2X3XA

Structure of mouse syndapin i (crystal form 1)
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
291
structure length
291
Chain Sequence
DSFWEVGNYKRTVKRIDDGHRLCNDLMSCVQERAKIEKAYAQQLTDWAKRWRQLIEKGPQYGSLERAWGAMMTEADKVSELHQEVKNSLLNEDLEKVKNWQKDAYHKQIMGGFKETKEAEDGFRKAQKPWAKKMKELEAAKKAYHLACKEERLAMTREMNSKTEQSVTPEQQKKLVDKVDKCRQDVQKTQEKYEKVLEDVGKTTPQYMEGMEQVFEQCQQFEEKRLVFLKEVLLDIKRHLNLAENSSYMHVYRELEQAIRGADAQEDLRWFRSTSGPGMPMNWPQFEEWNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN KINASE C AND CASEIN KINASE SUBSTRATE IN NEURONS PROT
publication title Molecular Basis for SH3 Domain Regulation of F-Bar-Mediated Membrane Deformation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Endocytosis
total genus 112
structure length 291
sequence length 291
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00611 FCH Fes/CIP4, and EFC/F-BAR homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 2x3xA01
1ZWWA 2RAKA 1I4LA 1I4TA 2D4CA 3DYTA 2Q12A 2Z0NA 4DYLA 1I49A 4DCNC 4WPEA 2X3WA 4ATMA 1Y2OA 2YKTA 3SOGA 5C5BA 1X03A 2FICA 3HAHA 2Z0VA 3PLTA 2Z0OA 3ABHA 3HAIA 4I1QA 4AVMA 4AKVA 1I4DA 2ELBA 4NSWA 2EFLA 2Q13A 2RAIA 4FZSA 3Q84A 4WPCA 3OK8A 3SYVA 3LLLA 5C5BB 3M3WA 3CAZA 3Q0KA 1X04A 3ACOA 3QE6A 2EFKA 2RAJA 2X3XA 3I2WA 4NQIA 4BNEA 2V0OA 2X3VA 3QWEA 3HAJA 1URUA 1WDZA 4H8SA 2C08A 3G9GA 3QNIA 2D1LA
chains in the Genus database with same CATH superfamily
3BVVA 4D8JA 4WPEA 3EJTA 1TQSA 1HTYA 4AVMA 3ABHA 3B53X 4FZSA 4JLCA 3B51X 3VEBA 3EJQA 4EZPA 3O3OB 1QWUA 3I2WA 4NQIA 1MJGA 1TQWA 3KAWA 2NCZA 3CZSA 4AZGA 4M0MA 3O3MB 1ZYLA 4AZBA 1Y2OA 2GAFD 4AZ7A 2MI7A 3BUBA 3HAIA 2F1AA 2LXYA 2FYVA 4HY9A 1X04A 3QE6A 2X3XA 4H6IA 2X5CA 3DPQA 2YIAA 1OAOA 3B52X 2EWFA 3I39X 2D4CA 1I49A 4DCNC 4ATMA 1OA0A 3SOGA 2KHOA 4AKVA 1E1DA 3KDRA 4EZTA 3BVXA 2GF4A 3CZNA 3DYTA 2JNKA 4EZXA 3EJPA 2YL6A 1HXKA 3BVUA 2EX3B 1W9MA 4B9QA 3BLBA 1E2UA 4E3CA 3BVWA 3BUIA 3QWEA 1URUA 4IM0A 4H8SA 3I04A 2D1LA 4KIKA 1UPXA 1I4TA 4IM2A 3LVTA 3RV0A 4DYLA 3D2FA 1TQTA 4G6QA 4UDXX 4KIKB 4JL9A 3I01A 3T48A 2ND1A 2ZXQA 3CKDA 4R5IA 2GA9D 4EZQA 4EZWA 3L3PA 1LQ7A 3QA8A 3QNJA 4EZRA 1R5EA 3DX3A 4JWDA 2ELBA 2Q13A 2OBMA 3GI7A 4R5GA 3ER9B 2Z8YA 3HAJA 2YI9A 4IWQA 1TQVA 3ERCC 3VEAA 3DPPA 3ER8C 1OA1A 4EZNA 4EZSA 3D51A 1U00A 4JWCA 4JWIA 2Z0OA 1QX1A 2LM0A 2OZNB 4JNEA 4AZHA 3D4ZA 3ACOA 4FZPA 2YLLA 1DKYA 4R5KA 1DKZA 1JQKA 3FD9A 1SU7A 5KBPA 4FM3A 4IWPA 4FZOA 4JNFA 4F00A 1I4DA 4EZZA 3Q84A 1PS3A 3CAZA 1TQUA 2RAJA 2X3VA 1HWWA 2JNSA 2RT6A 3EJSA 3D52A 2YIVX 4PO2A 4H6HA 1SUFA 4I1QA 1O7DC 1DKXA 4UDYX 3BUQA 1SU8A 5TKYA 3F7WA 2F18A 3DDGA 4AZCA 3DX2A 3BUPA 1ZWWA 3VKHA 1I4LA 3T47A 3C7NA 3L3OM 4AZCB 3D2EA 1X03A 3LMFA 3DX1A 4NSWA 2EFLA 2F7RA 3D50A 4WPCA 2YLAA 3OHXM 2YL5A 3Q0KA 2OW7A 3EJRA 1O7DB 3BUDA 2N3KA 2ND0A 3BVTA 4HYBA 3UITA 2Q12A 2ALWA 3HAHA 3CV5A 4IWOA 4E81A 4IM3A 2OO2A 3OK8A 3DPOA 2F7PA 3M3WA 5FLEX 3DX4A 2PMRA 2OBLA 2QKWA 4EZOA 3KAVA 2YL8A 5C5BA 1E9VA 3T4AG 1QWNA 3LLLA 5C5BB 4F01A 4AZ5A 4BNEA 3CVRA 2F1BA 1WDZA 2C08A 2WYHA 3QNIA 2QXLA 5E84A 1GN9A 2F7OA 3D4YA 2QFFA 2OW6A 2O0I1 4R5LA 2YKTA 2Z0VA 4HR1A 2PY6A 2YI8A 3RV1A 1GNTA 4HR1B 4JN4A 1YWMA 2RAKA 1R34A 2X3WA 2FICA 3PLTA 5FIGA 2WYIA 2WINM 2EFKA 4JWEA 1GNLA 2V0OA 3O3NB 2F7QA 4R5JA 4AZIA 3RPMA 2RAIA 3SYVA 4IW0A 2YIBA 4EZYA 2YL9A 3A98A 4EZUA 4EZVA 3EJUA 2Z0NA 1SU6A 3OWGA 3ZEDA 3T49A 4NPHA 3DX0A 4AZ6A 1R33A 3DDFA 3T46A 3G9GA
chains in the Genus database with same CATH topology
1ZWWA 2RAKA 1I4LA 1I4TA 2D4CA 3DYTA 2Q12A 2Z0NA 4DYLA 1I49A 4DCNC 4WPEA 2X3WA 4ATMA 1Y2OA 2YKTA 3SOGA 5C5BA 1X03A 2FICA 3HAHA 2Z0VA 3PLTA 2Z0OA 3ABHA 3HAIA 4I1QA 4AVMA 4AKVA 1I4DA 2ELBA 4NSWA 2EFLA 2Q13A 2RAIA 4FZSA 3Q84A 4WPCA 3OK8A 3SYVA 3LLLA 5C5BB 3M3WA 3CAZA 3Q0KA 1X04A 3ACOA 3QE6A 2EFKA 2RAJA 2X3XA 3I2WA 4NQIA 4BNEA 2V0OA 2X3VA 3QWEA 3HAJA 1URUA 1WDZA 4H8SA 2C08A 3G9GA 3QNIA 2D1LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZWW A;  2RAK A;  1I4L A;  1I4T A;  2D4C A;  3DYT A;  2Q12 A;  2Z0N A;  4DYL A;  1I49 A;  4DCN C;  4WPE A;  2X3W A;  4ATM A;  1Y2O A;  2YKT A;  3SOG A;  5C5B A;  1X03 A;  2FIC A;  3HAH A;  2Z0V A;  3PLT A;  2Z0O A;  3ABH A;  3HAI A;  4I1Q A;  4AVM A;  4AKV A;  1I4D A;  2ELB A;  4NSW A;  2EFL A;  2Q13 A;  2RAI A;  4FZS A;  3Q84 A;  4WPC A;  3OK8 A;  3SYV A;  3LLL A;  5C5B B;  3M3W A;  3CAZ A;  3Q0K A;  1X04 A;  3ACO A;  3QE6 A;  2EFK A;  2RAJ A;  2X3X A;  3I2W A;  4NQI A;  4BNE A;  2V0O A;  2X3V A;  3QWE A;  3HAJ A;  1URU A;  1WDZ A;  4H8S A;  2C08 A;  3G9G A;  3QNI A;  2D1L A; 
#chains in the Genus database with same CATH topology
 3BVV A;  4D8J A;  4WPE A;  3EJT A;  1TQS A;  1HTY A;  4AVM A;  3ABH A;  3B53 X;  4FZS A;  4JLC A;  3B51 X;  3VEB A;  3EJQ A;  4EZP A;  3O3O B;  1QWU A;  3I2W A;  4NQI A;  1MJG A;  1TQW A;  3KAW A;  2NCZ A;  3CZS A;  4AZG A;  4M0M A;  3O3M B;  1ZYL A;  4AZB A;  1Y2O A;  2GAF D;  4AZ7 A;  2MI7 A;  3BUB A;  3HAI A;  2F1A A;  2LXY A;  2FYV A;  4HY9 A;  1X04 A;  3QE6 A;  2X3X A;  4H6I A;  2X5C A;  3DPQ A;  2YIA A;  1OAO A;  3B52 X;  2EWF A;  3I39 X;  2D4C A;  1I49 A;  4DCN C;  4ATM A;  1OA0 A;  3SOG A;  2KHO A;  4AKV A;  1E1D A;  3KDR A;  4EZT A;  3BVX A;  2GF4 A;  3CZN A;  3DYT A;  2JNK A;  4EZX A;  3EJP A;  2YL6 A;  1HXK A;  3BVU A;  2EX3 B;  1W9M A;  4B9Q A;  3BLB A;  1E2U A;  4E3C A;  3BVW A;  3BUI A;  3QWE A;  1URU A;  4IM0 A;  4H8S A;  3I04 A;  2D1L A;  4KIK A;  1UPX A;  1I4T A;  4IM2 A;  3LVT A;  3RV0 A;  4DYL A;  3D2F A;  1TQT A;  4G6Q A;  4UDX X;  4KIK B;  4JL9 A;  3I01 A;  3T48 A;  2ND1 A;  2ZXQ A;  3CKD A;  4R5I A;  2GA9 D;  4EZQ A;  4EZW A;  3L3P A;  1LQ7 A;  3QA8 A;  3QNJ A;  4EZR A;  1R5E A;  3DX3 A;  4JWD A;  2ELB A;  2Q13 A;  2OBM A;  3GI7 A;  4R5G A;  3ER9 B;  2Z8Y A;  3HAJ A;  2YI9 A;  4IWQ A;  1TQV A;  3ERC C;  3VEA A;  3DPP A;  3ER8 C;  1OA1 A;  4EZN A;  4EZS A;  3D51 A;  1U00 A;  4JWC A;  4JWI A;  2Z0O A;  1QX1 A;  2LM0 A;  2OZN B;  4JNE A;  4AZH A;  3D4Z A;  3ACO A;  4FZP A;  2YLL A;  1DKY A;  4R5K A;  1DKZ A;  1JQK A;  3FD9 A;  1SU7 A;  5KBP A;  4FM3 A;  4IWP A;  4FZO A;  4JNF A;  4F00 A;  1I4D A;  4EZZ A;  3Q84 A;  1PS3 A;  3CAZ A;  1TQU A;  2RAJ A;  2X3V A;  1HWW A;  2JNS A;  2RT6 A;  3EJS A;  3D52 A;  2YIV X;  4PO2 A;  4H6H A;  1SUF A;  4I1Q A;  1O7D C;  1DKX A;  4UDY X;  3BUQ A;  1SU8 A;  5TKY A;  3F7W A;  2F18 A;  3DDG A;  4AZC A;  3DX2 A;  3BUP A;  1ZWW A;  3VKH A;  1I4L A;  3T47 A;  3C7N A;  3L3O M;  4AZC B;  3D2E A;  1X03 A;  3LMF A;  3DX1 A;  4NSW A;  2EFL A;  2F7R A;  3D50 A;  4WPC A;  2YLA A;  3OHX M;  2YL5 A;  3Q0K A;  2OW7 A;  3EJR A;  1O7D B;  3BUD A;  2N3K A;  2ND0 A;  3BVT A;  4HYB A;  3UIT A;  2Q12 A;  2ALW A;  3HAH A;  3CV5 A;  4IWO A;  4E81 A;  4IM3 A;  2OO2 A;  3OK8 A;  3DPO A;  2F7P A;  3M3W A;  5FLE X;  3DX4 A;  2PMR A;  2OBL A;  2QKW A;  4EZO A;  3KAV A;  2YL8 A;  5C5B A;  1E9V A;  3T4A G;  1QWN A;  3LLL A;  5C5B B;  4F01 A;  4AZ5 A;  4BNE A;  3CVR A;  2F1B A;  1WDZ A;  2C08 A;  2WYH A;  3QNI A;  2QXL A;  5E84 A;  1GN9 A;  2F7O A;  3D4Y A;  2QFF A;  2OW6 A;  2O0I 1;  4R5L A;  2YKT A;  2Z0V A;  4HR1 A;  2PY6 A;  2YI8 A;  3RV1 A;  1GNT A;  4HR1 B;  4JN4 A;  1YWM A;  2RAK A;  1R34 A;  2X3W A;  2FIC A;  3PLT A;  5FIG A;  2WYI A;  2WIN M;  2EFK A;  4JWE A;  1GNL A;  2V0O A;  3O3N B;  2F7Q A;  4R5J A;  4AZI A;  3RPM A;  2RAI A;  3SYV A;  4IW0 A;  2YIB A;  4EZY A;  2YL9 A;  3A98 A;  4EZU A;  4EZV A;  3EJU A;  2Z0N A;  1SU6 A;  3OWG A;  3ZED A;  3T49 A;  4NPH A;  3DX0 A;  4AZ6 A;  1R33 A;  3DDF A;  3T46 A;  3G9G A; 
#chains in the Genus database with same CATH homology
 1ZWW A;  2RAK A;  1I4L A;  1I4T A;  2D4C A;  3DYT A;  2Q12 A;  2Z0N A;  4DYL A;  1I49 A;  4DCN C;  4WPE A;  2X3W A;  4ATM A;  1Y2O A;  2YKT A;  3SOG A;  5C5B A;  1X03 A;  2FIC A;  3HAH A;  2Z0V A;  3PLT A;  2Z0O A;  3ABH A;  3HAI A;  4I1Q A;  4AVM A;  4AKV A;  1I4D A;  2ELB A;  4NSW A;  2EFL A;  2Q13 A;  2RAI A;  4FZS A;  3Q84 A;  4WPC A;  3OK8 A;  3SYV A;  3LLL A;  5C5B B;  3M3W A;  3CAZ A;  3Q0K A;  1X04 A;  3ACO A;  3QE6 A;  2EFK A;  2RAJ A;  2X3X A;  3I2W A;  4NQI A;  4BNE A;  2V0O A;  2X3V A;  3QWE A;  3HAJ A;  1URU A;  1WDZ A;  4H8S A;  2C08 A;  3G9G A;  3QNI A;  2D1L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...