3T48A

Crystal structure of truncated form of staphylococcal complement inhibitor d (scin-d) at 1.5 angstrom
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
71
structure length
71
Chain Sequence
b'QHQALVDQLHELIANTDLNKLSYLNLDAFQKRDILAAHYIAKSAIRTKNLDQMTKAKQRLESIYNSISNPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SCIN-D
publication title Diversity in the C3b Convertase Contact Residues and Tertiary Structures of the Staphylococcal Complement Inhibitor (SCIN) Protein Family.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Immune system
total genus 26
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3t48A00
3DPOA 4F00A 1DKYA 4JNFA 3T4AG 1DKXA 4R5GA 3T49A 3D2FA 2WINM 4EZWA 4EZTA 4F01A 4R5IA 4H6IA 3QNJA 2QXLA 4JN4A 4R5JA 4EZSA 4HY9A 4JWDA 3DPPA 4EZVA 4R5LA 3T47A 5E84A 4EZQA 4JWEA 4JWCA 4EZNA 3DPQA 1U00A 4EZPA 1DKZA 2KHOA 3OHXM 5TKYA 4EZYA 4B9QA 4EZOA 3T46A 2QFFA 3C7NA 4PO2A 3D2EA 4JWIA 4R5KA 3T48A 4JNEA 4EZXA 4EZUA 4EZRA 4H6HA 4E81A 4EZZA 3L3OM 4HYBA
chains in the Genus database with same CATH superfamily
2NCZA 4JNFA 1E9VA 4KIKA 3PLTA 2F1AA 2O0I1 1SU8A 2V0OA 2D4CA 4R5KA 5C5BB 4JNEA 2WYHA 3CAZA 4IWQA 3CKDA 4H8SA 1QWNA 1TQVA 4HY9A 4EZVA 4AZ6A 2ND1A 5FLEX 2ZXQA 3LLLA 3I01A 1PS3A 4IWPA 1UPXA 1DKZA 3BVTA 4G6QA 2X3XA 4FZSA 1TQWA 3DPOA 4AZHA 4F00A 1MJGA 3D2FA 2WINM 4F01A 3EJUA 3VKHA 1R34A 4JWDA 3BVUA 3D51A 3M3WA 5TKYA 3BUDA 1OAOA 3T48A 2YKTA 2Q13A 3KAWA 4AZCA 4IWOA 3D4YA 3L3OM 4AZ5A 2RAJA 1DKYA 3OWGA 3SOGA 3O3NB 2GA9D 5FIGA 3HAHA 3EJRA 3B52X 1TQSA 3HAIA 2YI9A 4NSWA 1X04A 2FICA 2YL5A 4AZ7A 1HWWA 3DX2A 3B53X 1SU6A 4PO2A 4AZBA 1OA0A 2X3WA 2YLAA 3RPMA 3ABHA 2YIBA 1R33A 3VEBA 3KAVA 4AVMA 3I39X 2ALWA 1I4DA 1GN9A 4WPCA 3ACOA 2F7PA 2KHOA 4ATMA 1GNTA 1I49A 4EZUA 3D50A 3LVTA 4R5LA 3OK8A 3DPQA 4EZYA 3L3PA 3BLBA 3ZEDA 2YL9A 2YL6A 3DDFA 3ER8C 4EZXA 2ELBA 4KIKB 2PY6A 2RAKA 1DKXA 4R5GA 3BUBA 4JN4A 1Y2OA 2WYIA 2QKWA 1QX1A 4EZPA 3I2WA 2GAFD 4B9QA 1I4LA 3BUPA 2OBLA 3DX4A 4IW0A 2N3KA 4NQIA 4E3CA 2QXLA 4R5JA 2RT6A 1GNLA 2YL8A 2F1BA 2OO2A 4IM2A 1SU7A 3UITA 4WPEA 3RV0A 3BVXA 3D52A 4FZOA 1O7DB 3FD9A 3QWEA 3BUQA 4AZIA 2F18A 4HR1A 5E84A 1TQTA 2X3VA 3QNIA 1W9MA 1E2UA 4AZCB 3T46A 3B51X 3BUIA 1QWUA 2OBMA 4JL9A 4HR1B 2YLLA 3D4ZA 3LMFA 4BNEA 2EFLA 2EWFA 3F7WA 3T47A 2F7RA 4UDXX 4DYLA 2QFFA 2YIVX 4IM3A 4H6HA 4HYBA 3EJSA 2F7OA 1HTYA 3G9GA 2YI8A 3DPPA 3QA8A 1URUA 1X03A 3SYVA 2D1LA 2LM0A 3OHXM 4JWIA 2YIAA 2JNSA 4IM0A 3EJPA 2OW7A 3QE6A 5C5BA 4DCNC 2FYVA 2Z0OA 3QNJA 2Q12A 3DX0A 2OW6A 2Z8YA 1E1DA 2EX3B 4JWEA 3I04A 3BVWA 1LQ7A 3BVVA 2C08A 3ERCC 3T4AG 4AZGA 3HAJA 3DYTA 2X5CA 4EZWA 4EZSA 2PMRA 5KBPA 4JLCA 1SUFA 1HXKA 3DDGA 2EFKA 1ZYLA 4I1QA 3A98A 3ER9B 3T49A 2Z0VA 4EZTA 4NPHA 4EZQA 4FZPA 3RV1A 4AKVA 4JWCA 4EZOA 3D2EA 4EZRA 3CZSA 1WDZA 2JNKA 4M0MA 1TQUA 4H6IA 2ND0A 2OZNB 3Q0KA 2GF4A 3GI7A 3DX1A 3CZNA 3O3OB 2RAIA 1YWMA 4FM3A 1I4TA 3EJTA 4EZZA 2Z0NA 1R5EA 3KDRA 1O7DC 4R5IA 3O3MB 2LXYA 1OA1A 3EJQA 4UDYX 2F7QA 4EZNA 1U00A 1JQKA 3Q84A 3C7NA 1ZWWA 2MI7A 4D8JA 3CVRA 3VEAA 4E81A 3DX3A 3CV5A
chains in the Genus database with same CATH topology
3RV0A 2NCZA 3ERCC 4JNFA 3T4AG 1E9VA 2X5CA 4KIKA 3FD9A 4EZWA 2YIBA 4EZSA 3VEBA 3KAVA 4HR1A 1SU8A 3I39X 5E84A 1GN9A 1W9MA 1E2UA 4JLCA 1SUFA 2KHOA 1GNTA 3T46A 3B51X 4R5KA 4JNEA 1ZYLA 4EZUA 2OBMA 3A98A 3ER9B 4JL9A 4HR1B 3T49A 4IWQA 4EZTA 3LMFA 4NPHA 4HY9A 4EZVA 2EWFA 3F7WA 4R5LA 2ND1A 5FLEX 3T47A 4UDXX 4EZQA 3RV1A 3I01A 4JWCA 3DPQA 4IWPA 1UPXA 4EZOA 1DKZA 4EZYA 2QFFA 3D2EA 3ZEDA 2YIVX 4IM3A 4G6QA 3ER8C 4EZXA 4EZRA 4KIKB 4H6HA 4HYBA 3DPOA 4F00A 2PY6A 1DKXA 4R5GA 1MJGA 3D2FA 2WINM 4M0MA 4F01A 4H6IA 2YI8A 2ND0A 4JN4A 3VKHA 4JWDA 3GI7A 3DPPA 3QA8A 2LM0A 5TKYA 4EZPA 3OHXM 2GAFD 4B9QA 1OAOA 3O3OB 4JWIA 2YIAA 2JNSA 4FM3A 4IM0A 3T48A 3KAWA 4EZZA 2OBLA 4IWOA 3L3OM 1DKYA 4IW0A 3OWGA 2N3KA 3O3NB 2GA9D 3KDRA 5FIGA 4R5IA 4E3CA 3QNJA 2QXLA 3O3MB 3B52X 4R5JA 1OA1A 2RT6A 2YI9A 2Z8YA 1GNLA 4UDYX 1E1DA 2EX3B 4JWEA 4EZNA 3B53X 3I04A 1U00A 1SU6A 1JQKA 3C7NA 4PO2A 4IM2A 1SU7A 3UITA 1OA0A 4D8JA 3VEAA 4E81A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DPO A;  4F00 A;  1DKY A;  4JNF A;  3T4A G;  1DKX A;  4R5G A;  3T49 A;  3D2F A;  2WIN M;  4EZW A;  4EZT A;  4F01 A;  4R5I A;  4H6I A;  3QNJ A;  2QXL A;  4JN4 A;  4R5J A;  4EZS A;  4HY9 A;  4JWD A;  3DPP A;  4EZV A;  4R5L A;  3T47 A;  5E84 A;  4EZQ A;  4JWE A;  4JWC A;  4EZN A;  3DPQ A;  1U00 A;  4EZP A;  1DKZ A;  2KHO A;  3OHX M;  5TKY A;  4EZY A;  4B9Q A;  4EZO A;  3T46 A;  2QFF A;  3C7N A;  4PO2 A;  3D2E A;  4JWI A;  4R5K A;  3T48 A;  4JNE A;  4EZX A;  4EZU A;  4EZR A;  4H6H A;  4E81 A;  4EZZ A;  3L3O M;  4HYB A; 
#chains in the Genus database with same CATH topology
 2NCZ A;  4JNF A;  1E9V A;  4KIK A;  3PLT A;  2F1A A;  2O0I 1;  1SU8 A;  2V0O A;  2D4C A;  4R5K A;  5C5B B;  4JNE A;  2WYH A;  3CAZ A;  4IWQ A;  3CKD A;  4H8S A;  1QWN A;  1TQV A;  4HY9 A;  4EZV A;  4AZ6 A;  2ND1 A;  5FLE X;  2ZXQ A;  3LLL A;  3I01 A;  1PS3 A;  4IWP A;  1UPX A;  1DKZ A;  3BVT A;  4G6Q A;  2X3X A;  4FZS A;  1TQW A;  3DPO A;  4AZH A;  4F00 A;  1MJG A;  3D2F A;  2WIN M;  4F01 A;  3EJU A;  3VKH A;  1R34 A;  4JWD A;  3BVU A;  3D51 A;  3M3W A;  5TKY A;  3BUD A;  1OAO A;  3T48 A;  2YKT A;  2Q13 A;  3KAW A;  4AZC A;  4IWO A;  3D4Y A;  3L3O M;  4AZ5 A;  2RAJ A;  1DKY A;  3OWG A;  3SOG A;  3O3N B;  2GA9 D;  5FIG A;  3HAH A;  3EJR A;  3B52 X;  1TQS A;  3HAI A;  2YI9 A;  4NSW A;  1X04 A;  2FIC A;  2YL5 A;  4AZ7 A;  1HWW A;  3DX2 A;  3B53 X;  1SU6 A;  4PO2 A;  4AZB A;  1OA0 A;  2X3W A;  2YLA A;  3RPM A;  3ABH A;  2YIB A;  1R33 A;  3VEB A;  3KAV A;  4AVM A;  3I39 X;  2ALW A;  1I4D A;  1GN9 A;  4WPC A;  3ACO A;  2F7P A;  2KHO A;  4ATM A;  1GNT A;  1I49 A;  4EZU A;  3D50 A;  3LVT A;  4R5L A;  3OK8 A;  3DPQ A;  4EZY A;  3L3P A;  3BLB A;  3ZED A;  2YL9 A;  2YL6 A;  3DDF A;  3ER8 C;  4EZX A;  2ELB A;  4KIK B;  2PY6 A;  2RAK A;  1DKX A;  4R5G A;  3BUB A;  4JN4 A;  1Y2O A;  2WYI A;  2QKW A;  1QX1 A;  4EZP A;  3I2W A;  2GAF D;  4B9Q A;  1I4L A;  3BUP A;  2OBL A;  3DX4 A;  4IW0 A;  2N3K A;  4NQI A;  4E3C A;  2QXL A;  4R5J A;  2RT6 A;  1GNL A;  2YL8 A;  2F1B A;  2OO2 A;  4IM2 A;  1SU7 A;  3UIT A;  4WPE A;  3RV0 A;  3BVX A;  3D52 A;  4FZO A;  1O7D B;  3FD9 A;  3QWE A;  3BUQ A;  4AZI A;  2F18 A;  4HR1 A;  5E84 A;  1TQT A;  2X3V A;  3QNI A;  1W9M A;  1E2U A;  4AZC B;  3T46 A;  3B51 X;  3BUI A;  1QWU A;  2OBM A;  4JL9 A;  4HR1 B;  2YLL A;  3D4Z A;  3LMF A;  4BNE A;  2EFL A;  2EWF A;  3F7W A;  3T47 A;  2F7R A;  4UDX X;  4DYL A;  2QFF A;  2YIV X;  4IM3 A;  4H6H A;  4HYB A;  3EJS A;  2F7O A;  1HTY A;  3G9G A;  2YI8 A;  3DPP A;  3QA8 A;  1URU A;  1X03 A;  3SYV A;  2D1L A;  2LM0 A;  3OHX M;  4JWI A;  2YIA A;  2JNS A;  4IM0 A;  3EJP A;  2OW7 A;  3QE6 A;  5C5B A;  4DCN C;  2FYV A;  2Z0O A;  3QNJ A;  2Q12 A;  3DX0 A;  2OW6 A;  2Z8Y A;  1E1D A;  2EX3 B;  4JWE A;  3I04 A;  3BVW A;  1LQ7 A;  3BVV A;  2C08 A;  3ERC C;  3T4A G;  4AZG A;  3HAJ A;  3DYT A;  2X5C A;  4EZW A;  4EZS A;  2PMR A;  5KBP A;  4JLC A;  1SUF A;  1HXK A;  3DDG A;  2EFK A;  1ZYL A;  4I1Q A;  3A98 A;  3ER9 B;  3T49 A;  2Z0V A;  4EZT A;  4NPH A;  4EZQ A;  4FZP A;  3RV1 A;  4AKV A;  4JWC A;  4EZO A;  3D2E A;  4EZR A;  3CZS A;  1WDZ A;  2JNK A;  4M0M A;  1TQU A;  4H6I A;  2ND0 A;  2OZN B;  3Q0K A;  2GF4 A;  3GI7 A;  3DX1 A;  3CZN A;  3O3O B;  2RAI A;  1YWM A;  4FM3 A;  1I4T A;  3EJT A;  4EZZ A;  2Z0N A;  1R5E A;  3KDR A;  1O7D C;  4R5I A;  3O3M B;  2LXY A;  1OA1 A;  3EJQ A;  4UDY X;  2F7Q A;  4EZN A;  1U00 A;  1JQK A;  3Q84 A;  3C7N A;  1ZWW A;  2MI7 A;  4D8J A;  3CVR A;  3VEA A;  4E81 A;  3DX3 A;  3CV5 A; 
#chains in the Genus database with same CATH homology
 3RV0 A;  2NCZ A;  3ERC C;  4JNF A;  3T4A G;  1E9V A;  2X5C A;  4KIK A;  3FD9 A;  4EZW A;  2YIB A;  4EZS A;  3VEB A;  3KAV A;  4HR1 A;  1SU8 A;  3I39 X;  5E84 A;  1GN9 A;  1W9M A;  1E2U A;  4JLC A;  1SUF A;  2KHO A;  1GNT A;  3T46 A;  3B51 X;  4R5K A;  4JNE A;  1ZYL A;  4EZU A;  2OBM A;  3A98 A;  3ER9 B;  4JL9 A;  4HR1 B;  3T49 A;  4IWQ A;  4EZT A;  3LMF A;  4NPH A;  4HY9 A;  4EZV A;  2EWF A;  3F7W A;  4R5L A;  2ND1 A;  5FLE X;  3T47 A;  4UDX X;  4EZQ A;  3RV1 A;  3I01 A;  4JWC A;  3DPQ A;  4IWP A;  1UPX A;  4EZO A;  1DKZ A;  4EZY A;  2QFF A;  3D2E A;  3ZED A;  2YIV X;  4IM3 A;  4G6Q A;  3ER8 C;  4EZX A;  4EZR A;  4KIK B;  4H6H A;  4HYB A;  3DPO A;  4F00 A;  2PY6 A;  1DKX A;  4R5G A;  1MJG A;  3D2F A;  2WIN M;  4M0M A;  4F01 A;  4H6I A;  2YI8 A;  2ND0 A;  4JN4 A;  3VKH A;  4JWD A;  3GI7 A;  3DPP A;  3QA8 A;  2LM0 A;  5TKY A;  4EZP A;  3OHX M;  2GAF D;  4B9Q A;  1OAO A;  3O3O B;  4JWI A;  2YIA A;  2JNS A;  4FM3 A;  4IM0 A;  3T48 A;  3KAW A;  4EZZ A;  2OBL A;  4IWO A;  3L3O M;  1DKY A;  4IW0 A;  3OWG A;  2N3K A;  3O3N B;  2GA9 D;  3KDR A;  5FIG A;  4R5I A;  4E3C A;  3QNJ A;  2QXL A;  3O3M B;  3B52 X;  4R5J A;  1OA1 A;  2RT6 A;  2YI9 A;  2Z8Y A;  1GNL A;  4UDY X;  1E1D A;  2EX3 B;  4JWE A;  4EZN A;  3B53 X;  3I04 A;  1U00 A;  1SU6 A;  1JQK A;  3C7N A;  4PO2 A;  4IM2 A;  1SU7 A;  3UIT A;  1OA0 A;  4D8J A;  3VEA A;  4E81 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...