2X3XA

Structure of mouse syndapin i (crystal form 1)
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
291
structure length
291
Chain Sequence
b'DSFWEVGNYKRTVKRIDDGHRLCNDLMSCVQERAKIEKAYAQQLTDWAKRWRQLIEKGPQYGSLERAWGAMMTEADKVSELHQEVKNSLLNEDLEKVKNWQKDAYHKQIMGGFKETKEAEDGFRKAQKPWAKKMKELEAAKKAYHLACKEERLAMTREMNSKTEQSVTPEQQKKLVDKVDKCRQDVQKTQEKYEKVLEDVGKTTPQYMEGMEQVFEQCQQFEEKRLVFLKEVLLDIKRHLNLAENSSYMHVYRELEQAIRGADAQEDLRWFRSTSGPGMPMNWPQFEEWNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN KINASE C AND CASEIN KINASE SUBSTRATE IN NEURONS PROT
publication title Molecular Basis for SH3 Domain Regulation of F-Bar-Mediated Membrane Deformation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Endocytosis
total genus 112
structure length 291
sequence length 291
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00611 FCH Fes/CIP4, and EFC/F-BAR homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 2x3xA01
3HAHA 3QWEA 2Z0NA 3Q0KA 2X3XA 3CAZA 2Z0VA 3DYTA 3LLLA 5C5BA 2FICA 3SOGA 3ABHA 2D1LA 2RAJA 1I4DA 4BNEA 3HAJA 3I2WA 4I1QA 2RAKA 1I49A 4AKVA 3PLTA 1X03A 2X3WA 4WPEA 5C5BB 2ELBA 1WDZA 3M3WA 2YKTA 2V0OA 2EFLA 2Q13A 3G9GA 4ATMA 3QE6A 4DYLA 4NQIA 1Y2OA 1I4LA 4FZSA 1X04A 2C08A 3ACOA 3HAIA 3SYVA 2Z0OA 4DCNC 3Q84A 1I4TA 4NSWA 2RAIA 4H8SA 2EFKA 3OK8A 1URUA 2Q12A 3QNIA 4AVMA 2X3VA 2D4CA 4WPCA 1ZWWA
chains in the Genus database with same CATH superfamily
2X3XA 2YIBA 4EZWA 2OO2A 2ND0A 2RAJA 4F00A 4AZIA 4AKVA 1X03A 3VEAA 1SU8A 2JNKA 5KBPA 1DKYA 4IW0A 3T4AG 3ERCC 3CV5A 1PS3A 3BUPA 4EZUA 4AZHA 3DYTA 2N3KA 2WYIA 4FM3A 4KIKB 1E9VA 1TQUA 3I2WA 4D8JA 4JWCA 3D50A 5C5BB 2Z0OA 3BUBA 1GNLA 3I01A 4M0MA 3DPQA 1QWUA 3QWEA 3Q0KA 1MJGA 1O7DC 4EZVA 2D1LA 2F1BA 2RAKA 2FYVA 3L3OM 4EZOA 3BVVA 2Q13A 1OA0A 3G9GA 3LMFA 3D4ZA 2C08A 2JNSA 2EFKA 2Q12A 2PY6A 3LLLA 3SOGA 2YLAA 2EWFA 3BUDA 3B52X 3CKDA 4R5JA 3T48A 4EZTA 3HAIA 4AZGA 4G6QA 2X5CA 4EZRA 2WINM 4WPCA 2ZXQA 3KAVA 2F7PA 3CAZA 4R5KA 2YI8A 2QFFA 3DPOA 5FIGA 2F18A 3EJSA 3D2EA 3PLTA 4WPEA 3KAWA 4FZSA 2QKWA 4DCNC 3D4YA 4H8SA 5FLEX 2X3VA 1Y2OA 4UDYX 3BUIA 4R5LA 3VKHA 2PMRA 4AZ7A 2YL5A 2YIVX 3T49A 3EJTA 4IM2A 4JNFA 4EZSA 3QNIA 2ND1A 3C7NA 4JNEA 2LM0A 1E1DA 3EJQA 2YLLA 3ZEDA 4EZQA 2F7OA 1W9MA 3O3NB 3OHXM 3B51X 3KDRA 2YL8A 1TQTA 1TQSA 4JWEA 4NSWA 1ZYLA 3VEBA 1O7DB 1DKXA 2OW6A 4JN4A 2FICA 4R5GA 1SU6A 2YL9A 2X3WA 1OA1A 4F01A 2EX3B 3CVRA 4JL9A 3F7WA 1QX1A 4AZCB 4JLCA 4IM3A 3DX4A 1TQVA 1GNTA 4ATMA 3QE6A 4DYLA 1R33A 3ACOA 4IWOA 3DPPA 1I4TA 2WYHA 4KIKA 2D4CA 1R5EA 3SYVA 4HYBA 2F7RA 5C5BA 3CZSA 4UDXX 3ABHA 2Z8YA 2F7QA 3BVWA 4NPHA 2V0OA 4EZZA 3Q84A 3BVXA 2Z0VA 1ZWWA 3GI7A 5TKYA 4H6IA 3BVUA 4PO2A 1HTYA 3L3PA 4NQIA 1I4LA 4AZ5A 2F1AA 2OBLA 1SU7A 3T47A 3ER9B 3I04A 4JWIA 3EJUA 3EJPA 1I49A 4HR1A 1HXKA 1E2UA 4IWQA 4E3CA 2O0I1 3RV1A 3RPMA 1LQ7A 2YI9A 3BLBA 2MI7A 3DX1A 2RAIA 3OK8A 3ER8C 4AVMA 2OW7A 2GAFD 3DX3A 3HAHA 3D52A 1DKZA 2QXLA 1HWWA 1YWMA 3I39X 4FZOA 4B9QA 2EFLA 1R34A 2OZNB 2GA9D 3DDFA 4AZBA 4FZPA 1URUA 3BVTA 5E84A 1OAOA 3DDGA 2Z0NA 3UITA 4E81A 3A98A 3B53X 4EZYA 2YIAA 3D2FA 4EZNA 4EZPA 3QNJA 2ELBA 3M3WA 4H6HA 2ALWA 1JQKA 1UPXA 3OWGA 4AZ6A 3LVTA 4BNEA 3EJRA 2OBMA 3O3OB 4R5IA 2YL6A 1I4DA 3HAJA 1U00A 2NCZA 1WDZA 3CZNA 4JWDA 4HR1B 1X04A 1TQWA 3DX2A 1SUFA 2GF4A 1GN9A 3BUQA 3FD9A 2KHOA 3O3MB 4HY9A 4IWPA 4I1QA 3T46A 4IM0A 3QA8A 4EZXA 2YKTA 3RV0A 1QWNA 2LXYA 3D51A 2RT6A 3DX0A 4AZCA
chains in the Genus database with same CATH topology
3HAHA 3QWEA 2Z0NA 3Q0KA 2X3XA 3CAZA 2Z0VA 3DYTA 3LLLA 5C5BA 2FICA 3SOGA 3ABHA 2D1LA 2RAJA 1I4DA 4BNEA 3HAJA 3I2WA 4I1QA 2RAKA 1I49A 4AKVA 3PLTA 1X03A 2X3WA 4WPEA 5C5BB 2ELBA 1WDZA 3M3WA 2YKTA 2V0OA 2EFLA 2Q13A 3G9GA 4ATMA 3QE6A 4DYLA 4NQIA 1Y2OA 1I4LA 4FZSA 1X04A 2C08A 3ACOA 3HAIA 3SYVA 2Z0OA 4DCNC 3Q84A 1I4TA 4NSWA 2RAIA 4H8SA 2EFKA 3OK8A 1URUA 2Q12A 3QNIA 4AVMA 2X3VA 2D4CA 4WPCA 1ZWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HAH A;  3QWE A;  2Z0N A;  3Q0K A;  2X3X A;  3CAZ A;  2Z0V A;  3DYT A;  3LLL A;  5C5B A;  2FIC A;  3SOG A;  3ABH A;  2D1L A;  2RAJ A;  1I4D A;  4BNE A;  3HAJ A;  3I2W A;  4I1Q A;  2RAK A;  1I49 A;  4AKV A;  3PLT A;  1X03 A;  2X3W A;  4WPE A;  5C5B B;  2ELB A;  1WDZ A;  3M3W A;  2YKT A;  2V0O A;  2EFL A;  2Q13 A;  3G9G A;  4ATM A;  3QE6 A;  4DYL A;  4NQI A;  1Y2O A;  1I4L A;  4FZS A;  1X04 A;  2C08 A;  3ACO A;  3HAI A;  3SYV A;  2Z0O A;  4DCN C;  3Q84 A;  1I4T A;  4NSW A;  2RAI A;  4H8S A;  2EFK A;  3OK8 A;  1URU A;  2Q12 A;  3QNI A;  4AVM A;  2X3V A;  2D4C A;  4WPC A;  1ZWW A; 
#chains in the Genus database with same CATH topology
 2X3X A;  2YIB A;  4EZW A;  2OO2 A;  2ND0 A;  2RAJ A;  4F00 A;  4AZI A;  4AKV A;  1X03 A;  3VEA A;  1SU8 A;  2JNK A;  5KBP A;  1DKY A;  4IW0 A;  3T4A G;  3ERC C;  3CV5 A;  1PS3 A;  3BUP A;  4EZU A;  4AZH A;  3DYT A;  2N3K A;  2WYI A;  4FM3 A;  4KIK B;  1E9V A;  1TQU A;  3I2W A;  4D8J A;  4JWC A;  3D50 A;  5C5B B;  2Z0O A;  3BUB A;  1GNL A;  3I01 A;  4M0M A;  3DPQ A;  1QWU A;  3QWE A;  3Q0K A;  1MJG A;  1O7D C;  4EZV A;  2D1L A;  2F1B A;  2RAK A;  2FYV A;  3L3O M;  4EZO A;  3BVV A;  2Q13 A;  1OA0 A;  3G9G A;  3LMF A;  3D4Z A;  2C08 A;  2JNS A;  2EFK A;  2Q12 A;  2PY6 A;  3LLL A;  3SOG A;  2YLA A;  2EWF A;  3BUD A;  3B52 X;  3CKD A;  4R5J A;  3T48 A;  4EZT A;  3HAI A;  4AZG A;  4G6Q A;  2X5C A;  4EZR A;  2WIN M;  4WPC A;  2ZXQ A;  3KAV A;  2F7P A;  3CAZ A;  4R5K A;  2YI8 A;  2QFF A;  3DPO A;  5FIG A;  2F18 A;  3EJS A;  3D2E A;  3PLT A;  4WPE A;  3KAW A;  4FZS A;  2QKW A;  4DCN C;  3D4Y A;  4H8S A;  5FLE X;  2X3V A;  1Y2O A;  4UDY X;  3BUI A;  4R5L A;  3VKH A;  2PMR A;  4AZ7 A;  2YL5 A;  2YIV X;  3T49 A;  3EJT A;  4IM2 A;  4JNF A;  4EZS A;  3QNI A;  2ND1 A;  3C7N A;  4JNE A;  2LM0 A;  1E1D A;  3EJQ A;  2YLL A;  3ZED A;  4EZQ A;  2F7O A;  1W9M A;  3O3N B;  3OHX M;  3B51 X;  3KDR A;  2YL8 A;  1TQT A;  1TQS A;  4JWE A;  4NSW A;  1ZYL A;  3VEB A;  1O7D B;  1DKX A;  2OW6 A;  4JN4 A;  2FIC A;  4R5G A;  1SU6 A;  2YL9 A;  2X3W A;  1OA1 A;  4F01 A;  2EX3 B;  3CVR A;  4JL9 A;  3F7W A;  1QX1 A;  4AZC B;  4JLC A;  4IM3 A;  3DX4 A;  1TQV A;  1GNT A;  4ATM A;  3QE6 A;  4DYL A;  1R33 A;  3ACO A;  4IWO A;  3DPP A;  1I4T A;  2WYH A;  4KIK A;  2D4C A;  1R5E A;  3SYV A;  4HYB A;  2F7R A;  5C5B A;  3CZS A;  4UDX X;  3ABH A;  2Z8Y A;  2F7Q A;  3BVW A;  4NPH A;  2V0O A;  4EZZ A;  3Q84 A;  3BVX A;  2Z0V A;  1ZWW A;  3GI7 A;  5TKY A;  4H6I A;  3BVU A;  4PO2 A;  1HTY A;  3L3P A;  4NQI A;  1I4L A;  4AZ5 A;  2F1A A;  2OBL A;  1SU7 A;  3T47 A;  3ER9 B;  3I04 A;  4JWI A;  3EJU A;  3EJP A;  1I49 A;  4HR1 A;  1HXK A;  1E2U A;  4IWQ A;  4E3C A;  2O0I 1;  3RV1 A;  3RPM A;  1LQ7 A;  2YI9 A;  3BLB A;  2MI7 A;  3DX1 A;  2RAI A;  3OK8 A;  3ER8 C;  4AVM A;  2OW7 A;  2GAF D;  3DX3 A;  3HAH A;  3D52 A;  1DKZ A;  2QXL A;  1HWW A;  1YWM A;  3I39 X;  4FZO A;  4B9Q A;  2EFL A;  1R34 A;  2OZN B;  2GA9 D;  3DDF A;  4AZB A;  4FZP A;  1URU A;  3BVT A;  5E84 A;  1OAO A;  3DDG A;  2Z0N A;  3UIT A;  4E81 A;  3A98 A;  3B53 X;  4EZY A;  2YIA A;  3D2F A;  4EZN A;  4EZP A;  3QNJ A;  2ELB A;  3M3W A;  4H6H A;  2ALW A;  1JQK A;  1UPX A;  3OWG A;  4AZ6 A;  3LVT A;  4BNE A;  3EJR A;  2OBM A;  3O3O B;  4R5I A;  2YL6 A;  1I4D A;  3HAJ A;  1U00 A;  2NCZ A;  1WDZ A;  3CZN A;  4JWD A;  4HR1 B;  1X04 A;  1TQW A;  3DX2 A;  1SUF A;  2GF4 A;  1GN9 A;  3BUQ A;  3FD9 A;  2KHO A;  3O3M B;  4HY9 A;  4IWP A;  4I1Q A;  3T46 A;  4IM0 A;  3QA8 A;  4EZX A;  2YKT A;  3RV0 A;  1QWN A;  2LXY A;  3D51 A;  2RT6 A;  3DX0 A;  4AZC A; 
#chains in the Genus database with same CATH homology
 3HAH A;  3QWE A;  2Z0N A;  3Q0K A;  2X3X A;  3CAZ A;  2Z0V A;  3DYT A;  3LLL A;  5C5B A;  2FIC A;  3SOG A;  3ABH A;  2D1L A;  2RAJ A;  1I4D A;  4BNE A;  3HAJ A;  3I2W A;  4I1Q A;  2RAK A;  1I49 A;  4AKV A;  3PLT A;  1X03 A;  2X3W A;  4WPE A;  5C5B B;  2ELB A;  1WDZ A;  3M3W A;  2YKT A;  2V0O A;  2EFL A;  2Q13 A;  3G9G A;  4ATM A;  3QE6 A;  4DYL A;  4NQI A;  1Y2O A;  1I4L A;  4FZS A;  1X04 A;  2C08 A;  3ACO A;  3HAI A;  3SYV A;  2Z0O A;  4DCN C;  3Q84 A;  1I4T A;  4NSW A;  2RAI A;  4H8S A;  2EFK A;  3OK8 A;  1URU A;  2Q12 A;  3QNI A;  4AVM A;  2X3V A;  2D4C A;  4WPC A;  1ZWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...