DYTA 1SU6A 2O0I1 4EZSA 5C5BA 1HWWA 3DX1A 4E3CA 2EWFA 3D4ZA 4IM2A 1I4LA 3O3MB 3SOGA 2RAJA 2Q12A 3HAHA 2ZXQA 3Q84A 4I1QA 3ACOA 2FICA 2X5CA 4D8JA 2WINM 3B53X 3BUDA 2PMRA 2YIVX 3SYVA 2OBLA 3CVRA 2YI9A 3A98A 2PY6A 4AZ7A 4IWOA 2OZNB 4AZ6A 4KIKA 3BUQA 4R5KA 3LMFA 4IW0A 2D1LA 2GAFD 2EFKA 4EZOA 1QX1A 3UITA 3BUPA 2D4CA 3QE6A 3DX0A 4JWEA 1X04A 3CKDA 3T49A 1I4TA 2X3XA 4HY9A 1OA0A 2QFFA 4JWCA 3I01A 4BNEA 3VEAA 3T48A 4R5GA 2YL9A 4H6IA 3ER9B 4FZPA 1GNLA 1DKYA
chains in the Genus database with same CATH topology
4FZSA 1WDZA 1I4DA 1URUA 1X04A 2Q13A 2RAKA 3CAZA 3PLTA 2Z0NA 4AVMA 1I4TA 1I4LA 2X3XA 3QNIA 3SOGA 3OK8A 2Z0VA 2RAJA 1X03A 2Q12A 2V0OA 2YKTA 4AKVA 1ZWWA 4WPEA 2EFLA 2X3WA 3HAHA 2X3VA 3M3WA 3HAJA 3ABHA 4ATMA 1Y2OA 4BNEA 4NQIA 2RAIA 3Q84A 3G9GA 4I1QA 3ACOA 4WPCA 2FICA 1I49A 2C08A 4H8SA 2D1LA 5C5BB 3LLLA 4DYLA 2EFKA 4NSWA 4DCNC 2Z0OA 3HAIA 3Q0KA 3DYTA 3I2WA 3SYVA 2D4CA 5C5BA 3QE6A 3QWEA 2ELBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FZS A;  1WDZ A;  1I4D A;  1URU A;  1X04 A;  2Q13 A;  2RAK A;  3CAZ A;  3PLT A;  2Z0N A;  4AVM A;  1I4T A;  1I4L A;  2X3X A;  3QNI A;  3SOG A;  3OK8 A;  2Z0V A;  2RAJ A;  1X03 A;  2Q12 A;  2V0O A;  2YKT A;  4AKV A;  1ZWW A;  4WPE A;  2EFL A;  2X3W A;  3HAH A;  2X3V A;  3M3W A;  3HAJ A;  3ABH A;  4ATM A;  1Y2O A;  4BNE A;  4NQI A;  2RAI A;  3Q84 A;  3G9G A;  4I1Q A;  3ACO A;  4WPC A;  2FIC A;  1I49 A;  2C08 A;  4H8S A;  2D1L A;  5C5B B;  3LLL A;  4DYL A;  2EFK A;  4NSW A;  4DCN C;  2Z0O A;  3HAI A;  3Q0K A;  3DYT A;  3I2W A;  3SYV A;  2D4C A;  5C5B A;  3QE6 A;  3QWE A;  2ELB A; 
#chains in the Genus database with same CATH topology
 3CZN A;  3CV5 A;  1R5E A;  4WPE A;  3HAJ A;  3EJT A;  1SUF A;  4EZY A;  3LLL A;  1R34 A;  1TQW A;  1SU7 A;  1O7D B;  3KDR A;  4NPH A;  3BLB A;  3RPM A;  3QNJ A;  2LXY A;  3C7N A;  4R5I A;  2X3V A;  3M3W A;  2F1B A;  2F7O A;  1I49 A;  4F01 A;  3L3P A;  3RV0 A;  1W9M A;  3FD9 A;  3EJU A;  4EZQ A;  1X03 A;  1MJG A;  2EX3 B;  1QWU A;  4FM3 A;  1ZYL A;  4UDX X;  4ATM A;  3T46 A;  2QXL A;  2C08 A;  4JWD A;  2YLA A;  4JL9 A;  3LVT A;  3BUI A;  3B51 X;  3KAV A;  4FZS A;  1URU A;  4R5J A;  4EZW A;  2Z8Y A;  2WYI A;  2X3W A;  1OAO A;  3OWG A;  5FLE X;  4IM0 A;  4NSW A;  2N3K A;  3HAI A;  4PO2 A;  3EJR A;  4JN4 A;  3QWE A;  4R5L A;  2Q13 A;  3B52 X;  2YI8 A;  1HXK A;  4EZT A;  3D51 A;  2MI7 A;  2OW7 A;  2YIB A;  2GA9 D;  3D4Y A;  2YL8 A;  4WPC A;  3VEB A;  4AZ5 A;  4JNF A;  1LQ7 A;  4EZV A;  4H6H A;  3O3O B;  2YL5 A;  3EJQ A;  3KAW A;  2ELB A;  1WDZ A;  2GF4 A;  4EZN A;  2YLL A;  3OK8 A;  1TQV A;  3DX4 A;  2ALW A;  3D2F A;  3Q0K A;  2OBM A;  3DDG A;  3CZS A;  3T4A G;  4AZC B;  3L3O M;  4AVM A;  3DPO A;  3F7W A;  3D2E A;  2RT6 A;  3ERC C;  2FYV A;  1GNT A;  2F7P A;  3BUB A;  4H8S A;  1QWN A;  2KHO A;  1GN9 A;  4FZO A;  3CAZ A;  3T47 A;  2ND0 A;  2YL6 A;  3VKH A;  5E84 A;  3DPP A;  3BVT A;  3ABH A;  4UDY X;  4EZP A;  2F7R A;  1YWM A;  4M0M A;  2NCZ A;  4DYL A;  2Z0O A;  3I2W A;  4HR1 B;  2Z0V A;  4HR1 A;  1DKZ A;  3ZED A;  1E2U A;  1TQT A;  2F1A A;  4IWQ A;  2YKT A;  3EJS A;  3BVW A;  1Y2O A;  3G9G A;  3RV1 A;  2JNK A;  4IWP A;  3DPQ A;  4E81 A;  5KBP A;  1TQS A;  2WYH A;  4KIK B;  3QNI A;  1HTY A;  1JQK A;  2YIA A;  1ZWW A;  4EZZ A;  3DX2 A;  4IM3 A;  4JNE A;  3ER8 C;  3OHX M;  3QA8 A;  2LM0 A;  1R33 A;  3I04 A;  3BVX A;  2F7Q A;  3BVV A;  1OA1 A;  2EFL A;  4AZI A;  4HYB A;  4JLC A;  2RAI A;  4NQI A;  4EZX A;  2OO2 A;  4AZB A;  2JNS A;  3D52 A;  3GI7 A;  5FIG A;  1I4D A;  4G6Q A;  2RAK A;  3I39 X;  3O3N B;  3PLT A;  2Z0N A;  1U00 A;  4AZC A;  4EZR A;  2V0O A;  4AKV A;  2QKW A;  1SU8 A;  1TQU A;  4JWI A;  4EZU A;  1O7D C;  2OW6 A;  3DDF A;  1UPX A;  1PS3 A;  1DKX A;  4B9Q A;  4AZG A;  3D50 A;  4F00 A;  3BVU A;  3EJP A;  2ND1 A;  1E1D A;  4AZH A;  5C5B B;  2F18 A;  3DX3 A;  4DCN C;  5TKY A;  1E9V A;  3DYT A;  1SU6 A;  2O0I 1;  4EZS A;  5C5B A;  1HWW A;  3DX1 A;  4E3C A;  2EWF A;  3D4Z A;  4IM2 A;  1I4L A;  3O3M B;  3SOG A;  2RAJ A;  2Q12 A;  3HAH A;  2ZXQ A;  3Q84 A;  4I1Q A;  3ACO A;  2FIC A;  2X5C A;  4D8J A;  2WIN M;  3B53 X;  3BUD A;  2PMR A;  2YIV X;  3SYV A;  2OBL A;  3CVR A;  2YI9 A;  3A98 A;  2PY6 A;  4AZ7 A;  4IWO A;  2OZN B;  4AZ6 A;  4KIK A;  3BUQ A;  4R5K A;  3LMF A;  4IW0 A;  2D1L A;  2GAF D;  2EFK A;  4EZO A;  1QX1 A;  3UIT A;  3BUP A;  2D4C A;  3QE6 A;  3DX0 A;  4JWE A;  1X04 A;  3CKD A;  3T49 A;  1I4T A;  2X3X A;  4HY9 A;  1OA0 A;  2QFF A;  4JWC A;  3I01 A;  4BNE A;  3VEA A;  3T48 A;  4R5G A;  2YL9 A;  4H6I A;  3ER9 B;  4FZP A;  1GNL A;  1DKY A; 
#chains in the Genus database with same CATH homology
 4FZS A;  1WDZ A;  1I4D A;  1URU A;  1X04 A;  2Q13 A;  2RAK A;  3CAZ A;  3PLT A;  2Z0N A;  4AVM A;  1I4T A;  1I4L A;  2X3X A;  3QNI A;  3SOG A;  3OK8 A;  2Z0V A;  2RAJ A;  1X03 A;  2Q12 A;  2V0O A;  2YKT A;  4AKV A;  1ZWW A;  4WPE A;  2EFL A;  2X3W A;  3HAH A;  2X3V A;  3M3W A;  3HAJ A;  3ABH A;  4ATM A;  1Y2O A;  4BNE A;  4NQI A;  2RAI A;  3Q84 A;  3G9G A;  4I1Q A;  3ACO A;  4WPC A;  2FIC A;  1I49 A;  2C08 A;  4H8S A;  2D1L A;  5C5B B;  3LLL A;  4DYL A;  2EFK A;  4NSW A;  4DCN C;  2Z0O A;  3HAI A;  3Q0K A;  3DYT A;  3I2W A;  3SYV A;  2D4C A;  5C5B A;  3QE6 A;  3QWE A;  2ELB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...