3T48A

Crystal structure of truncated form of staphylococcal complement inhibitor d (scin-d) at 1.5 angstrom
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
71
structure length
71
Chain Sequence
QHQALVDQLHELIANTDLNKLSYLNLDAFQKRDILAAHYIAKSAIRTKNLDQMTKAKQRLESIYNSISNPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords SCIN-D
publication title Diversity in the C3b Convertase Contact Residues and Tertiary Structures of the Staphylococcal Complement Inhibitor (SCIN) Protein Family.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 26
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3t48A00
1DKZA 5E84A 4EZVA 4EZUA 4JWIA 4JWEA 4EZTA 4R5KA 4EZOA 2WINM 4F01A 4EZSA 2KHOA 4R5IA 4JWCA 4JN4A 3T48A 4F00A 3DPOA 4EZXA 4H6HA 4EZPA 3DPPA 3T4AG 4JWDA 4JNEA 4PO2A 2QFFA 3T49A 1U00A 4EZZA 4R5JA 3D2FA 1DKYA 4EZRA 4EZYA 4JNFA 4B9QA 4HY9A 3QNJA 3T47A 1DKXA 3T46A 3D2EA 4HYBA 4EZNA 4R5GA 5TKYA 4R5LA 3L3OM 4E81A 3OHXM 2QXLA 4H6IA 4EZQA 3C7NA 4EZWA 3DPQA
chains in the Genus database with same CATH superfamily
5E84A 3CZNA 4R5KA 3BUQA 2Z0NA 2KHOA 1YWMA 4PO2A 2EWFA 2YKTA 2YIAA 1DKYA 5KBPA 2X3WA 2YLAA 4DCNC 1HTYA 3OHXM 4H6IA 1LQ7A 4IM0A 1PS3A 2OBMA 2PMRA 3I04A 1GNTA 4IM3A 4AZIA 3KAWA 4HR1B 4R5JA 3LLLA 2JNKA 2X3XA 4R5GA 3L3OM 3BLBA 4WPEA 3BUBA 2OW6A 1X04A 2GAFD 1ZYLA 2WYIA 3EJQA 3BUPA 3BVWA 2F18A 3T4AG 2C08A 4AZBA 4AZCB 3CAZA 1OA1A 3D4ZA 4HYBA 3KAVA 3LVTA 3RV0A 3SOGA 4EZWA 2ND1A 3DPQA 2F1AA 4EZUA 3DYTA 4IM2A 1MJGA 4HR1A 2F7QA 4AZ5A 4EZZA 3D2FA 1SU8A 2OBLA 2JNSA 1TQVA 3B51X 3DX0A 3KDRA 2QKWA 3C7NA 2FYVA 3BVUA 4EZVA 4EZOA 4EZSA 3ACOA 2EFKA 4AKVA 4M0MA 2QFFA 3Q0KA 4H8SA 2O0I1 4B9QA 3RV1A 4EZNA 1I49A 3F7WA 1SU7A 3HAIA 1DKZA 2OW7A 4BNEA 2ALWA 3GI7A 1OAOA 1E1DA 4R5IA 4D8JA 3T48A 2GA9D 2YI8A 1E9VA 3D50A 1U00A 4KIKB 3BVXA 2V0OA 3D2EA 3B53X 2D1LA 2D4CA 2YIBA 4FZPA 4IW0A 1TQSA 3BUDA 4JWIA 2LM0A 3D51A 2F7OA 3M3WA 1R34A 2LXYA 4EZPA 3FD9A 2Q12A 1TQTA 1Y2OA 3T47A 3T46A 1TQUA 3PLTA 2YL6A 3BVVA 1O7DB 2YL5A 1HXKA 2NCZA 3DDGA 4KIKA 4JWDA 3O3OB 4AZ7A 3I39X 2OO2A 4AZGA 3OK8A 3OWGA 3LMFA 2OZNB 4NQIA 4JL9A 2Z0VA 2WYHA 3DX2A 2RAJA 2EFLA 4JWEA 3DDFA 3QNIA 1HWWA 1URUA 3EJTA 3DPOA 4FZSA 2X3VA 3B52X 1TQWA 3O3NB 1UPXA 2F7RA 4EZTA 3DX4A 3ER9B 4UDYX 2RAIA 3QA8A 3ABHA 3VEBA 1R33A 3A98A 2MI7A 2RAKA 4AZCA 2X5CA 2Z0OA 3CZSA 3VEAA 5TKYA 4R5LA 3I2WA 3EJPA 3ER8C 1O7DC 4IWOA 4E3CA 4NSWA 5FIGA 3BVTA 5C5BB 2F7PA 3CVRA 2Z8YA 1I4LA 1SU6A 2RT6A 2GF4A 2YI9A 2WINM 3VKHA 2ND0A 2ELBA 4FZOA 4IWQA 2YL9A 4JNEA 2YIVX 3ERCC 3QE6A 4ATMA 3CV5A 4NPHA 5C5BA 2YL8A 1R5EA 3CKDA 4FM3A 3I01A 1W9MA 3T49A 3HAHA 2PY6A 2FICA 3O3MB 4JNFA 1QWUA 1ZWWA 4AVMA 3DX1A 4WPCA 2QXLA 2EX3B 4EZQA 3SYVA 3Q84A 4AZ6A 1SUFA 4G6QA 4JWCA 3ZEDA 3BUIA 4EZXA 3EJSA 4H6HA 4UDXX 4EZRA 1WDZA 4AZHA 1GNLA 1QWNA 2ZXQA 1E2UA 2N3KA 3HAJA 1I4DA 3L3PA 3QWEA 1X03A 2F1BA 1JQKA 3RPMA 4JLCA 3DPPA 4IWPA 5FLEX 3EJUA 4EZYA 3EJRA 4HY9A 1QX1A 3UITA 1I4TA 4F01A 4JN4A 3D4YA 4F00A 3DX3A 2YLLA 4I1QA 3D52A 3QNJA 1DKXA 1OA0A 4DYLA 2Q13A 4E81A 1GN9A 3G9GA
chains in the Genus database with same CATH topology
5E84A 4EZVA 4JWEA 4R5KA 4EZOA 4EZSA 2KHOA 3DPOA 4FM3A 4M0MA 3I01A 1W9MA 4PO2A 2QFFA 2EWFA 3T49A 2YIAA 1DKYA 2PY6A 3O3MB 4JNFA 4B9QA 3RV1A 3B52X 4EZNA 3F7WA 3O3NB 1UPXA 3OHXM 2QXLA 2EX3B 4H6IA 4EZQA 1SU7A 1DKZA 4IM0A 3GI7A 4EZTA 2OBMA 1OAOA 3ER9B 4UDYX 1E1DA 4R5IA 1SUFA 4G6QA 4JWCA 3I04A 4D8JA 3T48A 1GNTA 2GA9D 3QA8A 4IM3A 3ZEDA 3VEBA 4EZXA 4H6HA 3KAWA 2YI8A 1E9VA 4UDXX 3A98A 4HR1B 1U00A 4R5JA 4KIKB 4EZRA 2X5CA 4NPHA 3D2EA 3VEAA 3B53X 4R5GA 5TKYA 4R5LA 3L3OM 3ER8C 2YIBA 1GNLA 4IW0A 1E2UA 2N3KA 4JWIA 4IWOA 2GAFD 2LM0A 1ZYLA 4E3CA 1JQKA 5FIGA 4EZPA 4JLCA 3FD9A 2Z8YA 3DPPA 4IWPA 5FLEX 3T4AG 4EZYA 1SU6A 4HY9A 3T47A 1OA1A 3T46A 2RT6A 4HYBA 3KAVA 3RV0A 4EZWA 3DPQA 2ND1A 3UITA 2YI9A 4EZUA 2WINM 4IM2A 4F01A 3VKHA 2ND0A 4JN4A 1MJGA 2NCZA 4F00A 4HR1A 4KIKA 4IWQA 4JWDA 4JNEA 3O3OB 4EZZA 3D2FA 1SU8A 3I39X 2OBLA 2YIVX 3ERCC 3QNJA 2JNSA 1DKXA 1OA0A 3B51X 3OWGA 3LMFA 3KDRA 4E81A 1GN9A 3C7NA 4JL9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DKZ A;  5E84 A;  4EZV A;  4EZU A;  4JWI A;  4JWE A;  4EZT A;  4R5K A;  4EZO A;  2WIN M;  4F01 A;  4EZS A;  2KHO A;  4R5I A;  4JWC A;  4JN4 A;  3T48 A;  4F00 A;  3DPO A;  4EZX A;  4H6H A;  4EZP A;  3DPP A;  3T4A G;  4JWD A;  4JNE A;  4PO2 A;  2QFF A;  3T49 A;  1U00 A;  4EZZ A;  4R5J A;  3D2F A;  1DKY A;  4EZR A;  4EZY A;  4JNF A;  4B9Q A;  4HY9 A;  3QNJ A;  3T47 A;  1DKX A;  3T46 A;  3D2E A;  4HYB A;  4EZN A;  4R5G A;  5TKY A;  4R5L A;  3L3O M;  4E81 A;  3OHX M;  2QXL A;  4H6I A;  4EZQ A;  3C7N A;  4EZW A;  3DPQ A; 
#chains in the Genus database with same CATH topology
 5E84 A;  3CZN A;  4R5K A;  3BUQ A;  2Z0N A;  2KHO A;  1YWM A;  4PO2 A;  2EWF A;  2YKT A;  2YIA A;  1DKY A;  5KBP A;  2X3W A;  2YLA A;  4DCN C;  1HTY A;  3OHX M;  4H6I A;  1LQ7 A;  4IM0 A;  1PS3 A;  2OBM A;  2PMR A;  3I04 A;  1GNT A;  4IM3 A;  4AZI A;  3KAW A;  4HR1 B;  4R5J A;  3LLL A;  2JNK A;  2X3X A;  4R5G A;  3L3O M;  3BLB A;  4WPE A;  3BUB A;  2OW6 A;  1X04 A;  2GAF D;  1ZYL A;  2WYI A;  3EJQ A;  3BUP A;  3BVW A;  2F18 A;  3T4A G;  2C08 A;  4AZB A;  4AZC B;  3CAZ A;  1OA1 A;  3D4Z A;  4HYB A;  3KAV A;  3LVT A;  3RV0 A;  3SOG A;  4EZW A;  2ND1 A;  3DPQ A;  2F1A A;  4EZU A;  3DYT A;  4IM2 A;  1MJG A;  4HR1 A;  2F7Q A;  4AZ5 A;  4EZZ A;  3D2F A;  1SU8 A;  2OBL A;  2JNS A;  1TQV A;  3B51 X;  3DX0 A;  3KDR A;  2QKW A;  3C7N A;  2FYV A;  3BVU A;  4EZV A;  4EZO A;  4EZS A;  3ACO A;  2EFK A;  4AKV A;  4M0M A;  2QFF A;  3Q0K A;  4H8S A;  2O0I 1;  4B9Q A;  3RV1 A;  4EZN A;  1I49 A;  3F7W A;  1SU7 A;  3HAI A;  1DKZ A;  2OW7 A;  4BNE A;  2ALW A;  3GI7 A;  1OAO A;  1E1D A;  4R5I A;  4D8J A;  3T48 A;  2GA9 D;  2YI8 A;  1E9V A;  3D50 A;  1U00 A;  4KIK B;  3BVX A;  2V0O A;  3D2E A;  3B53 X;  2D1L A;  2D4C A;  2YIB A;  4FZP A;  4IW0 A;  1TQS A;  3BUD A;  4JWI A;  2LM0 A;  3D51 A;  2F7O A;  3M3W A;  1R34 A;  2LXY A;  4EZP A;  3FD9 A;  2Q12 A;  1TQT A;  1Y2O A;  3T47 A;  3T46 A;  1TQU A;  3PLT A;  2YL6 A;  3BVV A;  1O7D B;  2YL5 A;  1HXK A;  2NCZ A;  3DDG A;  4KIK A;  4JWD A;  3O3O B;  4AZ7 A;  3I39 X;  2OO2 A;  4AZG A;  3OK8 A;  3OWG A;  3LMF A;  2OZN B;  4NQI A;  4JL9 A;  2Z0V A;  2WYH A;  3DX2 A;  2RAJ A;  2EFL A;  4JWE A;  3DDF A;  3QNI A;  1HWW A;  1URU A;  3EJT A;  3DPO A;  4FZS A;  2X3V A;  3B52 X;  1TQW A;  3O3N B;  1UPX A;  2F7R A;  4EZT A;  3DX4 A;  3ER9 B;  4UDY X;  2RAI A;  3QA8 A;  3ABH A;  3VEB A;  1R33 A;  3A98 A;  2MI7 A;  2RAK A;  4AZC A;  2X5C A;  2Z0O A;  3CZS A;  3VEA A;  5TKY A;  4R5L A;  3I2W A;  3EJP A;  3ER8 C;  1O7D C;  4IWO A;  4E3C A;  4NSW A;  5FIG A;  3BVT A;  5C5B B;  2F7P A;  3CVR A;  2Z8Y A;  1I4L A;  1SU6 A;  2RT6 A;  2GF4 A;  2YI9 A;  2WIN M;  3VKH A;  2ND0 A;  2ELB A;  4FZO A;  4IWQ A;  2YL9 A;  4JNE A;  2YIV X;  3ERC C;  3QE6 A;  4ATM A;  3CV5 A;  4NPH A;  5C5B A;  2YL8 A;  1R5E A;  3CKD A;  4FM3 A;  3I01 A;  1W9M A;  3T49 A;  3HAH A;  2PY6 A;  2FIC A;  3O3M B;  4JNF A;  1QWU A;  1ZWW A;  4AVM A;  3DX1 A;  4WPC A;  2QXL A;  2EX3 B;  4EZQ A;  3SYV A;  3Q84 A;  4AZ6 A;  1SUF A;  4G6Q A;  4JWC A;  3ZED A;  3BUI A;  4EZX A;  3EJS A;  4H6H A;  4UDX X;  4EZR A;  1WDZ A;  4AZH A;  1GNL A;  1QWN A;  2ZXQ A;  1E2U A;  2N3K A;  3HAJ A;  1I4D A;  3L3P A;  3QWE A;  1X03 A;  2F1B A;  1JQK A;  3RPM A;  4JLC A;  3DPP A;  4IWP A;  5FLE X;  3EJU A;  4EZY A;  3EJR A;  4HY9 A;  1QX1 A;  3UIT A;  1I4T A;  4F01 A;  4JN4 A;  3D4Y A;  4F00 A;  3DX3 A;  2YLL A;  4I1Q A;  3D52 A;  3QNJ A;  1DKX A;  1OA0 A;  4DYL A;  2Q13 A;  4E81 A;  1GN9 A;  3G9G A; 
#chains in the Genus database with same CATH homology
 5E84 A;  4EZV A;  4JWE A;  4R5K A;  4EZO A;  4EZS A;  2KHO A;  3DPO A;  4FM3 A;  4M0M A;  3I01 A;  1W9M A;  4PO2 A;  2QFF A;  2EWF A;  3T49 A;  2YIA A;  1DKY A;  2PY6 A;  3O3M B;  4JNF A;  4B9Q A;  3RV1 A;  3B52 X;  4EZN A;  3F7W A;  3O3N B;  1UPX A;  3OHX M;  2QXL A;  2EX3 B;  4H6I A;  4EZQ A;  1SU7 A;  1DKZ A;  4IM0 A;  3GI7 A;  4EZT A;  2OBM A;  1OAO A;  3ER9 B;  4UDY X;  1E1D A;  4R5I A;  1SUF A;  4G6Q A;  4JWC A;  3I04 A;  4D8J A;  3T48 A;  1GNT A;  2GA9 D;  3QA8 A;  4IM3 A;  3ZED A;  3VEB A;  4EZX A;  4H6H A;  3KAW A;  2YI8 A;  1E9V A;  4UDX X;  3A98 A;  4HR1 B;  1U00 A;  4R5J A;  4KIK B;  4EZR A;  2X5C A;  4NPH A;  3D2E A;  3VEA A;  3B53 X;  4R5G A;  5TKY A;  4R5L A;  3L3O M;  3ER8 C;  2YIB A;  1GNL A;  4IW0 A;  1E2U A;  2N3K A;  4JWI A;  4IWO A;  2GAF D;  2LM0 A;  1ZYL A;  4E3C A;  1JQK A;  5FIG A;  4EZP A;  4JLC A;  3FD9 A;  2Z8Y A;  3DPP A;  4IWP A;  5FLE X;  3T4A G;  4EZY A;  1SU6 A;  4HY9 A;  3T47 A;  1OA1 A;  3T46 A;  2RT6 A;  4HYB A;  3KAV A;  3RV0 A;  4EZW A;  3DPQ A;  2ND1 A;  3UIT A;  2YI9 A;  4EZU A;  2WIN M;  4IM2 A;  4F01 A;  3VKH A;  2ND0 A;  4JN4 A;  1MJG A;  2NCZ A;  4F00 A;  4HR1 A;  4KIK A;  4IWQ A;  4JWD A;  4JNE A;  3O3O B;  4EZZ A;  3D2F A;  1SU8 A;  3I39 X;  2OBL A;  2YIV X;  3ERC C;  3QNJ A;  2JNS A;  1DKX A;  1OA0 A;  3B51 X;  3OWG A;  3LMF A;  3KDR A;  4E81 A;  1GN9 A;  3C7N A;  4JL9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...