2EX3B

Bacteriophage phi29 dna polymerase bound to terminal protein
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
196
Chain Sequence
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXANMRYQFEKNAYGVVASKAKIAEIERNTKEVQRLVDEKIKAMKDKEYYATGINRPHDFDFSKVRSYSRLRTLEESMEMRTDPQYYEKKMIQLQLNFIKSVEGSFNSFDAADELIEELKKIPPDDFYELFLRISEISGNTVENVEGNVYKILSYLEQYRRGDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/replication
molecule keywords DNA polymerase
publication title The phi29 DNA polymerase:protein-primer structure suggests a model for the initiation to elongation transition
pubmed doi rcsb
source organism Bacillus phage phi29
total genus 55
structure length 196
sequence length 223
chains with identical sequence D, F, H, J, L
ec nomenclature
pdb deposition date 2005-11-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.230 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 2ex3B02
2EX3B
chains in the Genus database with same CATH superfamily
3A98A 3OHXM 1SU6A 2JNKA 3PLTA 1YWMA 2WYHA 3BUDA 3KAWA 3UITA 2LM0A 3DPPA 4JN4A 1X03A 1O7DB 1HWWA 4HYBA 3CV5A 4JWIA 4EZNA 5KBPA 3B51X 2EFKA 1W9MA 2YIAA 3CKDA 3Q84A 4HY9A 1O7DC 4IM0A 3ER8C 2X3WA 1ZWWA 4AZHA 5E84A 3G9GA 2YLAA 4R5GA 4AZGA 1Y2OA 4NSWA 3QA8A 2GAFD 3BVWA 4EZWA 2O0I1 3CZNA 4EZUA 4NQIA 4H8SA 3GI7A 4IWQA 4I1QA 1TQUA 2OZNB 3VEAA 2GA9D 4JNFA 4AZIA 4PO2A 1WDZA 3DX1A 4KIKB 5FIGA 1MJGA 4R5IA 2X3VA 3DYTA 3BVUA 2ALWA 3T4AG 2PY6A 1OA1A 4AZBA 4FZPA 4AKVA 4IWPA 3DDFA 2KHOA 4KIKA 3T46A 3T48A 2EFLA 3O3NB 3RV1A 2YL9A 2Z0OA 2YIVX 2F7PA 2Z8YA 2ZXQA 3CAZA 3CZSA 4IW0A 2RAKA 3CVRA 4R5LA 1URUA 2F1BA 3T47A 3M3WA 3OWGA 3EJQA 4D8JA 2YL5A 3D52A 2PMRA 3D4ZA 4HR1B 4JWCA 1TQSA 3ABHA 3B52X 4M0MA 3ER9B 4EZZA 3QE6A 3D50A 2YIBA 3HAJA 4IWOA 4UDYX 3BUBA 4JWEA 2X5CA 4HR1A 3BVXA 3B53X 1U00A 3QNIA 1I4DA 1SUFA 4AZCB 3HAIA 4EZVA 1HXKA 3EJSA 3D2FA 1JQKA 3F7WA 1TQVA 4NPHA 2YL8A 2F7QA 4B9QA 3DX0A 1DKZA 3T49A 2Z0NA 4WPCA 2FYVA 3ACOA 2JNSA 1QWNA 4EZSA 1X04A 1QWUA 3DX2A 3O3MB 1DKXA 1OAOA 1LQ7A 2EWFA 4AZCA 2EX3B 3L3OM 1E1DA 2RAIA 3RV0A 4AVMA 4EZRA 1TQWA 1I49A 2YKTA 4WPEA 4ATMA 2F7RA 5TKYA 3DDGA 4EZQA 2QFFA 2QKWA 2ELBA 2MI7A 1R34A 3FD9A 2RT6A 2OW7A 3ZEDA 1UPXA 2N3KA 2F18A 3EJUA 1GN9A 4F00A 3L3PA 4EZXA 3BUQA 4AZ7A 2Q12A 3OK8A 1R5EA 3LVTA 4G6QA 1SU8A 4DCNC 1QX1A 2Q13A 3D4YA 4FM3A 3I39X 1HTYA 4AZ5A 1E9VA 4JL9A 4EZOA 3ERCC 4AZ6A 2V0OA 1I4LA 3C7NA 2NCZA 2QXLA 4IM2A 2OO2A 3Q0KA 1SU7A 3EJPA 1PS3A 5C5BB 1E2UA 3DPOA 4F01A 4JLCA 1ZYLA 4EZPA 3SOGA 1DKYA 4DYLA 2ND1A 2YL6A 3BUPA 4H6IA 4IM3A 4EZTA 2WINM 3EJTA 3DX4A 2OBMA 2FICA 2OBLA 4H6HA 4EZYA 3KDRA 3DX3A 3BVVA 4BNEA 2X3XA 1I4TA 1OA0A 2YI8A 5C5BA 4JNEA 2C08A 2F1AA 3QWEA 2RAJA 3DPQA 4UDXX 4E3CA 3QNJA 2D1LA 3O3OB 4JWDA 2GF4A 3SYVA 3VKHA 4FZOA 3EJRA 2OW6A 1GNTA 2WYIA 2D4CA 4R5JA 2YLLA 3LMFA 3BUIA 1TQTA 4FZSA 1R33A 3LLLA 3BLBA 3I2WA 2LXYA 3HAHA 3D51A 3BVTA 3I04A 2ND0A 2YI9A 3RPMA 5FLEX 2Z0VA 2F7OA 3I01A 3VEBA 3KAVA 3D2EA 1GNLA 4R5KA 4E81A
chains in the Genus database with same CATH topology
3A98A 3T4AG 2PY6A 2JNSA 1DKYA 3OHXM 1OA1A 2ND1A 1SU6A 4EZSA 4H6IA 4IM3A 4EZTA 2WINM 4IWPA 2OBMA 3O3MB 1DKXA 2OBLA 4H6HA 1OAOA 4EZYA 3KDRA 2EWFA 2EX3B 2KHOA 1E1DA 3L3OM 1OA0A 4KIKA 3T46A 3T48A 2YI8A 3O3NB 3KAWA 3RV0A 4EZRA 3RV1A 3UITA 4JNEA 2LM0A 2YIVX 3DPPA 4JN4A 2Z8YA 5TKYA 4HYBA 4IW0A 4EZQA 4JWIA 3DPQA 4UDXX 4EZNA 2QFFA 4R5LA 3B51X 4E3CA 3QNJA 1W9MA 3FD9A 3T47A 3O3OB 4JWDA 2RT6A 3OWGA 2YIAA 4HY9A 4IM0A 3ZEDA 3ER8C 4D8JA 1UPXA 2N3KA 4F00A 1GN9A 3VKHA 4EZXA 4HR1B 5E84A 1GNTA 4JWCA 4R5GA 4R5JA 4G6QA 1SU8A 3QA8A 3LMFA 2GAFD 4EZWA 3B52X 4M0MA 4FM3A 3ER9B 3I39X 4EZUA 4EZZA 2YIBA 1E9VA 4JL9A 4EZOA 3GI7A 4IWQA 4IWOA 4UDYX 3ERCC 4JWEA 2X5CA 3C7NA 4HR1A 2NCZA 3VEAA 2GA9D 3I04A 4JNFA 3B53X 2ND0A 1U00A 2QXLA 2YI9A 4IM2A 1SUFA 4EZVA 4PO2A 5FLEX 1SU7A 3D2FA 4KIKB 1JQKA 5FIGA 3I01A 3VEBA 3KAVA 3F7WA 4NPHA 1MJGA 1E2UA 3DPOA 3D2EA 4F01A 4R5IA 4JLCA 1GNLA 4B9QA 1ZYLA 4EZPA 4R5KA 1DKZA 3T49A 4E81A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EX3 B; 
#chains in the Genus database with same CATH topology
 3A98 A;  3OHX M;  1SU6 A;  2JNK A;  3PLT A;  1YWM A;  2WYH A;  3BUD A;  3KAW A;  3UIT A;  2LM0 A;  3DPP A;  4JN4 A;  1X03 A;  1O7D B;  1HWW A;  4HYB A;  3CV5 A;  4JWI A;  4EZN A;  5KBP A;  3B51 X;  2EFK A;  1W9M A;  2YIA A;  3CKD A;  3Q84 A;  4HY9 A;  1O7D C;  4IM0 A;  3ER8 C;  2X3W A;  1ZWW A;  4AZH A;  5E84 A;  3G9G A;  2YLA A;  4R5G A;  4AZG A;  1Y2O A;  4NSW A;  3QA8 A;  2GAF D;  3BVW A;  4EZW A;  2O0I 1;  3CZN A;  4EZU A;  4NQI A;  4H8S A;  3GI7 A;  4IWQ A;  4I1Q A;  1TQU A;  2OZN B;  3VEA A;  2GA9 D;  4JNF A;  4AZI A;  4PO2 A;  1WDZ A;  3DX1 A;  4KIK B;  5FIG A;  1MJG A;  4R5I A;  2X3V A;  3DYT A;  3BVU A;  2ALW A;  3T4A G;  2PY6 A;  1OA1 A;  4AZB A;  4FZP A;  4AKV A;  4IWP A;  3DDF A;  2KHO A;  4KIK A;  3T46 A;  3T48 A;  2EFL A;  3O3N B;  3RV1 A;  2YL9 A;  2Z0O A;  2YIV X;  2F7P A;  2Z8Y A;  2ZXQ A;  3CAZ A;  3CZS A;  4IW0 A;  2RAK A;  3CVR A;  4R5L A;  1URU A;  2F1B A;  3T47 A;  3M3W A;  3OWG A;  3EJQ A;  4D8J A;  2YL5 A;  3D52 A;  2PMR A;  3D4Z A;  4HR1 B;  4JWC A;  1TQS A;  3ABH A;  3B52 X;  4M0M A;  3ER9 B;  4EZZ A;  3QE6 A;  3D50 A;  2YIB A;  3HAJ A;  4IWO A;  4UDY X;  3BUB A;  4JWE A;  2X5C A;  4HR1 A;  3BVX A;  3B53 X;  1U00 A;  3QNI A;  1I4D A;  1SUF A;  4AZC B;  3HAI A;  4EZV A;  1HXK A;  3EJS A;  3D2F A;  1JQK A;  3F7W A;  1TQV A;  4NPH A;  2YL8 A;  2F7Q A;  4B9Q A;  3DX0 A;  1DKZ A;  3T49 A;  2Z0N A;  4WPC A;  2FYV A;  3ACO A;  2JNS A;  1QWN A;  4EZS A;  1X04 A;  1QWU A;  3DX2 A;  3O3M B;  1DKX A;  1OAO A;  1LQ7 A;  2EWF A;  4AZC A;  2EX3 B;  3L3O M;  1E1D A;  2RAI A;  3RV0 A;  4AVM A;  4EZR A;  1TQW A;  1I49 A;  2YKT A;  4WPE A;  4ATM A;  2F7R A;  5TKY A;  3DDG A;  4EZQ A;  2QFF A;  2QKW A;  2ELB A;  2MI7 A;  1R34 A;  3FD9 A;  2RT6 A;  2OW7 A;  3ZED A;  1UPX A;  2N3K A;  2F18 A;  3EJU A;  1GN9 A;  4F00 A;  3L3P A;  4EZX A;  3BUQ A;  4AZ7 A;  2Q12 A;  3OK8 A;  1R5E A;  3LVT A;  4G6Q A;  1SU8 A;  4DCN C;  1QX1 A;  2Q13 A;  3D4Y A;  4FM3 A;  3I39 X;  1HTY A;  4AZ5 A;  1E9V A;  4JL9 A;  4EZO A;  3ERC C;  4AZ6 A;  2V0O A;  1I4L A;  3C7N A;  2NCZ A;  2QXL A;  4IM2 A;  2OO2 A;  3Q0K A;  1SU7 A;  3EJP A;  1PS3 A;  5C5B B;  1E2U A;  3DPO A;  4F01 A;  4JLC A;  1ZYL A;  4EZP A;  3SOG A;  1DKY A;  4DYL A;  2ND1 A;  2YL6 A;  3BUP A;  4H6I A;  4IM3 A;  4EZT A;  2WIN M;  3EJT A;  3DX4 A;  2OBM A;  2FIC A;  2OBL A;  4H6H A;  4EZY A;  3KDR A;  3DX3 A;  3BVV A;  4BNE A;  2X3X A;  1I4T A;  1OA0 A;  2YI8 A;  5C5B A;  4JNE A;  2C08 A;  2F1A A;  3QWE A;  2RAJ A;  3DPQ A;  4UDX X;  4E3C A;  3QNJ A;  2D1L A;  3O3O B;  4JWD A;  2GF4 A;  3SYV A;  3VKH A;  4FZO A;  3EJR A;  2OW6 A;  1GNT A;  2WYI A;  2D4C A;  4R5J A;  2YLL A;  3LMF A;  3BUI A;  1TQT A;  4FZS A;  1R33 A;  3LLL A;  3BLB A;  3I2W A;  2LXY A;  3HAH A;  3D51 A;  3BVT A;  3I04 A;  2ND0 A;  2YI9 A;  3RPM A;  5FLE X;  2Z0V A;  2F7O A;  3I01 A;  3VEB A;  3KAV A;  3D2E A;  1GNL A;  4R5K A;  4E81 A; 
#chains in the Genus database with same CATH homology
 3A98 A;  3T4A G;  2PY6 A;  2JNS A;  1DKY A;  3OHX M;  1OA1 A;  2ND1 A;  1SU6 A;  4EZS A;  4H6I A;  4IM3 A;  4EZT A;  2WIN M;  4IWP A;  2OBM A;  3O3M B;  1DKX A;  2OBL A;  4H6H A;  1OAO A;  4EZY A;  3KDR A;  2EWF A;  2EX3 B;  2KHO A;  1E1D A;  3L3O M;  1OA0 A;  4KIK A;  3T46 A;  3T48 A;  2YI8 A;  3O3N B;  3KAW A;  3RV0 A;  4EZR A;  3RV1 A;  3UIT A;  4JNE A;  2LM0 A;  2YIV X;  3DPP A;  4JN4 A;  2Z8Y A;  5TKY A;  4HYB A;  4IW0 A;  4EZQ A;  4JWI A;  3DPQ A;  4UDX X;  4EZN A;  2QFF A;  4R5L A;  3B51 X;  4E3C A;  3QNJ A;  1W9M A;  3FD9 A;  3T47 A;  3O3O B;  4JWD A;  2RT6 A;  3OWG A;  2YIA A;  4HY9 A;  4IM0 A;  3ZED A;  3ER8 C;  4D8J A;  1UPX A;  2N3K A;  4F00 A;  1GN9 A;  3VKH A;  4EZX A;  4HR1 B;  5E84 A;  1GNT A;  4JWC A;  4R5G A;  4R5J A;  4G6Q A;  1SU8 A;  3QA8 A;  3LMF A;  2GAF D;  4EZW A;  3B52 X;  4M0M A;  4FM3 A;  3ER9 B;  3I39 X;  4EZU A;  4EZZ A;  2YIB A;  1E9V A;  4JL9 A;  4EZO A;  3GI7 A;  4IWQ A;  4IWO A;  4UDY X;  3ERC C;  4JWE A;  2X5C A;  3C7N A;  4HR1 A;  2NCZ A;  3VEA A;  2GA9 D;  3I04 A;  4JNF A;  3B53 X;  2ND0 A;  1U00 A;  2QXL A;  2YI9 A;  4IM2 A;  1SUF A;  4EZV A;  4PO2 A;  5FLE X;  1SU7 A;  3D2F A;  4KIK B;  1JQK A;  5FIG A;  3I01 A;  3VEB A;  3KAV A;  3F7W A;  4NPH A;  1MJG A;  1E2U A;  3DPO A;  3D2E A;  4F01 A;  4R5I A;  4JLC A;  1GNL A;  4B9Q A;  1ZYL A;  4EZP A;  4R5K A;  1DKZ A;  3T49 A;  4E81 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...