2X3XA

Structure of mouse syndapin i (crystal form 1)
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
291
structure length
291
Chain Sequence
DSFWEVGNYKRTVKRIDDGHRLCNDLMSCVQERAKIEKAYAQQLTDWAKRWRQLIEKGPQYGSLERAWGAMMTEADKVSELHQEVKNSLLNEDLEKVKNWQKDAYHKQIMGGFKETKEAEDGFRKAQKPWAKKMKELEAAKKAYHLACKEERLAMTREMNSKTEQSVTPEQQKKLVDKVDKCRQDVQKTQEKYEKVLEDVGKTTPQYMEGMEQVFEQCQQFEEKRLVFLKEVLLDIKRHLNLAENSSYMHVYRELEQAIRGADAQEDLRWFRSTSGPGMPMNWPQFEEWNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis
molecule keywords PROTEIN KINASE C AND CASEIN KINASE SUBSTRATE IN NEURONS PROT
publication title Molecular Basis for SH3 Domain Regulation of F-Bar-Mediated Membrane Deformation.
pubmed doi rcsb
source organism Mus musculus
total genus 112
structure length 291
sequence length 291
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00611 FCH Fes/CIP4, and EFC/F-BAR homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 2x3xA01
2X3WA 4BNEA 2Q13A 2Z0OA 2YKTA 2X3XA 3Q0KA 2D4CA 2RAJA 2X3VA 3ACOA 4AKVA 1URUA 4I1QA 2RAIA 4NSWA 3G9GA 5C5BA 2EFKA 2FICA 3M3WA 4AVMA 2C08A 1ZWWA 2ELBA 3HAJA 3OK8A 3QWEA 4WPCA 3HAHA 3Q84A 3QNIA 4DCNC 4DYLA 2Z0NA 4H8SA 3DYTA 1Y2OA 2V0OA 2Q12A 3CAZA 3LLLA 1I49A 1I4LA 3ABHA 1X04A 1WDZA 4FZSA 3PLTA 4NQIA 1I4DA 2Z0VA 1X03A 5C5BB 3SYVA 3QE6A 3I2WA 2EFLA 3SOGA 2RAKA 1I4TA 3HAIA 4ATMA 4WPEA 2D1LA
chains in the Genus database with same CATH superfamily
3ERCC 3I04A 4H6IA 1HTYA 4NPHA 1E9VA 2YI8A 4KIKB 5E84A 4AZ6A 3DX1A 3ER8C 3QA8A 4JNFA 1ZWWA 3FD9A 4AZHA 4AZ7A 1HXKA 2YL9A 3L3PA 4EZWA 2EWFA 3VEBA 2LXYA 4EZVA 2Q13A 3D51A 3O3NB 2X3VA 2JNKA 4I1QA 2N3KA 1OA0A 1W9MA 3BVXA 3KAWA 3D4ZA 3OWGA 4IM2A 1E2UA 3BVVA 4E3CA 1TQSA 4AKVA 2ALWA 2PY6A 4R5GA 4HYBA 2EX3B 3D52A 3T46A 3DDFA 2QXLA 4H8SA 1Y2OA 3DX4A 2F1AA 3F7WA 3CZNA 3EJUA 3DPOA 2GF4A 3EJQA 4R5LA 4FZPA 1GNLA 4EZPA 3QNIA 3D2EA 3DYTA 3T4AG 2YL8A 2YLLA 3HAIA 4ATMA 3I01A 2Z8YA 2F1BA 4R5KA 4NSWA 4IM0A 4HR1A 3G9GA 4UDXX 3D4YA 3RV1A 4AZIA 3DX0A 2YL6A 1UPXA 4AZGA 3B53X 2QFFA 4HY9A 3VEAA 3ACOA 3EJSA 3QWEA 3T48A 4EZZA 4DCNC 4DYLA 4JL9A 2Z0NA 4IWQA 1I49A 1I4LA 2Z0VA 2GA9D 3BUPA 1MJGA 2RAKA 3D2FA 4F00A 4AZCA 4WPEA 3BLBA 5KBPA 4G6QA 1SU8A 1TQUA 1SUFA 2EFKA 3O3MB 2ELBA 2O0I1 3T47A 2OW7A 2JNSA 1JQKA 1X04A 5C5BB 1O7DB 3BVWA 1SU6A 2D1LA 4BNEA 2YLAA 1R33A 2D4CA 1SU7A 1DKYA 4EZTA 2ZXQA 2C08A 3RPMA 2X5CA 4WPCA 1DKXA 2OBMA 4EZSA 1OA1A 3ZEDA 1X03A 3CV5A 1I4TA 3A98A 2OZNB 4EZRA 3Q0KA 3LVTA 4E81A 3M3WA 2F7PA 2PMRA 3OK8A 1QX1A 3HAHA 4UDYX 1GNTA 3O3OB 2WYHA 1TQVA 4IWPA 4JN4A 3BUQA 2F7RA 3BVUA 2X3XA 2QKWA 3OHXM 2NCZA 4M0MA 4B9QA 2FICA 2OW6A 3CVRA 4AZ5A 2YIBA 2YIVX 2LM0A 3ABHA 5FLEX 1R34A 2EFLA 2F7QA 2F18A 2YI9A 1HWWA 2Z0OA 2OBLA 2RAJA 3C7NA 2WINM 3HAJA 1YWMA 4JWCA 3EJTA 4EZYA 3B52X 3GI7A 3BUDA 3BUBA 3I2WA 3SOGA 3CZSA 3BVTA 3BUIA 2YIAA 3DDGA 2RAIA 3ER9B 4IM3A 4H6HA 3VKHA 2MI7A 4IWOA 3KAVA 3QNJA 2YL5A 2ND0A 2V0OA 1DKZA 2OO2A 1OAOA 2F7OA 3SYVA 1QWNA 4FM3A 3DX2A 4EZXA 3Q84A 3T49A 1GN9A 4EZQA 2ND1A 4JWIA 3I39X 4KIKA 4HR1B 3B51X 4FZOA 2GAFD 3EJRA 2X3WA 4JWDA 4JNEA 3CKDA 2WYIA 2Q12A 4FZSA 1U00A 4JWEA 3EJPA 4D8JA 3LMFA 5TKYA 3UITA 2YKTA 3KDRA 4AZBA 1URUA 5C5BA 4EZOA 2FYVA 5FIGA 4AZCB 3DPPA 4R5IA 1QWUA 3CAZA 3LLLA 1TQWA 3PLTA 4NQIA 3DX3A 3QE6A 4EZNA 3RV0A 4EZUA 1LQ7A 3D50A 1R5EA 1TQTA 1O7DC 1ZYLA 4AVMA 1E1DA 2KHOA 4PO2A 3DPQA 3L3OM 4JLCA 2RT6A 4F01A 1WDZA 4IW0A 4R5JA 1I4DA 1PS3A
chains in the Genus database with same CATH topology
2X3WA 4BNEA 2Q13A 2Z0OA 2YKTA 2X3XA 3Q0KA 2D4CA 2RAJA 2X3VA 3ACOA 4AKVA 1URUA 4I1QA 2RAIA 4NSWA 3G9GA 5C5BA 2EFKA 2FICA 3M3WA 4AVMA 2C08A 1ZWWA 2ELBA 3HAJA 3OK8A 3QWEA 4WPCA 3HAHA 3Q84A 3QNIA 4DCNC 4DYLA 2Z0NA 4H8SA 3DYTA 1Y2OA 2V0OA 2Q12A 3CAZA 3LLLA 1I49A 1I4LA 3ABHA 1X04A 1WDZA 4FZSA 3PLTA 4NQIA 1I4DA 2Z0VA 1X03A 5C5BB 3SYVA 3QE6A 3I2WA 2EFLA 3SOGA 2RAKA 1I4TA 3HAIA 4ATMA 4WPEA 2D1LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X3W A;  4BNE A;  2Q13 A;  2Z0O A;  2YKT A;  2X3X A;  3Q0K A;  2D4C A;  2RAJ A;  2X3V A;  3ACO A;  4AKV A;  1URU A;  4I1Q A;  2RAI A;  4NSW A;  3G9G A;  5C5B A;  2EFK A;  2FIC A;  3M3W A;  4AVM A;  2C08 A;  1ZWW A;  2ELB A;  3HAJ A;  3OK8 A;  3QWE A;  4WPC A;  3HAH A;  3Q84 A;  3QNI A;  4DCN C;  4DYL A;  2Z0N A;  4H8S A;  3DYT A;  1Y2O A;  2V0O A;  2Q12 A;  3CAZ A;  3LLL A;  1I49 A;  1I4L A;  3ABH A;  1X04 A;  1WDZ A;  4FZS A;  3PLT A;  4NQI A;  1I4D A;  2Z0V A;  1X03 A;  5C5B B;  3SYV A;  3QE6 A;  3I2W A;  2EFL A;  3SOG A;  2RAK A;  1I4T A;  3HAI A;  4ATM A;  4WPE A;  2D1L A; 
#chains in the Genus database with same CATH topology
 3ERC C;  3I04 A;  4H6I A;  1HTY A;  4NPH A;  1E9V A;  2YI8 A;  4KIK B;  5E84 A;  4AZ6 A;  3DX1 A;  3ER8 C;  3QA8 A;  4JNF A;  1ZWW A;  3FD9 A;  4AZH A;  4AZ7 A;  1HXK A;  2YL9 A;  3L3P A;  4EZW A;  2EWF A;  3VEB A;  2LXY A;  4EZV A;  2Q13 A;  3D51 A;  3O3N B;  2X3V A;  2JNK A;  4I1Q A;  2N3K A;  1OA0 A;  1W9M A;  3BVX A;  3KAW A;  3D4Z A;  3OWG A;  4IM2 A;  1E2U A;  3BVV A;  4E3C A;  1TQS A;  4AKV A;  2ALW A;  2PY6 A;  4R5G A;  4HYB A;  2EX3 B;  3D52 A;  3T46 A;  3DDF A;  2QXL A;  4H8S A;  1Y2O A;  3DX4 A;  2F1A A;  3F7W A;  3CZN A;  3EJU A;  3DPO A;  2GF4 A;  3EJQ A;  4R5L A;  4FZP A;  1GNL A;  4EZP A;  3QNI A;  3D2E A;  3DYT A;  3T4A G;  2YL8 A;  2YLL A;  3HAI A;  4ATM A;  3I01 A;  2Z8Y A;  2F1B A;  4R5K A;  4NSW A;  4IM0 A;  4HR1 A;  3G9G A;  4UDX X;  3D4Y A;  3RV1 A;  4AZI A;  3DX0 A;  2YL6 A;  1UPX A;  4AZG A;  3B53 X;  2QFF A;  4HY9 A;  3VEA A;  3ACO A;  3EJS A;  3QWE A;  3T48 A;  4EZZ A;  4DCN C;  4DYL A;  4JL9 A;  2Z0N A;  4IWQ A;  1I49 A;  1I4L A;  2Z0V A;  2GA9 D;  3BUP A;  1MJG A;  2RAK A;  3D2F A;  4F00 A;  4AZC A;  4WPE A;  3BLB A;  5KBP A;  4G6Q A;  1SU8 A;  1TQU A;  1SUF A;  2EFK A;  3O3M B;  2ELB A;  2O0I 1;  3T47 A;  2OW7 A;  2JNS A;  1JQK A;  1X04 A;  5C5B B;  1O7D B;  3BVW A;  1SU6 A;  2D1L A;  4BNE A;  2YLA A;  1R33 A;  2D4C A;  1SU7 A;  1DKY A;  4EZT A;  2ZXQ A;  2C08 A;  3RPM A;  2X5C A;  4WPC A;  1DKX A;  2OBM A;  4EZS A;  1OA1 A;  3ZED A;  1X03 A;  3CV5 A;  1I4T A;  3A98 A;  2OZN B;  4EZR A;  3Q0K A;  3LVT A;  4E81 A;  3M3W A;  2F7P A;  2PMR A;  3OK8 A;  1QX1 A;  3HAH A;  4UDY X;  1GNT A;  3O3O B;  2WYH A;  1TQV A;  4IWP A;  4JN4 A;  3BUQ A;  2F7R A;  3BVU A;  2X3X A;  2QKW A;  3OHX M;  2NCZ A;  4M0M A;  4B9Q A;  2FIC A;  2OW6 A;  3CVR A;  4AZ5 A;  2YIB A;  2YIV X;  2LM0 A;  3ABH A;  5FLE X;  1R34 A;  2EFL A;  2F7Q A;  2F18 A;  2YI9 A;  1HWW A;  2Z0O A;  2OBL A;  2RAJ A;  3C7N A;  2WIN M;  3HAJ A;  1YWM A;  4JWC A;  3EJT A;  4EZY A;  3B52 X;  3GI7 A;  3BUD A;  3BUB A;  3I2W A;  3SOG A;  3CZS A;  3BVT A;  3BUI A;  2YIA A;  3DDG A;  2RAI A;  3ER9 B;  4IM3 A;  4H6H A;  3VKH A;  2MI7 A;  4IWO A;  3KAV A;  3QNJ A;  2YL5 A;  2ND0 A;  2V0O A;  1DKZ A;  2OO2 A;  1OAO A;  2F7O A;  3SYV A;  1QWN A;  4FM3 A;  3DX2 A;  4EZX A;  3Q84 A;  3T49 A;  1GN9 A;  4EZQ A;  2ND1 A;  4JWI A;  3I39 X;  4KIK A;  4HR1 B;  3B51 X;  4FZO A;  2GAF D;  3EJR A;  2X3W A;  4JWD A;  4JNE A;  3CKD A;  2WYI A;  2Q12 A;  4FZS A;  1U00 A;  4JWE A;  3EJP A;  4D8J A;  3LMF A;  5TKY A;  3UIT A;  2YKT A;  3KDR A;  4AZB A;  1URU A;  5C5B A;  4EZO A;  2FYV A;  5FIG A;  4AZC B;  3DPP A;  4R5I A;  1QWU A;  3CAZ A;  3LLL A;  1TQW A;  3PLT A;  4NQI A;  3DX3 A;  3QE6 A;  4EZN A;  3RV0 A;  4EZU A;  1LQ7 A;  3D50 A;  1R5E A;  1TQT A;  1O7D C;  1ZYL A;  4AVM A;  1E1D A;  2KHO A;  4PO2 A;  3DPQ A;  3L3O M;  4JLC A;  2RT6 A;  4F01 A;  1WDZ A;  4IW0 A;  4R5J A;  1I4D A;  1PS3 A; 
#chains in the Genus database with same CATH homology
 2X3W A;  4BNE A;  2Q13 A;  2Z0O A;  2YKT A;  2X3X A;  3Q0K A;  2D4C A;  2RAJ A;  2X3V A;  3ACO A;  4AKV A;  1URU A;  4I1Q A;  2RAI A;  4NSW A;  3G9G A;  5C5B A;  2EFK A;  2FIC A;  3M3W A;  4AVM A;  2C08 A;  1ZWW A;  2ELB A;  3HAJ A;  3OK8 A;  3QWE A;  4WPC A;  3HAH A;  3Q84 A;  3QNI A;  4DCN C;  4DYL A;  2Z0N A;  4H8S A;  3DYT A;  1Y2O A;  2V0O A;  2Q12 A;  3CAZ A;  3LLL A;  1I49 A;  1I4L A;  3ABH A;  1X04 A;  1WDZ A;  4FZS A;  3PLT A;  4NQI A;  1I4D A;  2Z0V A;  1X03 A;  5C5B B;  3SYV A;  3QE6 A;  3I2W A;  2EFL A;  3SOG A;  2RAK A;  1I4T A;  3HAI A;  4ATM A;  4WPE A;  2D1L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...