3Q84A

Crystal structure of human pacsin 1 f-bar domain
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
293
structure length
285
Chain Sequence
TDSFWEVGNYKRTVKRIDDGHRLCNDLMNCVQERAKIEKAYGQQLTDWAKRWRQLIEKGPQYGSLERAWGAIMTEADKVSELHQEVKNNLLNEDLEKVKNWQKDAYHKQIMGGFKETKEAEDGFRKAQKPWAKKMKELEAAKKAYHLACKEEKLAMTREMTEVPQKKLQDKVDKCKQDVQKTQEKYEKVLEDVGKTTPQYMENMEQVFEQCQQFEEKRLVFLKEVLLDIKRHLNLAENSSYIHVYRELEQAIRGADAQEDLRWFRSTSGPGMPMNWPQFEEWNPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis
molecule keywords Protein kinase C and casein kinase substrate in neurons prot
publication title Crystal structure of human PACSIN 1 F-BAR domain
rcsb
total genus 112
structure length 285
sequence length 293
chains with identical sequence B, G, H, M, N
ec nomenclature
pdb deposition date 2011-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00611 FCH Fes/CIP4, and EFC/F-BAR homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 3q84A01
1I49A 2V0OA 4AVMA 3ABHA 2X3VA 2RAIA 1ZWWA 3HAIA 3QE6A 4FZSA 1X03A 3HAJA 2YKTA 2RAJA 3PLTA 4WPCA 2FICA 4BNEA 4DYLA 2EFKA 3ACOA 2D4CA 3HAHA 3LLLA 5C5BB 4DCNC 2X3XA 3CAZA 4H8SA 3QWEA 2RAKA 2X3WA 1URUA 3Q84A 4I1QA 1X04A 1I4DA 3I2WA 3OK8A 4WPEA 2D1LA 2Q13A 3QNIA 5C5BA 4NQIA 4AKVA 3Q0KA 4ATMA 2C08A 3SOGA 3SYVA 1WDZA 3DYTA 2Z0OA 4NSWA 3M3WA 3G9GA 2ELBA 2Z0NA 2Z0VA 2EFLA 2Q12A 1I4TA 1I4LA 1Y2OA
chains in the Genus database with same CATH superfamily
2F7RA 3ABHA 4D8JA 3DPQA 4AZIA 1MJGA 4H8SA 4AZCB 2PY6A 3L3PA 2YIVX 4AKVA 1DKXA 4FM3A 2Z0NA 2Z0VA 2V0OA 2QFFA 3CZSA 1OA1A 1U00A 4F00A 3HAJA 2YKTA 3ACOA 1R33A 4JWEA 3CAZA 3QWEA 3Q84A 3O3OB 4HR1A 3ER9B 3D2EA 2N3KA 2LXYA 3SOGA 4EZVA 3F7WA 3EJTA 1I4LA 4KIKB 4AVMA 1O7DB 2YL8A 1HTYA 2YLAA 4FZSA 4HR1B 2ND0A 3EJQA 4EZOA 2WINM 4I1QA 1QX1A 2JNKA 4IWQA 3OK8A 4IWPA 3LVTA 1PS3A 3SYVA 3LMFA 1TQUA 3G9GA 2ELBA 1QWNA 5TKYA 2F7PA 4EZPA 2GAFD 4R5LA 3D4YA 2YI9A 3D51A 3CKDA 3HAHA 3LLLA 3BVWA 1I4DA 1JQKA 3QNIA 3EJUA 4IW0A 3D52A 4IM3A 5E84A 4IM0A 2YL6A 3RPMA 3BVXA 3ER8C 1GNTA 4M0MA 2OW6A 3B52X 4R5IA 4F01A 3D4ZA 4EZQA 3QA8A 3OHXM 2Q13A 3VEAA 4AZCA 1SU7A 4NSWA 2EFLA 2EWFA 4EZZA 4E3CA 3KDRA 3O3MB 2YL9A 2FICA 3D50A 4EZYA 2Z8YA 2RAKA 2X3WA 1X04A 3I2WA 1QWUA 3EJRA 4JLCA 4EZSA 3O3NB 2NCZA 2EX3B 2X3VA 2WYHA 2RAJA 4B9QA 4KIKA 2EFKA 4JL9A 2D4CA 4DCNC 1URUA 1SU8A 5KBPA 1O7DC 3BVTA 4NQIA 2C08A 3OWGA 3T4AG 3DYTA 4HYBA 3DX4A 3L3OM 4R5KA 2ZXQA 3T47A 3BUBA 3BLBA 3QNJA 1OAOA 3I39X 3ZEDA 1R5EA 2OW7A 1TQVA 2PMRA 1LQ7A 3DDGA 4AZ6A 1W9MA 4AZGA 3M3WA 2OBLA 1DKZA 4AZ7A 1I4TA 3BUDA 4UDYX 3CVRA 3HAIA 1HXKA 4PO2A 4IM2A 4EZWA 4EZRA 4WPEA 5FIGA 2F1AA 4ATMA 2MI7A 3CV5A 3EJSA 4UDXX 1I49A 3C7NA 4EZXA 3QE6A 4BNEA 2QKWA 2LM0A 1HWWA 3KAVA 3FD9A 2OO2A 3VEBA 2F7OA 4G6QA 1TQWA 4JNFA 4IWOA 4R5GA 3RV1A 3DPPA 3DX0A 4JN4A 2JNSA 1GNLA 1GN9A 4JWCA 4JNEA 2X3XA 1TQTA 2D1LA 2OBMA 3KAWA 1ZYLA 3D2FA 3BUQA 3T48A 1X03A 2WYIA 4H6IA 2YIBA 4E81A 4AZHA 2YL5A 3I01A 3CZNA 4AZ5A 1E2UA 2Z0OA 2ALWA 4FZPA 4AZBA 2KHOA 3T49A 4FZOA 4WPCA 4NPHA 1UPXA 3B53X 4EZTA 3DX2A 4EZUA 1E9VA 1SUFA 3UITA 1SU6A 2Q12A 2QXLA 1YWMA 2F7QA 2RAIA 3BVUA 3PLTA 4R5JA 3ERCC 2OZNB 3BUPA 2YI8A 1OA0A 5C5BA 3BUIA 3Q0KA 3GI7A 1WDZA 4JWIA 3VKHA 2YIAA 2YLLA 1TQSA 2X5CA 4DYLA 5C5BB 4JWDA 3B51X 2FYVA 3DPOA 2ND1A 3DX3A 3T46A 4EZNA 4H6HA 2GA9D 1Y2OA 3DDFA 4HY9A 1DKYA 3DX1A 3RV0A 2F1BA 1ZWWA 1R34A 3I04A 2F18A 3A98A 3EJPA 2GF4A 2RT6A 2O0I1 1E1DA 3BVVA 5FLEX
chains in the Genus database with same CATH topology
1I49A 2V0OA 4AVMA 3ABHA 2X3VA 2RAIA 1ZWWA 3HAIA 3QE6A 4FZSA 1X03A 3HAJA 2YKTA 2RAJA 3PLTA 4WPCA 2FICA 4BNEA 4DYLA 2EFKA 3ACOA 2D4CA 3HAHA 3LLLA 5C5BB 4DCNC 2X3XA 3CAZA 4H8SA 3QWEA 2RAKA 2X3WA 1URUA 3Q84A 4I1QA 1X04A 1I4DA 3I2WA 3OK8A 4WPEA 2D1LA 2Q13A 3QNIA 5C5BA 4NQIA 4AKVA 3Q0KA 4ATMA 2C08A 3SOGA 3SYVA 1WDZA 3DYTA 2Z0OA 4NSWA 3M3WA 3G9GA 2ELBA 2Z0NA 2Z0VA 2EFLA 2Q12A 1I4TA 1I4LA 1Y2OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I49 A;  2V0O A;  4AVM A;  3ABH A;  2X3V A;  2RAI A;  1ZWW A;  3HAI A;  3QE6 A;  4FZS A;  1X03 A;  3HAJ A;  2YKT A;  2RAJ A;  3PLT A;  4WPC A;  2FIC A;  4BNE A;  4DYL A;  2EFK A;  3ACO A;  2D4C A;  3HAH A;  3LLL A;  5C5B B;  4DCN C;  2X3X A;  3CAZ A;  4H8S A;  3QWE A;  2RAK A;  2X3W A;  1URU A;  3Q84 A;  4I1Q A;  1X04 A;  1I4D A;  3I2W A;  3OK8 A;  4WPE A;  2D1L A;  2Q13 A;  3QNI A;  5C5B A;  4NQI A;  4AKV A;  3Q0K A;  4ATM A;  2C08 A;  3SOG A;  3SYV A;  1WDZ A;  3DYT A;  2Z0O A;  4NSW A;  3M3W A;  3G9G A;  2ELB A;  2Z0N A;  2Z0V A;  2EFL A;  2Q12 A;  1I4T A;  1I4L A;  1Y2O A; 
#chains in the Genus database with same CATH topology
 2F7R A;  3ABH A;  4D8J A;  3DPQ A;  4AZI A;  1MJG A;  4H8S A;  4AZC B;  2PY6 A;  3L3P A;  2YIV X;  4AKV A;  1DKX A;  4FM3 A;  2Z0N A;  2Z0V A;  2V0O A;  2QFF A;  3CZS A;  1OA1 A;  1U00 A;  4F00 A;  3HAJ A;  2YKT A;  3ACO A;  1R33 A;  4JWE A;  3CAZ A;  3QWE A;  3Q84 A;  3O3O B;  4HR1 A;  3ER9 B;  3D2E A;  2N3K A;  2LXY A;  3SOG A;  4EZV A;  3F7W A;  3EJT A;  1I4L A;  4KIK B;  4AVM A;  1O7D B;  2YL8 A;  1HTY A;  2YLA A;  4FZS A;  4HR1 B;  2ND0 A;  3EJQ A;  4EZO A;  2WIN M;  4I1Q A;  1QX1 A;  2JNK A;  4IWQ A;  3OK8 A;  4IWP A;  3LVT A;  1PS3 A;  3SYV A;  3LMF A;  1TQU A;  3G9G A;  2ELB A;  1QWN A;  5TKY A;  2F7P A;  4EZP A;  2GAF D;  4R5L A;  3D4Y A;  2YI9 A;  3D51 A;  3CKD A;  3HAH A;  3LLL A;  3BVW A;  1I4D A;  1JQK A;  3QNI A;  3EJU A;  4IW0 A;  3D52 A;  4IM3 A;  5E84 A;  4IM0 A;  2YL6 A;  3RPM A;  3BVX A;  3ER8 C;  1GNT A;  4M0M A;  2OW6 A;  3B52 X;  4R5I A;  4F01 A;  3D4Z A;  4EZQ A;  3QA8 A;  3OHX M;  2Q13 A;  3VEA A;  4AZC A;  1SU7 A;  4NSW A;  2EFL A;  2EWF A;  4EZZ A;  4E3C A;  3KDR A;  3O3M B;  2YL9 A;  2FIC A;  3D50 A;  4EZY A;  2Z8Y A;  2RAK A;  2X3W A;  1X04 A;  3I2W A;  1QWU A;  3EJR A;  4JLC A;  4EZS A;  3O3N B;  2NCZ A;  2EX3 B;  2X3V A;  2WYH A;  2RAJ A;  4B9Q A;  4KIK A;  2EFK A;  4JL9 A;  2D4C A;  4DCN C;  1URU A;  1SU8 A;  5KBP A;  1O7D C;  3BVT A;  4NQI A;  2C08 A;  3OWG A;  3T4A G;  3DYT A;  4HYB A;  3DX4 A;  3L3O M;  4R5K A;  2ZXQ A;  3T47 A;  3BUB A;  3BLB A;  3QNJ A;  1OAO A;  3I39 X;  3ZED A;  1R5E A;  2OW7 A;  1TQV A;  2PMR A;  1LQ7 A;  3DDG A;  4AZ6 A;  1W9M A;  4AZG A;  3M3W A;  2OBL A;  1DKZ A;  4AZ7 A;  1I4T A;  3BUD A;  4UDY X;  3CVR A;  3HAI A;  1HXK A;  4PO2 A;  4IM2 A;  4EZW A;  4EZR A;  4WPE A;  5FIG A;  2F1A A;  4ATM A;  2MI7 A;  3CV5 A;  3EJS A;  4UDX X;  1I49 A;  3C7N A;  4EZX A;  3QE6 A;  4BNE A;  2QKW A;  2LM0 A;  1HWW A;  3KAV A;  3FD9 A;  2OO2 A;  3VEB A;  2F7O A;  4G6Q A;  1TQW A;  4JNF A;  4IWO A;  4R5G A;  3RV1 A;  3DPP A;  3DX0 A;  4JN4 A;  2JNS A;  1GNL A;  1GN9 A;  4JWC A;  4JNE A;  2X3X A;  1TQT A;  2D1L A;  2OBM A;  3KAW A;  1ZYL A;  3D2F A;  3BUQ A;  3T48 A;  1X03 A;  2WYI A;  4H6I A;  2YIB A;  4E81 A;  4AZH A;  2YL5 A;  3I01 A;  3CZN A;  4AZ5 A;  1E2U A;  2Z0O A;  2ALW A;  4FZP A;  4AZB A;  2KHO A;  3T49 A;  4FZO A;  4WPC A;  4NPH A;  1UPX A;  3B53 X;  4EZT A;  3DX2 A;  4EZU A;  1E9V A;  1SUF A;  3UIT A;  1SU6 A;  2Q12 A;  2QXL A;  1YWM A;  2F7Q A;  2RAI A;  3BVU A;  3PLT A;  4R5J A;  3ERC C;  2OZN B;  3BUP A;  2YI8 A;  1OA0 A;  5C5B A;  3BUI A;  3Q0K A;  3GI7 A;  1WDZ A;  4JWI A;  3VKH A;  2YIA A;  2YLL A;  1TQS A;  2X5C A;  4DYL A;  5C5B B;  4JWD A;  3B51 X;  2FYV A;  3DPO A;  2ND1 A;  3DX3 A;  3T46 A;  4EZN A;  4H6H A;  2GA9 D;  1Y2O A;  3DDF A;  4HY9 A;  1DKY A;  3DX1 A;  3RV0 A;  2F1B A;  1ZWW A;  1R34 A;  3I04 A;  2F18 A;  3A98 A;  3EJP A;  2GF4 A;  2RT6 A;  2O0I 1;  1E1D A;  3BVV A;  5FLE X; 
#chains in the Genus database with same CATH homology
 1I49 A;  2V0O A;  4AVM A;  3ABH A;  2X3V A;  2RAI A;  1ZWW A;  3HAI A;  3QE6 A;  4FZS A;  1X03 A;  3HAJ A;  2YKT A;  2RAJ A;  3PLT A;  4WPC A;  2FIC A;  4BNE A;  4DYL A;  2EFK A;  3ACO A;  2D4C A;  3HAH A;  3LLL A;  5C5B B;  4DCN C;  2X3X A;  3CAZ A;  4H8S A;  3QWE A;  2RAK A;  2X3W A;  1URU A;  3Q84 A;  4I1Q A;  1X04 A;  1I4D A;  3I2W A;  3OK8 A;  4WPE A;  2D1L A;  2Q13 A;  3QNI A;  5C5B A;  4NQI A;  4AKV A;  3Q0K A;  4ATM A;  2C08 A;  3SOG A;  3SYV A;  1WDZ A;  3DYT A;  2Z0O A;  4NSW A;  3M3W A;  3G9G A;  2ELB A;  2Z0N A;  2Z0V A;  2EFL A;  2Q12 A;  1I4T A;  1I4L A;  1Y2O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...