2X3XA

Structure of mouse syndapin i (crystal form 1)
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
291
structure length
291
Chain Sequence
DSFWEVGNYKRTVKRIDDGHRLCNDLMSCVQERAKIEKAYAQQLTDWAKRWRQLIEKGPQYGSLERAWGAMMTEADKVSELHQEVKNSLLNEDLEKVKNWQKDAYHKQIMGGFKETKEAEDGFRKAQKPWAKKMKELEAAKKAYHLACKEERLAMTREMNSKTEQSVTPEQQKKLVDKVDKCRQDVQKTQEKYEKVLEDVGKTTPQYMEGMEQVFEQCQQFEEKRLVFLKEVLLDIKRHLNLAENSSYMHVYRELEQAIRGADAQEDLRWFRSTSGPGMPMNWPQFEEWNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Basis for SH3 Domain Regulation of F-Bar-Mediated Membrane Deformation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Endocytosis
molecule keywords PROTEIN KINASE C AND CASEIN KINASE SUBSTRATE IN NEURONS PROT
total genus 112
structure length 291
sequence length 291
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00611 FCH Fes/CIP4, and EFC/F-BAR homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 2x3xA01
2D4CA 3HAHA 2X3WA 3SOGA 1X04A 4NQIA 2YKTA 2Z0VA 2EFLA 2RAIA 4DYLA 3Q0KA 1ZWWA 4WPEA 2Q13A 4AVMA 2Z0OA 3LLLA 4I1QA 1I4DA 1WDZA 3ACOA 3QE6A 2Q12A 2Z0NA 4FZSA 2D1LA 3G9GA 2ELBA 1I49A 4WPCA 3Q84A 3QNIA 4H8SA 1URUA 3DYTA 3PLTA 5C5BB 4DCNC 1X03A 3HAJA 1I4TA 2RAJA 3OK8A 3QWEA 3CAZA 4BNEA 3ABHA 3HAIA 2X3XA 4NSWA 5C5BA 4AKVA 4ATMA 1Y2OA 3M3WA 2C08A 2EFKA 3I2WA 2FICA 2RAKA 2X3VA 2V0OA 1I4LA 3SYVA
chains in the Genus database with same CATH superfamily
2X3WA 2WYIA 2F1BA 4EZNA 4F01A 2Z0VA 2EFLA 2F1AA 1R5EA 3VKHA 3DDGA 4R5KA 3T49A 3LLLA 4R5IA 4R5LA 4JWDA 3DPOA 1WDZA 1U00A 2Q12A 2Z0NA 3DPQA 2JNKA 2YIBA 4JWIA 1OAOA 2MI7A 4JN4A 2ND0A 3ER8C 2YL5A 3D50A 3DDFA 3D2FA 3T46A 4FM3A 2GA9D 3DYTA 3DX4A 3FD9A 4JNFA 5C5BB 3RPMA 4B9QA 4DCNC 1SUFA 3ZEDA 3HAJA 1SU7A 1TQVA 2JNSA 3I01A 3OK8A 1TQUA 4F00A 3HAIA 2X3XA 2OBMA 1Y2OA 3M3WA 4AZ5A 2YLLA 2FYVA 4H6IA 3DX2A 3KAWA 1DKYA 3VEAA 4EZZA 4EZXA 3EJUA 1HXKA 3QA8A 4M0MA 4AKVA 2F7OA 2YI8A 2ZXQA 3BVWA 1OA0A 3SOGA 4AZCB 1X04A 2KHOA 4IM3A 3CVRA 2YKTA 4IWPA 3LMFA 4JNEA 4JLCA 1TQSA 2GF4A 1E1DA 3Q0KA 3D4YA 3A98A 4KIKA 2Z0OA 3O3MB 3B53X 3EJPA 4KIKB 2N3KA 1SU8A 3ER9B 4AZIA 3F7WA 1OA1A 1QWUA 2X5CA 3C7NA 3CZSA 3DPPA 2D1LA 3G9GA 3O3NB 3OHXM 3BUBA 4IWOA 4NPHA 2ELBA 1I49A 2F18A 3UITA 1O7DB 3QNIA 1E2UA 3EJQA 4EZSA 2PY6A 3DX1A 4H8SA 2LXYA 3DX0A 4EZWA 3KAVA 4EZQA 2LM0A 1MJGA 1R34A 2RAJA 5KBPA 3ABHA 4H6HA 4R5GA 3RV1A 1PS3A 2WYHA 3T47A 4JL9A 3EJTA 2C08A 3L3OM 1E9VA 2YIVX 2RAKA 1GNTA 1SU6A 1TQWA 2ALWA 1W9MA 3BUPA 2V0OA 1I4LA 4JWEA 1ZYLA 2YL6A 4PO2A 2YL9A 2D4CA 3HAHA 3B51X 3OWGA 4NQIA 4D8JA 4DYLA 4IM0A 5FLEX 3BVXA 1ZWWA 4WPEA 2Q13A 4AVMA 4I1QA 4EZOA 5TKYA 3CV5A 2NCZA 2YLAA 1QX1A 1HTYA 3D51A 4IW0A 3BVVA 4EZYA 3BUQA 3ACOA 3BVUA 1GNLA 4AZCA 2OW7A 1O7DC 1JQKA 2EX3B 4WPCA 3CZNA 3EJRA 4AZHA 4EZVA 3O3OB 3D4ZA 1QWNA 3T4AG 1URUA 3PLTA 4R5JA 4HR1B 2YL8A 4EZPA 1GN9A 1I4TA 2WINM 3QWEA 4HYBA 5E84A 3QNJA 4BNEA 2QKWA 2EWFA 5C5BA 4FZOA 4ATMA 4JWCA 2RT6A 4AZ6A 1TQTA 2Z8YA 2QFFA 3B52X 3I2WA 4EZUA 4E3CA 3BUIA 2YIAA 3SYVA 1DKXA 1LQ7A 3BLBA 3I04A 3RV0A 4AZ7A 1DKZA 3I39X 2F7PA 2RAIA 3BUDA 4UDXX 4EZRA 3LVTA 1I4DA 3L3PA 4IM2A 2F7QA 4IWQA 3QE6A 4AZBA 3VEBA 3ERCC 3KDRA 4FZSA 3GI7A 2OW6A 4G6QA 2YI9A 2PMRA 3D52A 2OZNB 4UDYX 3Q84A 2ND1A 3T48A 1HWWA 4HY9A 4EZTA 2OBLA 4FZPA 1YWMA 1X03A 1R33A 2GAFD 2F7RA 3CAZA 4E81A 4NSWA 2QXLA 3EJSA 3BVTA 3DX3A 4HR1A 5FIGA 2EFKA 2FICA 1UPXA 2O0I1 4AZGA 2X3VA 3CKDA 3D2EA 2OO2A
chains in the Genus database with same CATH topology
2D4CA 3HAHA 2X3WA 3SOGA 1X04A 4NQIA 2YKTA 2Z0VA 2EFLA 2RAIA 4DYLA 3Q0KA 1ZWWA 4WPEA 2Q13A 4AVMA 2Z0OA 3LLLA 4I1QA 1I4DA 1WDZA 3ACOA 3QE6A 2Q12A 2Z0NA 4FZSA 2D1LA 3G9GA 2ELBA 1I49A 4WPCA 3Q84A 3QNIA 4H8SA 1URUA 3DYTA 3PLTA 5C5BB 4DCNC 1X03A 3HAJA 1I4TA 2RAJA 3OK8A 3QWEA 3CAZA 4BNEA 3ABHA 3HAIA 2X3XA 4NSWA 5C5BA 4AKVA 4ATMA 1Y2OA 3M3WA 2C08A 2EFKA 3I2WA 2FICA 2RAKA 2X3VA 2V0OA 1I4LA 3SYVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D4C A;  3HAH A;  2X3W A;  3SOG A;  1X04 A;  4NQI A;  2YKT A;  2Z0V A;  2EFL A;  2RAI A;  4DYL A;  3Q0K A;  1ZWW A;  4WPE A;  2Q13 A;  4AVM A;  2Z0O A;  3LLL A;  4I1Q A;  1I4D A;  1WDZ A;  3ACO A;  3QE6 A;  2Q12 A;  2Z0N A;  4FZS A;  2D1L A;  3G9G A;  2ELB A;  1I49 A;  4WPC A;  3Q84 A;  3QNI A;  4H8S A;  1URU A;  3DYT A;  3PLT A;  5C5B B;  4DCN C;  1X03 A;  3HAJ A;  1I4T A;  2RAJ A;  3OK8 A;  3QWE A;  3CAZ A;  4BNE A;  3ABH A;  3HAI A;  2X3X A;  4NSW A;  5C5B A;  4AKV A;  4ATM A;  1Y2O A;  3M3W A;  2C08 A;  2EFK A;  3I2W A;  2FIC A;  2RAK A;  2X3V A;  2V0O A;  1I4L A;  3SYV A; 
#chains in the Genus database with same CATH topology
 2X3W A;  2WYI A;  2F1B A;  4EZN A;  4F01 A;  2Z0V A;  2EFL A;  2F1A A;  1R5E A;  3VKH A;  3DDG A;  4R5K A;  3T49 A;  3LLL A;  4R5I A;  4R5L A;  4JWD A;  3DPO A;  1WDZ A;  1U00 A;  2Q12 A;  2Z0N A;  3DPQ A;  2JNK A;  2YIB A;  4JWI A;  1OAO A;  2MI7 A;  4JN4 A;  2ND0 A;  3ER8 C;  2YL5 A;  3D50 A;  3DDF A;  3D2F A;  3T46 A;  4FM3 A;  2GA9 D;  3DYT A;  3DX4 A;  3FD9 A;  4JNF A;  5C5B B;  3RPM A;  4B9Q A;  4DCN C;  1SUF A;  3ZED A;  3HAJ A;  1SU7 A;  1TQV A;  2JNS A;  3I01 A;  3OK8 A;  1TQU A;  4F00 A;  3HAI A;  2X3X A;  2OBM A;  1Y2O A;  3M3W A;  4AZ5 A;  2YLL A;  2FYV A;  4H6I A;  3DX2 A;  3KAW A;  1DKY A;  3VEA A;  4EZZ A;  4EZX A;  3EJU A;  1HXK A;  3QA8 A;  4M0M A;  4AKV A;  2F7O A;  2YI8 A;  2ZXQ A;  3BVW A;  1OA0 A;  3SOG A;  4AZC B;  1X04 A;  2KHO A;  4IM3 A;  3CVR A;  2YKT A;  4IWP A;  3LMF A;  4JNE A;  4JLC A;  1TQS A;  2GF4 A;  1E1D A;  3Q0K A;  3D4Y A;  3A98 A;  4KIK A;  2Z0O A;  3O3M B;  3B53 X;  3EJP A;  4KIK B;  2N3K A;  1SU8 A;  3ER9 B;  4AZI A;  3F7W A;  1OA1 A;  1QWU A;  2X5C A;  3C7N A;  3CZS A;  3DPP A;  2D1L A;  3G9G A;  3O3N B;  3OHX M;  3BUB A;  4IWO A;  4NPH A;  2ELB A;  1I49 A;  2F18 A;  3UIT A;  1O7D B;  3QNI A;  1E2U A;  3EJQ A;  4EZS A;  2PY6 A;  3DX1 A;  4H8S A;  2LXY A;  3DX0 A;  4EZW A;  3KAV A;  4EZQ A;  2LM0 A;  1MJG A;  1R34 A;  2RAJ A;  5KBP A;  3ABH A;  4H6H A;  4R5G A;  3RV1 A;  1PS3 A;  2WYH A;  3T47 A;  4JL9 A;  3EJT A;  2C08 A;  3L3O M;  1E9V A;  2YIV X;  2RAK A;  1GNT A;  1SU6 A;  1TQW A;  2ALW A;  1W9M A;  3BUP A;  2V0O A;  1I4L A;  4JWE A;  1ZYL A;  2YL6 A;  4PO2 A;  2YL9 A;  2D4C A;  3HAH A;  3B51 X;  3OWG A;  4NQI A;  4D8J A;  4DYL A;  4IM0 A;  5FLE X;  3BVX A;  1ZWW A;  4WPE A;  2Q13 A;  4AVM A;  4I1Q A;  4EZO A;  5TKY A;  3CV5 A;  2NCZ A;  2YLA A;  1QX1 A;  1HTY A;  3D51 A;  4IW0 A;  3BVV A;  4EZY A;  3BUQ A;  3ACO A;  3BVU A;  1GNL A;  4AZC A;  2OW7 A;  1O7D C;  1JQK A;  2EX3 B;  4WPC A;  3CZN A;  3EJR A;  4AZH A;  4EZV A;  3O3O B;  3D4Z A;  1QWN A;  3T4A G;  1URU A;  3PLT A;  4R5J A;  4HR1 B;  2YL8 A;  4EZP A;  1GN9 A;  1I4T A;  2WIN M;  3QWE A;  4HYB A;  5E84 A;  3QNJ A;  4BNE A;  2QKW A;  2EWF A;  5C5B A;  4FZO A;  4ATM A;  4JWC A;  2RT6 A;  4AZ6 A;  1TQT A;  2Z8Y A;  2QFF A;  3B52 X;  3I2W A;  4EZU A;  4E3C A;  3BUI A;  2YIA A;  3SYV A;  1DKX A;  1LQ7 A;  3BLB A;  3I04 A;  3RV0 A;  4AZ7 A;  1DKZ A;  3I39 X;  2F7P A;  2RAI A;  3BUD A;  4UDX X;  4EZR A;  3LVT A;  1I4D A;  3L3P A;  4IM2 A;  2F7Q A;  4IWQ A;  3QE6 A;  4AZB A;  3VEB A;  3ERC C;  3KDR A;  4FZS A;  3GI7 A;  2OW6 A;  4G6Q A;  2YI9 A;  2PMR A;  3D52 A;  2OZN B;  4UDY X;  3Q84 A;  2ND1 A;  3T48 A;  1HWW A;  4HY9 A;  4EZT A;  2OBL A;  4FZP A;  1YWM A;  1X03 A;  1R33 A;  2GAF D;  2F7R A;  3CAZ A;  4E81 A;  4NSW A;  2QXL A;  3EJS A;  3BVT A;  3DX3 A;  4HR1 A;  5FIG A;  2EFK A;  2FIC A;  1UPX A;  2O0I 1;  4AZG A;  2X3V A;  3CKD A;  3D2E A;  2OO2 A; 
#chains in the Genus database with same CATH homology
 2D4C A;  3HAH A;  2X3W A;  3SOG A;  1X04 A;  4NQI A;  2YKT A;  2Z0V A;  2EFL A;  2RAI A;  4DYL A;  3Q0K A;  1ZWW A;  4WPE A;  2Q13 A;  4AVM A;  2Z0O A;  3LLL A;  4I1Q A;  1I4D A;  1WDZ A;  3ACO A;  3QE6 A;  2Q12 A;  2Z0N A;  4FZS A;  2D1L A;  3G9G A;  2ELB A;  1I49 A;  4WPC A;  3Q84 A;  3QNI A;  4H8S A;  1URU A;  3DYT A;  3PLT A;  5C5B B;  4DCN C;  1X03 A;  3HAJ A;  1I4T A;  2RAJ A;  3OK8 A;  3QWE A;  3CAZ A;  4BNE A;  3ABH A;  3HAI A;  2X3X A;  4NSW A;  5C5B A;  4AKV A;  4ATM A;  1Y2O A;  3M3W A;  2C08 A;  2EFK A;  3I2W A;  2FIC A;  2RAK A;  2X3V A;  2V0O A;  1I4L A;  3SYV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...