2X3WA

Structure of mouse syndapin i (crystal form 2)
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
291
structure length
291
Chain Sequence
DSFWEVGNYKRTVKRIDDGHRLCNDLMSCVQERAKIEKAYAQQLTDWAKRWRQLIEKGPQYGSLERAWGAMMTEADKVSELHQEVKNSLLNEDLEKVKNWQKDAYHKQIMGGFKETKEAEDGFRKAQKPWAKKMKELEAAKKAYHLACKEERLAMTREMNSKTEQSVTPEQQKKLVDKVDKCRQDVQKTQEKYEKVLEDVGKTTPQYMEGMEQVFEQCQQFEEKRLVFLKEVLLDIKRHLNLAENSSYMHVYRELEQAIRGADAQEDLRWFRSTSGPGMPMNWPQFEEWNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis
molecule keywords PROTEIN KINASE C AND CASEIN KINASE SUBSTRATE IN NEURONS PROT
publication title Molecular Basis for SH3 Domain Regulation of F-Bar-Mediated Membrane Deformation.
pubmed doi rcsb
source organism Mus musculus
total genus 126
structure length 291
sequence length 291
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00611 FCH Fes/CIP4, and EFC/F-BAR homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 2x3wA01
2EFLA 3I2WA 1X03A 3QE6A 4NSWA 4BNEA 2D1LA 3HAHA 2YKTA 2FICA 2Z0NA 3ABHA 4AVMA 1I49A 2X3XA 3LLLA 3HAJA 3PLTA 2X3WA 4H8SA 4DYLA 1I4LA 2RAIA 3QNIA 2V0OA 1I4DA 2D4CA 3CAZA 2Z0OA 1Y2OA 2Q13A 4WPCA 3SYVA 1X04A 3DYTA 5C5BB 5C5BA 2ELBA 3M3WA 4DCNC 1I4TA 3SOGA 4WPEA 3Q84A 2RAJA 2RAKA 2X3VA 4AKVA 2C08A 4FZSA 4I1QA 4ATMA 1URUA 2Z0VA 3G9GA 1WDZA 1ZWWA 3OK8A 4NQIA 3QWEA 2Q12A 3HAIA 2EFKA 3Q0KA 3ACOA
chains in the Genus database with same CATH superfamily
2EFLA 3OHXM 4EZTA 2FYVA 3CKDA 4IW0A 2D4CA 4WPCA 1X04A 2ND1A 1SUFA 3DYTA 3DX0A 1GNLA 2YL5A 1TQTA 3QWEA 3D2FA 2Z0NA 3ABHA 1I49A 2X3XA 4PO2A 4AZBA 4E81A 4AZIA 4R5GA 3F7WA 3T4AG 4AZ7A 4EZNA 1ZWWA 1TQUA 2F1BA 3KAWA 3RV0A 2OZNB 2YIAA 1I4LA 2RAIA 5FIGA 1OA1A 3BUIA 3DDFA 2Q13A 5KBPA 2F7RA 3CZNA 1HXKA 3BVVA 4HY9A 1E9VA 2PMRA 4UDXX 4JN4A 2Q12A 2YI9A 4AZCB 2ND0A 1X03A 2YKTA 2GF4A 3B51X 4H6IA 4EZYA 3B53X 4E3CA 1HWWA 4JWDA 3UITA 1DKXA 1GNTA 2GA9D 3T47A 2ELBA 1MJGA 4IWOA 2RAKA 4B9QA 3BVUA 2N3KA 4AZCA 3B52X 4EZOA 3BUDA 3DX2A 1UPXA 1ZYLA 3KAVA 1I4TA 4R5KA 2X3VA 2Z8YA 4I1QA 1URUA 3DPPA 3Q0KA 4EZUA 4JWCA 4AVMA 4AZHA 1OA0A 4F00A 2O0I1 1SU8A 4R5LA 3QNIA 2Z0OA 4IM0A 4F01A 2YIBA 4EZWA 5C5BA 3T49A 1O7DB 4IWQA 2F18A 3O3NB 4JL9A 4AKVA 2WYIA 3BVWA 4JNFA 3RPMA 2RT6A 2QFFA 4M0MA 3I39X 2QXLA 1E1DA 4KIKA 3EJRA 2JNSA 2OBLA 4JNEA 2OW6A 3SOGA 3L3PA 3D51A 3D50A 3DX4A 4EZXA 4NSWA 2EFKA 3RV1A 2D1LA 3DX1A 2FICA 1U00A 4EZZA 3KDRA 2V0OA 3FD9A 1O7DC 5E84A 3D4ZA 2GAFD 2PY6A 1R5EA 3PLTA 2LM0A 3T48A 2EWFA 5FLEX 4AZ6A 1I4DA 1W9MA 4JWEA 4IWPA 3BVTA 3CZSA 2F7OA 2RAJA 3DPQA 3CVRA 2Z0VA 3A98A 4FZOA 4DCNC 1JQKA 1QX1A 3DPOA 4WPEA 3LVTA 2X3WA 1GN9A 3BUQA 2ALWA 3QA8A 5C5BB 2KHOA 2F7QA 4EZRA 3EJPA 2F7PA 4IM3A 1OAOA 3QE6A 1R33A 4KIKB 1QWUA 4IM2A 4JWIA 1WDZA 3OWGA 3LLLA 2NCZA 4H8SA 3HAJA 3C7NA 3EJSA 2ZXQA 3T46A 1SU7A 4EZVA 3VEAA 4D8JA 2YIVX 4HR1A 4R5IA 5TKYA 3BVXA 1TQWA 3D2EA 3O3MB 1DKYA 2OBMA 3BLBA 3I04A 4AZGA 3OK8A 2YL9A 2QKWA 1TQSA 2WYHA 1SU6A 4DYLA 3CAZA 1Y2OA 2YLAA 3M3WA 2JNKA 4EZSA 2WINM 4G6QA 4ATMA 3HAIA 3I2WA 3HAHA 2YL6A 2OO2A 2EX3B 3ER8C 4UDYX 3O3OB 3CV5A 1HTYA 3ER9B 1QWNA 3ZEDA 3VKHA 1DKZA 4FZSA 3LMFA 3GI7A 2YI8A 1LQ7A 3ERCC 3ACOA 3DDGA 3L3OM 4BNEA 1TQVA 3QNJA 3EJTA 2OW7A 1PS3A 3SYVA 4EZPA 4FM3A 1YWMA 3I01A 3Q84A 2X5CA 3D4YA 3EJUA 2C08A 3DX3A 2F1AA 2YL8A 4NPHA 4EZQA 2MI7A 3VEBA 3BUBA 4H6HA 2LXYA 1E2UA 4HYBA 4AZ5A 4FZPA 3D52A 4HR1B 3EJQA 2YLLA 4R5JA 4JLCA 1R34A 3G9GA 4NQIA 3BUPA
chains in the Genus database with same CATH topology
2EFLA 3I2WA 1X03A 3QE6A 4NSWA 4BNEA 2D1LA 3HAHA 2YKTA 2FICA 2Z0NA 3ABHA 4AVMA 1I49A 2X3XA 3LLLA 3HAJA 3PLTA 2X3WA 4H8SA 4DYLA 1I4LA 2RAIA 3QNIA 2V0OA 1I4DA 2D4CA 3CAZA 2Z0OA 1Y2OA 2Q13A 4WPCA 3SYVA 1X04A 3DYTA 5C5BB 5C5BA 2ELBA 3M3WA 4DCNC 1I4TA 3SOGA 4WPEA 3Q84A 2RAJA 2RAKA 2X3VA 4AKVA 2C08A 4FZSA 4I1QA 4ATMA 1URUA 2Z0VA 3G9GA 1WDZA 1ZWWA 3OK8A 4NQIA 3QWEA 2Q12A 3HAIA 2EFKA 3Q0KA 3ACOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EFL A;  3I2W A;  1X03 A;  3QE6 A;  4NSW A;  4BNE A;  2D1L A;  3HAH A;  2YKT A;  2FIC A;  2Z0N A;  3ABH A;  4AVM A;  1I49 A;  2X3X A;  3LLL A;  3HAJ A;  3PLT A;  2X3W A;  4H8S A;  4DYL A;  1I4L A;  2RAI A;  3QNI A;  2V0O A;  1I4D A;  2D4C A;  3CAZ A;  2Z0O A;  1Y2O A;  2Q13 A;  4WPC A;  3SYV A;  1X04 A;  3DYT A;  5C5B B;  5C5B A;  2ELB A;  3M3W A;  4DCN C;  1I4T A;  3SOG A;  4WPE A;  3Q84 A;  2RAJ A;  2RAK A;  2X3V A;  4AKV A;  2C08 A;  4FZS A;  4I1Q A;  4ATM A;  1URU A;  2Z0V A;  3G9G A;  1WDZ A;  1ZWW A;  3OK8 A;  4NQI A;  3QWE A;  2Q12 A;  3HAI A;  2EFK A;  3Q0K A;  3ACO A; 
#chains in the Genus database with same CATH topology
 2EFL A;  3OHX M;  4EZT A;  2FYV A;  3CKD A;  4IW0 A;  2D4C A;  4WPC A;  1X04 A;  2ND1 A;  1SUF A;  3DYT A;  3DX0 A;  1GNL A;  2YL5 A;  1TQT A;  3QWE A;  3D2F A;  2Z0N A;  3ABH A;  1I49 A;  2X3X A;  4PO2 A;  4AZB A;  4E81 A;  4AZI A;  4R5G A;  3F7W A;  3T4A G;  4AZ7 A;  4EZN A;  1ZWW A;  1TQU A;  2F1B A;  3KAW A;  3RV0 A;  2OZN B;  2YIA A;  1I4L A;  2RAI A;  5FIG A;  1OA1 A;  3BUI A;  3DDF A;  2Q13 A;  5KBP A;  2F7R A;  3CZN A;  1HXK A;  3BVV A;  4HY9 A;  1E9V A;  2PMR A;  4UDX X;  4JN4 A;  2Q12 A;  2YI9 A;  4AZC B;  2ND0 A;  1X03 A;  2YKT A;  2GF4 A;  3B51 X;  4H6I A;  4EZY A;  3B53 X;  4E3C A;  1HWW A;  4JWD A;  3UIT A;  1DKX A;  1GNT A;  2GA9 D;  3T47 A;  2ELB A;  1MJG A;  4IWO A;  2RAK A;  4B9Q A;  3BVU A;  2N3K A;  4AZC A;  3B52 X;  4EZO A;  3BUD A;  3DX2 A;  1UPX A;  1ZYL A;  3KAV A;  1I4T A;  4R5K A;  2X3V A;  2Z8Y A;  4I1Q A;  1URU A;  3DPP A;  3Q0K A;  4EZU A;  4JWC A;  4AVM A;  4AZH A;  1OA0 A;  4F00 A;  2O0I 1;  1SU8 A;  4R5L A;  3QNI A;  2Z0O A;  4IM0 A;  4F01 A;  2YIB A;  4EZW A;  5C5B A;  3T49 A;  1O7D B;  4IWQ A;  2F18 A;  3O3N B;  4JL9 A;  4AKV A;  2WYI A;  3BVW A;  4JNF A;  3RPM A;  2RT6 A;  2QFF A;  4M0M A;  3I39 X;  2QXL A;  1E1D A;  4KIK A;  3EJR A;  2JNS A;  2OBL A;  4JNE A;  2OW6 A;  3SOG A;  3L3P A;  3D51 A;  3D50 A;  3DX4 A;  4EZX A;  4NSW A;  2EFK A;  3RV1 A;  2D1L A;  3DX1 A;  2FIC A;  1U00 A;  4EZZ A;  3KDR A;  2V0O A;  3FD9 A;  1O7D C;  5E84 A;  3D4Z A;  2GAF D;  2PY6 A;  1R5E A;  3PLT A;  2LM0 A;  3T48 A;  2EWF A;  5FLE X;  4AZ6 A;  1I4D A;  1W9M A;  4JWE A;  4IWP A;  3BVT A;  3CZS A;  2F7O A;  2RAJ A;  3DPQ A;  3CVR A;  2Z0V A;  3A98 A;  4FZO A;  4DCN C;  1JQK A;  1QX1 A;  3DPO A;  4WPE A;  3LVT A;  2X3W A;  1GN9 A;  3BUQ A;  2ALW A;  3QA8 A;  5C5B B;  2KHO A;  2F7Q A;  4EZR A;  3EJP A;  2F7P A;  4IM3 A;  1OAO A;  3QE6 A;  1R33 A;  4KIK B;  1QWU A;  4IM2 A;  4JWI A;  1WDZ A;  3OWG A;  3LLL A;  2NCZ A;  4H8S A;  3HAJ A;  3C7N A;  3EJS A;  2ZXQ A;  3T46 A;  1SU7 A;  4EZV A;  3VEA A;  4D8J A;  2YIV X;  4HR1 A;  4R5I A;  5TKY A;  3BVX A;  1TQW A;  3D2E A;  3O3M B;  1DKY A;  2OBM A;  3BLB A;  3I04 A;  4AZG A;  3OK8 A;  2YL9 A;  2QKW A;  1TQS A;  2WYH A;  1SU6 A;  4DYL A;  3CAZ A;  1Y2O A;  2YLA A;  3M3W A;  2JNK A;  4EZS A;  2WIN M;  4G6Q A;  4ATM A;  3HAI A;  3I2W A;  3HAH A;  2YL6 A;  2OO2 A;  2EX3 B;  3ER8 C;  4UDY X;  3O3O B;  3CV5 A;  1HTY A;  3ER9 B;  1QWN A;  3ZED A;  3VKH A;  1DKZ A;  4FZS A;  3LMF A;  3GI7 A;  2YI8 A;  1LQ7 A;  3ERC C;  3ACO A;  3DDG A;  3L3O M;  4BNE A;  1TQV A;  3QNJ A;  3EJT A;  2OW7 A;  1PS3 A;  3SYV A;  4EZP A;  4FM3 A;  1YWM A;  3I01 A;  3Q84 A;  2X5C A;  3D4Y A;  3EJU A;  2C08 A;  3DX3 A;  2F1A A;  2YL8 A;  4NPH A;  4EZQ A;  2MI7 A;  3VEB A;  3BUB A;  4H6H A;  2LXY A;  1E2U A;  4HYB A;  4AZ5 A;  4FZP A;  3D52 A;  4HR1 B;  3EJQ A;  2YLL A;  4R5J A;  4JLC A;  1R34 A;  3G9G A;  4NQI A;  3BUP A; 
#chains in the Genus database with same CATH homology
 2EFL A;  3I2W A;  1X03 A;  3QE6 A;  4NSW A;  4BNE A;  2D1L A;  3HAH A;  2YKT A;  2FIC A;  2Z0N A;  3ABH A;  4AVM A;  1I49 A;  2X3X A;  3LLL A;  3HAJ A;  3PLT A;  2X3W A;  4H8S A;  4DYL A;  1I4L A;  2RAI A;  3QNI A;  2V0O A;  1I4D A;  2D4C A;  3CAZ A;  2Z0O A;  1Y2O A;  2Q13 A;  4WPC A;  3SYV A;  1X04 A;  3DYT A;  5C5B B;  5C5B A;  2ELB A;  3M3W A;  4DCN C;  1I4T A;  3SOG A;  4WPE A;  3Q84 A;  2RAJ A;  2RAK A;  2X3V A;  4AKV A;  2C08 A;  4FZS A;  4I1Q A;  4ATM A;  1URU A;  2Z0V A;  3G9G A;  1WDZ A;  1ZWW A;  3OK8 A;  4NQI A;  3QWE A;  2Q12 A;  3HAI A;  2EFK A;  3Q0K A;  3ACO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...