3T48A

Crystal structure of truncated form of staphylococcal complement inhibitor d (scin-d) at 1.5 angstrom
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
71
structure length
71
Chain Sequence
QHQALVDQLHELIANTDLNKLSYLNLDAFQKRDILAAHYIAKSAIRTKNLDQMTKAKQRLESIYNSISNPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SCIN-D
publication title Diversity in the C3b Convertase Contact Residues and Tertiary Structures of the Staphylococcal Complement Inhibitor (SCIN) Protein Family.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Immune system
total genus 26
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3t48A00
4EZXA 1DKYA 2QFFA 3QNJA 1U00A 4R5GA 1DKZA 4EZOA 5TKYA 4EZQA 4H6IA 4JNFA 4EZNA 4EZVA 4JNEA 1DKXA 3T47A 5E84A 3DPOA 2QXLA 3D2FA 3T46A 4EZSA 4R5JA 3D2EA 4EZPA 3DPPA 4JWDA 2KHOA 4EZWA 4EZRA 4EZZA 4HYBA 4JWEA 3T49A 3DPQA 3OHXM 4EZYA 4F00A 3C7NA 3T4AG 4PO2A 4H6HA 4B9QA 4R5KA 4JWIA 4JN4A 4HY9A 3T48A 4JWCA 2WINM 4EZTA 4E81A 3L3OM 4EZUA 4R5LA 4R5IA 4F01A
chains in the Genus database with same CATH superfamily
3DDFA 3SOGA 1TQSA 2YL6A 1SUFA 1X04A 3QWEA 5FIGA 3CZNA 3EJSA 4EZZA 3DPQA 2Z0VA 2YL8A 4ATMA 3Q0KA 3I01A 4PO2A 3O3MB 4JWCA 4E81A 3G9GA 3BUBA 4AKVA 1YWMA 1HXKA 2X3XA 2QKWA 2V0OA 4DYLA 2QXLA 2FICA 4AZ5A 4EZPA 2YI9A 3BVUA 3ZEDA 3O3OB 1MJGA 3CKDA 4R5KA 2RAKA 2F1AA 3HAJA 4R5IA 2QFFA 3ABHA 3ER9B 4WPEA 3O3NB 1O7DB 1R34A 3LVTA 4EZXA 3RV1A 4IM0A 3RV0A 2PMRA 2GA9D 3F7WA 1TQWA 3D50A 3EJRA 4EZRA 1OA1A 4I1QA 2EX3B 1I4DA 1HWWA 3FD9A 4AZBA 2N3KA 2YL9A 1DKZA 1UPXA 2ELBA 2OO2A 2PY6A 2OZNB 4JLCA 3ERCC 1X03A 2RAJA 5C5BB 1DKYA 3VEAA 2YIAA 1DKXA 4AZGA 1R5EA 4IW0A 3D51A 2YIBA 3T46A 2YLLA 3BUQA 3DX0A 3BUPA 4H8SA 1R33A 3BVTA 4AVMA 1OAOA 3CVRA 1I4TA 4KIKA 1ZYLA 4JL9A 4NPHA 2ND0A 4EZNA 2JNKA 1TQVA 3OK8A 4NSWA 4EZSA 3DPPA 2KHOA 1E1DA 4B9QA 2D4CA 5KBPA 3QNJA 1QX1A 2LM0A 1PS3A 2NCZA 1QWUA 4HR1A 4AZCA 3T48A 2F7QA 3DX4A 3VKHA 4UDXX 2MI7A 2Z8YA 4IWOA 3M3WA 4EZQA 4JNEA 3GI7A 2YI8A 4IM3A 2ALWA 2Q12A 3EJPA 1JQKA 2ND1A 3EJUA 2YKTA 2Z0OA 3RPMA 4F01A 1TQUA 4WPCA 1ZWWA 2OBMA 3B52X 2GAFD 1GN9A 4AZHA 3KAVA 3OWGA 2EFLA 2EWFA 3LLLA 3BVXA 4BNEA 4H6IA 2F1BA 1LQ7A 4R5JA 3D2EA 3BVVA 3EJQA 3T49A 3KAWA 1Y2OA 3C7NA 3VEBA 1HTYA 3QA8A 3HAIA 3DDGA 3CAZA 2WINM 1GNLA 3CV5A 2OW6A 3BLBA 1E2UA 4R5GA 3BVWA 3ER8C 1URUA 2JNSA 2O0I1 4EZWA 2LXYA 4JWEA 3QE6A 1W9MA 2F7PA 3PLTA 4FZOA 4EZUA 4F00A 1SU7A 5FLEX 3KDRA 1U00A 4KIKB 3BUIA 4NQIA 3D4YA 3B51X 4EZVA 3T47A 3DPOA 2D1LA 2C08A 2X5CA 2Z0NA 4JWDA 3I04A 3LMFA 4HYBA 1I49A 4EZYA 2EFKA 4H6HA 4JWIA 4HY9A 1WDZA 3QNIA 2RAIA 3B53X 3SYVA 4IM2A 2WYIA 3Q84A 2YL5A 3ACOA 4EZOA 5TKYA 3I2WA 3A98A 4D8JA 1TQTA 3D2FA 3DX2A 4DCNC 4G6QA 4FZPA 1E9VA 4HR1B 2X3VA 4AZCB 4EZTA 1SU8A 4R5LA 2WYHA 4E3CA 4FZSA 1GNTA 4FM3A 2OBLA 4JNFA 5E84A 2GF4A 4UDYX 3T4AG 3L3PA 3D4ZA 2Q13A 2F7RA 2RT6A 4AZ6A 2YLAA 3CZSA 1OA0A 3L3OM 5C5BA 3DX1A 3DX3A 2F18A 2F7OA 4IWQA 4AZ7A 3HAHA 3D52A 2ZXQA 1SU6A 1I4LA 3UITA 2FYVA 2X3WA 2YIVX 3I39X 2OW7A 4IWPA 4AZIA 3OHXM 4JN4A 3DYTA 4M0MA 1O7DC 1QWNA 3EJTA 3BUDA
chains in the Genus database with same CATH topology
4UDXX 3KDRA 5FLEX 1U00A 4KIKB 1DKZA 1UPXA 2Z8YA 4IWOA 1SUFA 3B51X 4EZQA 4EZVA 4JNEA 3T47A 3GI7A 3DPOA 5FIGA 2YI8A 2X5CA 4IM3A 4JWDA 3I04A 3LMFA 4EZZA 4HYBA 4EZYA 3DPQA 1JQKA 2ND1A 2PY6A 3I01A 4PO2A 4H6HA 3O3MB 4JWIA 4JLCA 4HY9A 4JWCA 3ERCC 3B53X 4E81A 4IM2A 4F01A 1DKYA 3VEAA 4EZOA 5TKYA 2YIAA 1DKXA 3A98A 2OBMA 4IW0A 4D8JA 2YIBA 2QXLA 3D2FA 3T46A 3B52X 4EZPA 2GAFD 2YI9A 1GN9A 3ZEDA 3O3OB 4G6QA 1MJGA 1E9VA 3KAVA 4R5KA 4HR1B 1OAOA 3OWGA 4EZTA 1SU8A 4R5LA 4R5IA 4KIKA 1ZYLA 2QFFA 4E3CA 2EWFA 1GNTA 4JL9A 4NPHA 4FM3A 3ER9B 2OBLA 2ND0A 4H6IA 4JNFA 4EZNA 5E84A 4EZSA 4R5JA 3D2EA 3DPPA 2KHOA 4UDYX 3T49A 3KAWA 3O3NB 3C7NA 3T4AG 3QA8A 1E1DA 3VEBA 2RT6A 4B9QA 2WINM 1OA0A 3L3OM 3VKHA 4EZXA 3RV1A 1GNLA 3QNJA 4IM0A 3RV0A 2GA9D 1E2UA 3F7WA 4R5GA 4IWQA 3ER8C 1SU6A 3UITA 2JNSA 2LM0A 2YIVX 3I39X 4EZRA 4EZWA 4IWPA 1OA1A 2NCZA 4JWEA 3OHXM 2EX3B 4HR1A 1W9MA 4JN4A 3FD9A 4M0MA 3T48A 2N3KA 4EZUA 4F00A 1SU7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EZX A;  1DKY A;  2QFF A;  3QNJ A;  1U00 A;  4R5G A;  1DKZ A;  4EZO A;  5TKY A;  4EZQ A;  4H6I A;  4JNF A;  4EZN A;  4EZV A;  4JNE A;  1DKX A;  3T47 A;  5E84 A;  3DPO A;  2QXL A;  3D2F A;  3T46 A;  4EZS A;  4R5J A;  3D2E A;  4EZP A;  3DPP A;  4JWD A;  2KHO A;  4EZW A;  4EZR A;  4EZZ A;  4HYB A;  4JWE A;  3T49 A;  3DPQ A;  3OHX M;  4EZY A;  4F00 A;  3C7N A;  3T4A G;  4PO2 A;  4H6H A;  4B9Q A;  4R5K A;  4JWI A;  4JN4 A;  4HY9 A;  3T48 A;  4JWC A;  2WIN M;  4EZT A;  4E81 A;  3L3O M;  4EZU A;  4R5L A;  4R5I A;  4F01 A; 
#chains in the Genus database with same CATH topology
 3DDF A;  3SOG A;  1TQS A;  2YL6 A;  1SUF A;  1X04 A;  3QWE A;  5FIG A;  3CZN A;  3EJS A;  4EZZ A;  3DPQ A;  2Z0V A;  2YL8 A;  4ATM A;  3Q0K A;  3I01 A;  4PO2 A;  3O3M B;  4JWC A;  4E81 A;  3G9G A;  3BUB A;  4AKV A;  1YWM A;  1HXK A;  2X3X A;  2QKW A;  2V0O A;  4DYL A;  2QXL A;  2FIC A;  4AZ5 A;  4EZP A;  2YI9 A;  3BVU A;  3ZED A;  3O3O B;  1MJG A;  3CKD A;  4R5K A;  2RAK A;  2F1A A;  3HAJ A;  4R5I A;  2QFF A;  3ABH A;  3ER9 B;  4WPE A;  3O3N B;  1O7D B;  1R34 A;  3LVT A;  4EZX A;  3RV1 A;  4IM0 A;  3RV0 A;  2PMR A;  2GA9 D;  3F7W A;  1TQW A;  3D50 A;  3EJR A;  4EZR A;  1OA1 A;  4I1Q A;  2EX3 B;  1I4D A;  1HWW A;  3FD9 A;  4AZB A;  2N3K A;  2YL9 A;  1DKZ A;  1UPX A;  2ELB A;  2OO2 A;  2PY6 A;  2OZN B;  4JLC A;  3ERC C;  1X03 A;  2RAJ A;  5C5B B;  1DKY A;  3VEA A;  2YIA A;  1DKX A;  4AZG A;  1R5E A;  4IW0 A;  3D51 A;  2YIB A;  3T46 A;  2YLL A;  3BUQ A;  3DX0 A;  3BUP A;  4H8S A;  1R33 A;  3BVT A;  4AVM A;  1OAO A;  3CVR A;  1I4T A;  4KIK A;  1ZYL A;  4JL9 A;  4NPH A;  2ND0 A;  4EZN A;  2JNK A;  1TQV A;  3OK8 A;  4NSW A;  4EZS A;  3DPP A;  2KHO A;  1E1D A;  4B9Q A;  2D4C A;  5KBP A;  3QNJ A;  1QX1 A;  2LM0 A;  1PS3 A;  2NCZ A;  1QWU A;  4HR1 A;  4AZC A;  3T48 A;  2F7Q A;  3DX4 A;  3VKH A;  4UDX X;  2MI7 A;  2Z8Y A;  4IWO A;  3M3W A;  4EZQ A;  4JNE A;  3GI7 A;  2YI8 A;  4IM3 A;  2ALW A;  2Q12 A;  3EJP A;  1JQK A;  2ND1 A;  3EJU A;  2YKT A;  2Z0O A;  3RPM A;  4F01 A;  1TQU A;  4WPC A;  1ZWW A;  2OBM A;  3B52 X;  2GAF D;  1GN9 A;  4AZH A;  3KAV A;  3OWG A;  2EFL A;  2EWF A;  3LLL A;  3BVX A;  4BNE A;  4H6I A;  2F1B A;  1LQ7 A;  4R5J A;  3D2E A;  3BVV A;  3EJQ A;  3T49 A;  3KAW A;  1Y2O A;  3C7N A;  3VEB A;  1HTY A;  3QA8 A;  3HAI A;  3DDG A;  3CAZ A;  2WIN M;  1GNL A;  3CV5 A;  2OW6 A;  3BLB A;  1E2U A;  4R5G A;  3BVW A;  3ER8 C;  1URU A;  2JNS A;  2O0I 1;  4EZW A;  2LXY A;  4JWE A;  3QE6 A;  1W9M A;  2F7P A;  3PLT A;  4FZO A;  4EZU A;  4F00 A;  1SU7 A;  5FLE X;  3KDR A;  1U00 A;  4KIK B;  3BUI A;  4NQI A;  3D4Y A;  3B51 X;  4EZV A;  3T47 A;  3DPO A;  2D1L A;  2C08 A;  2X5C A;  2Z0N A;  4JWD A;  3I04 A;  3LMF A;  4HYB A;  1I49 A;  4EZY A;  2EFK A;  4H6H A;  4JWI A;  4HY9 A;  1WDZ A;  3QNI A;  2RAI A;  3B53 X;  3SYV A;  4IM2 A;  2WYI A;  3Q84 A;  2YL5 A;  3ACO A;  4EZO A;  5TKY A;  3I2W A;  3A98 A;  4D8J A;  1TQT A;  3D2F A;  3DX2 A;  4DCN C;  4G6Q A;  4FZP A;  1E9V A;  4HR1 B;  2X3V A;  4AZC B;  4EZT A;  1SU8 A;  4R5L A;  2WYH A;  4E3C A;  4FZS A;  1GNT A;  4FM3 A;  2OBL A;  4JNF A;  5E84 A;  2GF4 A;  4UDY X;  3T4A G;  3L3P A;  3D4Z A;  2Q13 A;  2F7R A;  2RT6 A;  4AZ6 A;  2YLA A;  3CZS A;  1OA0 A;  3L3O M;  5C5B A;  3DX1 A;  3DX3 A;  2F18 A;  2F7O A;  4IWQ A;  4AZ7 A;  3HAH A;  3D52 A;  2ZXQ A;  1SU6 A;  1I4L A;  3UIT A;  2FYV A;  2X3W A;  2YIV X;  3I39 X;  2OW7 A;  4IWP A;  4AZI A;  3OHX M;  4JN4 A;  3DYT A;  4M0M A;  1O7D C;  1QWN A;  3EJT A;  3BUD A; 
#chains in the Genus database with same CATH homology
 4UDX X;  3KDR A;  5FLE X;  1U00 A;  4KIK B;  1DKZ A;  1UPX A;  2Z8Y A;  4IWO A;  1SUF A;  3B51 X;  4EZQ A;  4EZV A;  4JNE A;  3T47 A;  3GI7 A;  3DPO A;  5FIG A;  2YI8 A;  2X5C A;  4IM3 A;  4JWD A;  3I04 A;  3LMF A;  4EZZ A;  4HYB A;  4EZY A;  3DPQ A;  1JQK A;  2ND1 A;  2PY6 A;  3I01 A;  4PO2 A;  4H6H A;  3O3M B;  4JWI A;  4JLC A;  4HY9 A;  4JWC A;  3ERC C;  3B53 X;  4E81 A;  4IM2 A;  4F01 A;  1DKY A;  3VEA A;  4EZO A;  5TKY A;  2YIA A;  1DKX A;  3A98 A;  2OBM A;  4IW0 A;  4D8J A;  2YIB A;  2QXL A;  3D2F A;  3T46 A;  3B52 X;  4EZP A;  2GAF D;  2YI9 A;  1GN9 A;  3ZED A;  3O3O B;  4G6Q A;  1MJG A;  1E9V A;  3KAV A;  4R5K A;  4HR1 B;  1OAO A;  3OWG A;  4EZT A;  1SU8 A;  4R5L A;  4R5I A;  4KIK A;  1ZYL A;  2QFF A;  4E3C A;  2EWF A;  1GNT A;  4JL9 A;  4NPH A;  4FM3 A;  3ER9 B;  2OBL A;  2ND0 A;  4H6I A;  4JNF A;  4EZN A;  5E84 A;  4EZS A;  4R5J A;  3D2E A;  3DPP A;  2KHO A;  4UDY X;  3T49 A;  3KAW A;  3O3N B;  3C7N A;  3T4A G;  3QA8 A;  1E1D A;  3VEB A;  2RT6 A;  4B9Q A;  2WIN M;  1OA0 A;  3L3O M;  3VKH A;  4EZX A;  3RV1 A;  1GNL A;  3QNJ A;  4IM0 A;  3RV0 A;  2GA9 D;  1E2U A;  3F7W A;  4R5G A;  4IWQ A;  3ER8 C;  1SU6 A;  3UIT A;  2JNS A;  2LM0 A;  2YIV X;  3I39 X;  4EZR A;  4EZW A;  4IWP A;  1OA1 A;  2NCZ A;  4JWE A;  3OHX M;  2EX3 B;  4HR1 A;  1W9M A;  4JN4 A;  3FD9 A;  4M0M A;  3T48 A;  2N3K A;  4EZU A;  4F00 A;  1SU7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...