2X3XA

Structure of mouse syndapin i (crystal form 1)
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
291
structure length
291
Chain Sequence
DSFWEVGNYKRTVKRIDDGHRLCNDLMSCVQERAKIEKAYAQQLTDWAKRWRQLIEKGPQYGSLERAWGAMMTEADKVSELHQEVKNSLLNEDLEKVKNWQKDAYHKQIMGGFKETKEAEDGFRKAQKPWAKKMKELEAAKKAYHLACKEERLAMTREMNSKTEQSVTPEQQKKLVDKVDKCRQDVQKTQEKYEKVLEDVGKTTPQYMEGMEQVFEQCQQFEEKRLVFLKEVLLDIKRHLNLAENSSYMHVYRELEQAIRGADAQEDLRWFRSTSGPGMPMNWPQFEEWNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN KINASE C AND CASEIN KINASE SUBSTRATE IN NEURONS PROT
publication title Molecular Basis for SH3 Domain Regulation of F-Bar-Mediated Membrane Deformation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Endocytosis
total genus 112
structure length 291
sequence length 291
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00611 FCH Fes/CIP4, and EFC/F-BAR homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 2x3xA01
2X3WA 3ABHA 1X03A 3CAZA 2D4CA 3QE6A 2Z0OA 1I4TA 4AKVA 1URUA 2X3XA 3HAHA 3G9GA 3SYVA 3HAIA 5C5BA 3QNIA 1I49A 2YKTA 2RAIA 4I1QA 2EFKA 2Z0NA 3Q84A 2FICA 2C08A 2Q12A 4DCNC 2V0OA 3ACOA 4H8SA 1I4LA 3M3WA 4FZSA 3SOGA 4BNEA 2ELBA 2EFLA 1ZWWA 4ATMA 1Y2OA 3HAJA 4NQIA 4AVMA 2Z0VA 4WPCA 4DYLA 4WPEA 1WDZA 3PLTA 3Q0KA 2RAJA 2D1LA 3DYTA 3OK8A 2X3VA 2Q13A 1X04A 2RAKA 3I2WA 4NSWA 3QWEA 5C5BB 3LLLA 1I4DA
chains in the Genus database with same CATH superfamily
1OAOA 3QE6A 3KAWA 3G9GA 5C5BA 2WYIA 4H6IA 4JWDA 1SUFA 3D50A 4DCNC 1R5EA 1DKYA 3D2EA 1ZWWA 1R33A 2F7PA 3EJPA 4AZBA 2F1BA 2PY6A 4AZCA 1X04A 1E2UA 3D2FA 3QNJA 3CZNA 2FYVA 4G6QA 4AZIA 3SOGA 2ELBA 1Y2OA 3HAJA 2ND0A 3T4AG 5TKYA 4EZTA 1SU7A 3SYVA 2D4CA 4EZXA 4JN4A 3O3OB 1I49A 2OW6A 2JNSA 3VKHA 5FLEX 4FZPA 3I39X 4NQIA 3EJTA 4EZVA 1WDZA 4EZYA 1R34A 3B51X 4JL9A 1DKXA 2YIBA 2ZXQA 4IM2A 3CV5A 2OO2A 2O0I1 2V0OA 2PMRA 2OW7A 2LM0A 3EJSA 2YLAA 4KIKB 1GNTA 2X5CA 3EJQA 4JLCA 2YKTA 4I1QA 4EZWA 3B53X 3BVWA 3O3MB 3DPOA 1GNLA 2RAJA 3OK8A 1DKZA 3ZEDA 4BNEA 3GI7A 1URUA 4EZOA 3QNIA 3LMFA 2OZNB 3RV1A 4AZ6A 3D51A 2EFLA 4JWIA 3KAVA 4PO2A 3Q0KA 3DPQA 2QFFA 3RPMA 4NSWA 5C5BB 2ND1A 3DX4A 3CKDA 1TQWA 3EJRA 3OHXM 2KHOA 3BVUA 5KBPA 2OBMA 3ACOA 2WINM 4JWCA 3T48A 1U00A 3D52A 1SU8A 2RAKA 2MI7A 4M0MA 2QKWA 4JNFA 3L3PA 1HWWA 2RAIA 3CZSA 3A98A 2EFKA 2YIVX 2F7QA 2FICA 1PS3A 1YWMA 3BVVA 3DDGA 4EZSA 1QWUA 1OA1A 4WPEA 4DYLA 3DX3A 4D8JA 3F7WA 1ZYLA 3KDRA 3DPPA 1QX1A 1I4TA 1TQTA 1TQUA 2LXYA 2YI8A 5FIGA 4EZNA 3D4YA 4HY9A 2C08A 2YIAA 4AZHA 4AZ5A 3ERCC 3CVRA 3M3WA 3BUQA 4IWQA 2QXLA 1HTYA 2Q13A 3DDFA 1GN9A 1X03A 3C7NA 2OBLA 4UDYX 3T47A 3BUDA 2EX3B 2YL8A 1O7DB 1QWNA 4H8SA 4IWPA 4AZ7A 2N3KA 3PLTA 3RV0A 1SU6A 3VEBA 3L3OM 4R5KA 4F01A 4IM3A 4UDXX 2X3VA 1E1DA 3I01A 3VEAA 4E3CA 4HYBA 4HR1A 3DX1A 2Z0NA 3Q84A 4JNEA 4JWEA 4EZPA 3ER8C 1I4LA 4R5JA 1UPXA 1MJGA 2X3WA 3CAZA 1JQKA 3B52X 3ER9B 1TQVA 2GAFD 4E81A 2X3XA 2YL9A 3BUIA 2GA9D 3BUBA 4H6HA 2WYHA 2YL5A 3O3NB 4AZCB 2Z0VA 4WPCA 4AZGA 1TQSA 2NCZA 3EJUA 3QA8A 3ABHA 2Z0OA 4AKVA 3HAIA 1W9MA 2RT6A 2YLLA 2JNKA 4FZSA 3DX2A 4ATMA 1LQ7A 3D4ZA 5E84A 2GF4A 3T46A 2D1LA 3I2WA 3QWEA 4B9QA 4EZQA 3HAHA 2F7OA 4FM3A 1HXKA 4IWOA 4NPHA 4EZRA 3LVTA 4AVMA 4F00A 3DX0A 3DYTA 4EZUA 3OWGA 3BLBA 3T49A 2YI9A 3I04A 4IW0A 3BVTA 1OA0A 4R5LA 4EZZA 3FD9A 3UITA 4KIKA 2F18A 2F7RA 1E9VA 2ALWA 3BVXA 4FZOA 2F1AA 2Z8YA 2Q12A 4R5GA 4R5IA 2YL6A 3BUPA 2EWFA 4HR1B 4IM0A 1O7DC 3LLLA 1I4DA
chains in the Genus database with same CATH topology
2X3WA 3ABHA 1X03A 3CAZA 2D4CA 3QE6A 2Z0OA 1I4TA 4AKVA 1URUA 2X3XA 3HAHA 3G9GA 3SYVA 3HAIA 5C5BA 3QNIA 1I49A 2YKTA 2RAIA 4I1QA 2EFKA 2Z0NA 3Q84A 2FICA 2C08A 2Q12A 4DCNC 2V0OA 3ACOA 4H8SA 1I4LA 3M3WA 4FZSA 3SOGA 4BNEA 2ELBA 2EFLA 1ZWWA 4ATMA 1Y2OA 3HAJA 4NQIA 4AVMA 2Z0VA 4WPCA 4DYLA 4WPEA 1WDZA 3PLTA 3Q0KA 2RAJA 2D1LA 3DYTA 3OK8A 2X3VA 2Q13A 1X04A 2RAKA 3I2WA 4NSWA 3QWEA 5C5BB 3LLLA 1I4DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X3W A;  3ABH A;  1X03 A;  3CAZ A;  2D4C A;  3QE6 A;  2Z0O A;  1I4T A;  4AKV A;  1URU A;  2X3X A;  3HAH A;  3G9G A;  3SYV A;  3HAI A;  5C5B A;  3QNI A;  1I49 A;  2YKT A;  2RAI A;  4I1Q A;  2EFK A;  2Z0N A;  3Q84 A;  2FIC A;  2C08 A;  2Q12 A;  4DCN C;  2V0O A;  3ACO A;  4H8S A;  1I4L A;  3M3W A;  4FZS A;  3SOG A;  4BNE A;  2ELB A;  2EFL A;  1ZWW A;  4ATM A;  1Y2O A;  3HAJ A;  4NQI A;  4AVM A;  2Z0V A;  4WPC A;  4DYL A;  4WPE A;  1WDZ A;  3PLT A;  3Q0K A;  2RAJ A;  2D1L A;  3DYT A;  3OK8 A;  2X3V A;  2Q13 A;  1X04 A;  2RAK A;  3I2W A;  4NSW A;  3QWE A;  5C5B B;  3LLL A;  1I4D A; 
#chains in the Genus database with same CATH topology
 1OAO A;  3QE6 A;  3KAW A;  3G9G A;  5C5B A;  2WYI A;  4H6I A;  4JWD A;  1SUF A;  3D50 A;  4DCN C;  1R5E A;  1DKY A;  3D2E A;  1ZWW A;  1R33 A;  2F7P A;  3EJP A;  4AZB A;  2F1B A;  2PY6 A;  4AZC A;  1X04 A;  1E2U A;  3D2F A;  3QNJ A;  3CZN A;  2FYV A;  4G6Q A;  4AZI A;  3SOG A;  2ELB A;  1Y2O A;  3HAJ A;  2ND0 A;  3T4A G;  5TKY A;  4EZT A;  1SU7 A;  3SYV A;  2D4C A;  4EZX A;  4JN4 A;  3O3O B;  1I49 A;  2OW6 A;  2JNS A;  3VKH A;  5FLE X;  4FZP A;  3I39 X;  4NQI A;  3EJT A;  4EZV A;  1WDZ A;  4EZY A;  1R34 A;  3B51 X;  4JL9 A;  1DKX A;  2YIB A;  2ZXQ A;  4IM2 A;  3CV5 A;  2OO2 A;  2O0I 1;  2V0O A;  2PMR A;  2OW7 A;  2LM0 A;  3EJS A;  2YLA A;  4KIK B;  1GNT A;  2X5C A;  3EJQ A;  4JLC A;  2YKT A;  4I1Q A;  4EZW A;  3B53 X;  3BVW A;  3O3M B;  3DPO A;  1GNL A;  2RAJ A;  3OK8 A;  1DKZ A;  3ZED A;  4BNE A;  3GI7 A;  1URU A;  4EZO A;  3QNI A;  3LMF A;  2OZN B;  3RV1 A;  4AZ6 A;  3D51 A;  2EFL A;  4JWI A;  3KAV A;  4PO2 A;  3Q0K A;  3DPQ A;  2QFF A;  3RPM A;  4NSW A;  5C5B B;  2ND1 A;  3DX4 A;  3CKD A;  1TQW A;  3EJR A;  3OHX M;  2KHO A;  3BVU A;  5KBP A;  2OBM A;  3ACO A;  2WIN M;  4JWC A;  3T48 A;  1U00 A;  3D52 A;  1SU8 A;  2RAK A;  2MI7 A;  4M0M A;  2QKW A;  4JNF A;  3L3P A;  1HWW A;  2RAI A;  3CZS A;  3A98 A;  2EFK A;  2YIV X;  2F7Q A;  2FIC A;  1PS3 A;  1YWM A;  3BVV A;  3DDG A;  4EZS A;  1QWU A;  1OA1 A;  4WPE A;  4DYL A;  3DX3 A;  4D8J A;  3F7W A;  1ZYL A;  3KDR A;  3DPP A;  1QX1 A;  1I4T A;  1TQT A;  1TQU A;  2LXY A;  2YI8 A;  5FIG A;  4EZN A;  3D4Y A;  4HY9 A;  2C08 A;  2YIA A;  4AZH A;  4AZ5 A;  3ERC C;  3CVR A;  3M3W A;  3BUQ A;  4IWQ A;  2QXL A;  1HTY A;  2Q13 A;  3DDF A;  1GN9 A;  1X03 A;  3C7N A;  2OBL A;  4UDY X;  3T47 A;  3BUD A;  2EX3 B;  2YL8 A;  1O7D B;  1QWN A;  4H8S A;  4IWP A;  4AZ7 A;  2N3K A;  3PLT A;  3RV0 A;  1SU6 A;  3VEB A;  3L3O M;  4R5K A;  4F01 A;  4IM3 A;  4UDX X;  2X3V A;  1E1D A;  3I01 A;  3VEA A;  4E3C A;  4HYB A;  4HR1 A;  3DX1 A;  2Z0N A;  3Q84 A;  4JNE A;  4JWE A;  4EZP A;  3ER8 C;  1I4L A;  4R5J A;  1UPX A;  1MJG A;  2X3W A;  3CAZ A;  1JQK A;  3B52 X;  3ER9 B;  1TQV A;  2GAF D;  4E81 A;  2X3X A;  2YL9 A;  3BUI A;  2GA9 D;  3BUB A;  4H6H A;  2WYH A;  2YL5 A;  3O3N B;  4AZC B;  2Z0V A;  4WPC A;  4AZG A;  1TQS A;  2NCZ A;  3EJU A;  3QA8 A;  3ABH A;  2Z0O A;  4AKV A;  3HAI A;  1W9M A;  2RT6 A;  2YLL A;  2JNK A;  4FZS A;  3DX2 A;  4ATM A;  1LQ7 A;  3D4Z A;  5E84 A;  2GF4 A;  3T46 A;  2D1L A;  3I2W A;  3QWE A;  4B9Q A;  4EZQ A;  3HAH A;  2F7O A;  4FM3 A;  1HXK A;  4IWO A;  4NPH A;  4EZR A;  3LVT A;  4AVM A;  4F00 A;  3DX0 A;  3DYT A;  4EZU A;  3OWG A;  3BLB A;  3T49 A;  2YI9 A;  3I04 A;  4IW0 A;  3BVT A;  1OA0 A;  4R5L A;  4EZZ A;  3FD9 A;  3UIT A;  4KIK A;  2F18 A;  2F7R A;  1E9V A;  2ALW A;  3BVX A;  4FZO A;  2F1A A;  2Z8Y A;  2Q12 A;  4R5G A;  4R5I A;  2YL6 A;  3BUP A;  2EWF A;  4HR1 B;  4IM0 A;  1O7D C;  3LLL A;  1I4D A; 
#chains in the Genus database with same CATH homology
 2X3W A;  3ABH A;  1X03 A;  3CAZ A;  2D4C A;  3QE6 A;  2Z0O A;  1I4T A;  4AKV A;  1URU A;  2X3X A;  3HAH A;  3G9G A;  3SYV A;  3HAI A;  5C5B A;  3QNI A;  1I49 A;  2YKT A;  2RAI A;  4I1Q A;  2EFK A;  2Z0N A;  3Q84 A;  2FIC A;  2C08 A;  2Q12 A;  4DCN C;  2V0O A;  3ACO A;  4H8S A;  1I4L A;  3M3W A;  4FZS A;  3SOG A;  4BNE A;  2ELB A;  2EFL A;  1ZWW A;  4ATM A;  1Y2O A;  3HAJ A;  4NQI A;  4AVM A;  2Z0V A;  4WPC A;  4DYL A;  4WPE A;  1WDZ A;  3PLT A;  3Q0K A;  2RAJ A;  2D1L A;  3DYT A;  3OK8 A;  2X3V A;  2Q13 A;  1X04 A;  2RAK A;  3I2W A;  4NSW A;  3QWE A;  5C5B B;  3LLL A;  1I4D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...