2X3WA

Structure of mouse syndapin i (crystal form 2)
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
291
structure length
291
Chain Sequence
DSFWEVGNYKRTVKRIDDGHRLCNDLMSCVQERAKIEKAYAQQLTDWAKRWRQLIEKGPQYGSLERAWGAMMTEADKVSELHQEVKNSLLNEDLEKVKNWQKDAYHKQIMGGFKETKEAEDGFRKAQKPWAKKMKELEAAKKAYHLACKEERLAMTREMNSKTEQSVTPEQQKKLVDKVDKCRQDVQKTQEKYEKVLEDVGKTTPQYMEGMEQVFEQCQQFEEKRLVFLKEVLLDIKRHLNLAENSSYMHVYRELEQAIRGADAQEDLRWFRSTSGPGMPMNWPQFEEWNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN KINASE C AND CASEIN KINASE SUBSTRATE IN NEURONS PROT
publication title Molecular Basis for SH3 Domain Regulation of F-Bar-Mediated Membrane Deformation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Endocytosis
total genus 126
structure length 291
sequence length 291
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00611 FCH Fes/CIP4, and EFC/F-BAR homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 2x3wA01
4WPEA 2RAKA 3PLTA 2Q13A 3CAZA 2Z0OA 2RAIA 1ZWWA 3HAJA 3ACOA 2EFKA 3QNIA 4NQIA 3ABHA 4WPCA 1URUA 1I4LA 3Q84A 2X3XA 1I49A 1WDZA 2EFLA 3DYTA 5C5BB 4ATMA 1I4DA 2D4CA 3HAIA 4BNEA 1Y2OA 2FICA 2V0OA 1X04A 2RAJA 2C08A 4NSWA 5C5BA 4DYLA 2X3VA 3M3WA 2X3WA 3G9GA 2ELBA 3OK8A 4H8SA 3SOGA 4AKVA 4AVMA 3HAHA 1I4TA 3LLLA 4FZSA 1X03A 2Z0VA 3QE6A 3SYVA 4I1QA 3QWEA 3Q0KA 2Q12A 3I2WA 2YKTA 4DCNC 2D1LA 2Z0NA
chains in the Genus database with same CATH superfamily
1HWWA 3DPOA 2F1AA 3CAZA 3DPPA 4EZOA 2OBMA 4NQIA 1URUA 3BUBA 3Q84A 4EZVA 3D2FA 5C5BB 3D4ZA 4EZZA 1X04A 5C5BA 4H6HA 1E1DA 1O7DB 2QKWA 4IWPA 4R5IA 1QWUA 4DCNC 2YI9A 3VEAA 3DX4A 1I49A 4F01A 3T48A 2FYVA 1Y2OA 2F7RA 4NPHA 2MI7A 1MJGA 3G9GA 4AZBA 4AVMA 3I39X 3ZEDA 1R33A 4HR1B 3A98A 4E81A 3DX2A 2YKTA 4HR1A 3OWGA 3BLBA 2Q13A 1JQKA 2YLLA 2WYIA 4IM3A 3BVTA 1O7DC 2OBLA 3DX3A 3CZSA 2GAFD 1GN9A 4M0MA 4JLCA 1U00A 4PO2A 3T47A 2EWFA 1X03A 3Q0KA 3I2WA 3VKHA 1E9VA 2F18A 1W9MA 3D50A 3BVXA 4HY9A 4UDYX 4ATMA 3BVVA 2WYHA 1DKZA 1TQTA 2X3WA 4H8SA 4EZRA 2EX3B 4I1QA 3EJRA 4UDXX 4IWOA 2D1LA 4AZ6A 2ND0A 1UPXA 1ZWWA 3ACOA 3BUIA 2EFLA 4JWDA 3ERCC 4B9QA 2C08A 1TQSA 2ND1A 4JWCA 3HAHA 4HYBA 4IW0A 4R5KA 3GI7A 3VEBA 1E2UA 3D2EA 4AZHA 3CVRA 3DDFA 3ER8C 2X3XA 3BVWA 4FM3A 2Z8YA 1GNTA 3OK8A 3CZNA 4FZSA 5FIGA 3D4YA 3CV5A 4H6IA 4JL9A 1HXKA 3O3OB 3ER9B 3KDRA 4BNEA 3OHXM 4DYLA 3T49A 2X3VA 3BUDA 3SOGA 1TQVA 4R5GA 2N3KA 2RAIA 4IWQA 1I4LA 3L3OM 1SU8A 2FICA 4IM0A 3QA8A 4G6QA 5TKYA 2X5CA 2Z0VA 4EZTA 3DDGA 1QWNA 1OAOA 3KAWA 2OZNB 4EZNA 2EFKA 2F7QA 1SU7A 3B52X 3EJUA 3UITA 4EZUA 4NSWA 4FZPA 2ELBA 4R5LA 1I4TA 4AZCB 3B51X 4R5JA 4E3CA 4AZCA 3DX1A 4KIKB 3RPMA 4KIKA 4AZGA 2YL5A 3O3MB 4WPCA 3FD9A 3DX0A 1ZYLA 1QX1A 5E84A 2YIAA 2O0I1 2PMRA 3QWEA 1LQ7A 1OA1A 2OW7A 2GF4A 1YWMA 2Z0OA 3D52A 1I4DA 1TQWA 2F1BA 4EZPA 2LM0A 4AKVA 3QNJA 3I04A 3CKDA 2OW6A 1SUFA 3F7WA 1GNLA 1WDZA 4EZXA 1OA0A 5KBPA 3D51A 1R5EA 3LLLA 4D8JA 1R34A 4EZSA 3O3NB 4WPEA 2RAKA 3EJQA 2F7PA 2JNKA 2KHOA 2WINM 4JWIA 3HAJA 3KAVA 2ALWA 3BUPA 4JNEA 3I01A 3DYTA 2JNSA 2V0OA 2RAJA 3RV0A 4AZ5A 3M3WA 2YI8A 3B53X 4F00A 3T46A 1PS3A 1SU6A 3QE6A 2PY6A 2YL9A 2RT6A 1DKXA 2Z0NA 3DPQA 3PLTA 2QXLA 2YIVX 3QNIA 3ABHA 4EZWA 4JWEA 3C7NA 4JNFA 2OO2A 3BUQA 4IM2A 2YIBA 4EZQA 2NCZA 2ZXQA 3T4AG 3EJPA 2D4CA 1DKYA 2LXYA 2YL8A 3EJTA 4JN4A 3RV1A 1TQUA 4FZOA 2YL6A 5FLEX 2F7OA 4EZYA 3L3PA 4AZ7A 4AZIA 3HAIA 1HTYA 3BVUA 3LMFA 2GA9D 3EJSA 2YLAA 3SYVA 2Q12A 2QFFA 3LVTA
chains in the Genus database with same CATH topology
4WPEA 2RAKA 3PLTA 2Q13A 3CAZA 2Z0OA 2RAIA 1ZWWA 3HAJA 3ACOA 2EFKA 3QNIA 4NQIA 3ABHA 4WPCA 1URUA 1I4LA 3Q84A 2X3XA 1I49A 1WDZA 2EFLA 3DYTA 5C5BB 4ATMA 1I4DA 2D4CA 3HAIA 4BNEA 1Y2OA 2FICA 2V0OA 1X04A 2RAJA 2C08A 4NSWA 5C5BA 4DYLA 2X3VA 3M3WA 2X3WA 3G9GA 2ELBA 3OK8A 4H8SA 3SOGA 4AKVA 4AVMA 3HAHA 1I4TA 3LLLA 4FZSA 1X03A 2Z0VA 3QE6A 3SYVA 4I1QA 3QWEA 3Q0KA 2Q12A 3I2WA 2YKTA 4DCNC 2D1LA 2Z0NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WPE A;  2RAK A;  3PLT A;  2Q13 A;  3CAZ A;  2Z0O A;  2RAI A;  1ZWW A;  3HAJ A;  3ACO A;  2EFK A;  3QNI A;  4NQI A;  3ABH A;  4WPC A;  1URU A;  1I4L A;  3Q84 A;  2X3X A;  1I49 A;  1WDZ A;  2EFL A;  3DYT A;  5C5B B;  4ATM A;  1I4D A;  2D4C A;  3HAI A;  4BNE A;  1Y2O A;  2FIC A;  2V0O A;  1X04 A;  2RAJ A;  2C08 A;  4NSW A;  5C5B A;  4DYL A;  2X3V A;  3M3W A;  2X3W A;  3G9G A;  2ELB A;  3OK8 A;  4H8S A;  3SOG A;  4AKV A;  4AVM A;  3HAH A;  1I4T A;  3LLL A;  4FZS A;  1X03 A;  2Z0V A;  3QE6 A;  3SYV A;  4I1Q A;  3QWE A;  3Q0K A;  2Q12 A;  3I2W A;  2YKT A;  4DCN C;  2D1L A;  2Z0N A; 
#chains in the Genus database with same CATH topology
 1HWW A;  3DPO A;  2F1A A;  3CAZ A;  3DPP A;  4EZO A;  2OBM A;  4NQI A;  1URU A;  3BUB A;  3Q84 A;  4EZV A;  3D2F A;  5C5B B;  3D4Z A;  4EZZ A;  1X04 A;  5C5B A;  4H6H A;  1E1D A;  1O7D B;  2QKW A;  4IWP A;  4R5I A;  1QWU A;  4DCN C;  2YI9 A;  3VEA A;  3DX4 A;  1I49 A;  4F01 A;  3T48 A;  2FYV A;  1Y2O A;  2F7R A;  4NPH A;  2MI7 A;  1MJG A;  3G9G A;  4AZB A;  4AVM A;  3I39 X;  3ZED A;  1R33 A;  4HR1 B;  3A98 A;  4E81 A;  3DX2 A;  2YKT A;  4HR1 A;  3OWG A;  3BLB A;  2Q13 A;  1JQK A;  2YLL A;  2WYI A;  4IM3 A;  3BVT A;  1O7D C;  2OBL A;  3DX3 A;  3CZS A;  2GAF D;  1GN9 A;  4M0M A;  4JLC A;  1U00 A;  4PO2 A;  3T47 A;  2EWF A;  1X03 A;  3Q0K A;  3I2W A;  3VKH A;  1E9V A;  2F18 A;  1W9M A;  3D50 A;  3BVX A;  4HY9 A;  4UDY X;  4ATM A;  3BVV A;  2WYH A;  1DKZ A;  1TQT A;  2X3W A;  4H8S A;  4EZR A;  2EX3 B;  4I1Q A;  3EJR A;  4UDX X;  4IWO A;  2D1L A;  4AZ6 A;  2ND0 A;  1UPX A;  1ZWW A;  3ACO A;  3BUI A;  2EFL A;  4JWD A;  3ERC C;  4B9Q A;  2C08 A;  1TQS A;  2ND1 A;  4JWC A;  3HAH A;  4HYB A;  4IW0 A;  4R5K A;  3GI7 A;  3VEB A;  1E2U A;  3D2E A;  4AZH A;  3CVR A;  3DDF A;  3ER8 C;  2X3X A;  3BVW A;  4FM3 A;  2Z8Y A;  1GNT A;  3OK8 A;  3CZN A;  4FZS A;  5FIG A;  3D4Y A;  3CV5 A;  4H6I A;  4JL9 A;  1HXK A;  3O3O B;  3ER9 B;  3KDR A;  4BNE A;  3OHX M;  4DYL A;  3T49 A;  2X3V A;  3BUD A;  3SOG A;  1TQV A;  4R5G A;  2N3K A;  2RAI A;  4IWQ A;  1I4L A;  3L3O M;  1SU8 A;  2FIC A;  4IM0 A;  3QA8 A;  4G6Q A;  5TKY A;  2X5C A;  2Z0V A;  4EZT A;  3DDG A;  1QWN A;  1OAO A;  3KAW A;  2OZN B;  4EZN A;  2EFK A;  2F7Q A;  1SU7 A;  3B52 X;  3EJU A;  3UIT A;  4EZU A;  4NSW A;  4FZP A;  2ELB A;  4R5L A;  1I4T A;  4AZC B;  3B51 X;  4R5J A;  4E3C A;  4AZC A;  3DX1 A;  4KIK B;  3RPM A;  4KIK A;  4AZG A;  2YL5 A;  3O3M B;  4WPC A;  3FD9 A;  3DX0 A;  1ZYL A;  1QX1 A;  5E84 A;  2YIA A;  2O0I 1;  2PMR A;  3QWE A;  1LQ7 A;  1OA1 A;  2OW7 A;  2GF4 A;  1YWM A;  2Z0O A;  3D52 A;  1I4D A;  1TQW A;  2F1B A;  4EZP A;  2LM0 A;  4AKV A;  3QNJ A;  3I04 A;  3CKD A;  2OW6 A;  1SUF A;  3F7W A;  1GNL A;  1WDZ A;  4EZX A;  1OA0 A;  5KBP A;  3D51 A;  1R5E A;  3LLL A;  4D8J A;  1R34 A;  4EZS A;  3O3N B;  4WPE A;  2RAK A;  3EJQ A;  2F7P A;  2JNK A;  2KHO A;  2WIN M;  4JWI A;  3HAJ A;  3KAV A;  2ALW A;  3BUP A;  4JNE A;  3I01 A;  3DYT A;  2JNS A;  2V0O A;  2RAJ A;  3RV0 A;  4AZ5 A;  3M3W A;  2YI8 A;  3B53 X;  4F00 A;  3T46 A;  1PS3 A;  1SU6 A;  3QE6 A;  2PY6 A;  2YL9 A;  2RT6 A;  1DKX A;  2Z0N A;  3DPQ A;  3PLT A;  2QXL A;  2YIV X;  3QNI A;  3ABH A;  4EZW A;  4JWE A;  3C7N A;  4JNF A;  2OO2 A;  3BUQ A;  4IM2 A;  2YIB A;  4EZQ A;  2NCZ A;  2ZXQ A;  3T4A G;  3EJP A;  2D4C A;  1DKY A;  2LXY A;  2YL8 A;  3EJT A;  4JN4 A;  3RV1 A;  1TQU A;  4FZO A;  2YL6 A;  5FLE X;  2F7O A;  4EZY A;  3L3P A;  4AZ7 A;  4AZI A;  3HAI A;  1HTY A;  3BVU A;  3LMF A;  2GA9 D;  3EJS A;  2YLA A;  3SYV A;  2Q12 A;  2QFF A;  3LVT A; 
#chains in the Genus database with same CATH homology
 4WPE A;  2RAK A;  3PLT A;  2Q13 A;  3CAZ A;  2Z0O A;  2RAI A;  1ZWW A;  3HAJ A;  3ACO A;  2EFK A;  3QNI A;  4NQI A;  3ABH A;  4WPC A;  1URU A;  1I4L A;  3Q84 A;  2X3X A;  1I49 A;  1WDZ A;  2EFL A;  3DYT A;  5C5B B;  4ATM A;  1I4D A;  2D4C A;  3HAI A;  4BNE A;  1Y2O A;  2FIC A;  2V0O A;  1X04 A;  2RAJ A;  2C08 A;  4NSW A;  5C5B A;  4DYL A;  2X3V A;  3M3W A;  2X3W A;  3G9G A;  2ELB A;  3OK8 A;  4H8S A;  3SOG A;  4AKV A;  4AVM A;  3HAH A;  1I4T A;  3LLL A;  4FZS A;  1X03 A;  2Z0V A;  3QE6 A;  3SYV A;  4I1Q A;  3QWE A;  3Q0K A;  2Q12 A;  3I2W A;  2YKT A;  4DCN C;  2D1L A;  2Z0N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...